Symbol:
Yy1
Name:
YY1 transcription factor
RGD ID:
3982
Description:
Enables sequence-specific DNA binding activity. Involved in several processes, including cellular response to interleukin-1; negative regulation of cell growth involved in cardiac muscle cell development; and regulation of transcription by RNA polymerase II. Located in nuclear matrix. Part of transcription regulator complex. Used to study type 1 diabetes mellitus. Biomarker of type 1 diabetes mellitus. Human ortholog(s) of this gene implicated in congestive heart failure. Orthologous to human YY1 (YY1 transcription factor); PARTICIPATES IN INO80 family mediated chromatin remodeling pathway; mTOR signaling pathway; Notch signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 2,4-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
NF-E1; NMP-1; NMP1; transcriptional repressor protein YY1; UCRBP
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
YY1 (YY1 transcription factor) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Yy1 (YY1 transcription factor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Yy1 (YY1 transcription factor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
YY1 (YY1 transcription factor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
YY1 (YY1 transcription factor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Yy1 (YY1 transcription factor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
YY1 (YY1 transcription factor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
YY1 (YY1 transcription factor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Yy1 (YY1 transcription factor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
YY2 (YY2 transcription factor) HGNC
Panther
Alliance orthologs 3
Mus musculus (house mouse):
Yy1 (YY1 transcription factor)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Homo sapiens (human):
YY1 (YY1 transcription factor)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Danio rerio (zebrafish):
yy1a (YY1 transcription factor a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
yy1b (YY1 transcription factor b)
Alliance
DIOPT (Ensembl Compara|OrthoInspector|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
pho
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
yy1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 133,471,615 - 133,500,875 (+) NCBI GRCr8 mRatBN7.2 6 127,706,739 - 127,736,499 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 127,707,596 - 127,732,747 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 127,830,843 - 127,855,090 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 128,125,889 - 128,150,136 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 127,484,792 - 127,509,137 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 132,702,443 - 132,726,848 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 132,702,448 - 132,727,046 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 141,872,505 - 141,896,924 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 133,132,419 - 133,156,686 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 133,138,605 - 133,162,873 (+) NCBI Celera 6 125,273,530 - 125,282,803 (+) NCBI Celera Cytogenetic Map 6 q32 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Yy1 Rat (R,R,R)-alpha-tocopherol multiple interactions ISO YY1 (Homo sapiens) 6480464 alpha-Tocopherol inhibits the reaction [[manganese chloride results in increased abundance of Manganese] which results in increased expression of YY1 mRNA] and alpha-Tocopherol inhibits the reaction [[manganese chloride results in increased abundance of Manganese] which results in increased expression of YY1 protein] CTD PMID:34310962 Yy1 Rat 1,2-dimethylhydrazine decreases expression ISO Yy1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of YY1 mRNA CTD PMID:22206623 Yy1 Rat 1-naphthyl isothiocyanate affects binding ISO YY1 (Homo sapiens) 6480464 1-Naphthylisothiocyanate binds to YY1 protein CTD PMID:39368342 Yy1 Rat 1-naphthyl isothiocyanate increases expression ISO Yy1 (Mus musculus) 6480464 1-Naphthylisothiocyanate results in increased expression of YY1 protein CTD PMID:39368342 Yy1 Rat 1-naphthyl isothiocyanate increases expression ISO YY1 (Homo sapiens) 6480464 1-Naphthylisothiocyanate results in increased expression of YY1 protein CTD PMID:39368342 Yy1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Yy1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of YY1 mRNA CTD PMID:21570461 and PMID:24058054 Yy1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of YY1 mRNA CTD PMID:33387578 Yy1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Yy1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of YY1 mRNA CTD PMID:25270620 Yy1 Rat 2,3,7,8-Tetrachlorodibenzofuran increases expression EXP 6480464 2 more ... CTD PMID:32109520 Yy1 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of YY1 mRNA CTD PMID:21346803 Yy1 Rat 2-arachidonoylglycerol increases expression ISO Yy1 (Mus musculus) 6480464 glyceryl 2-arachidonate results in increased expression of YY1 mRNA CTD PMID:28095641 Yy1 Rat 2-ethoxyethanol increases expression EXP 6480464 2-ethoxyethanol results in increased expression of YY1 mRNA CTD PMID:19643169 Yy1 Rat 2-methoxyethanol increases expression EXP 6480464 methyl cellosolve results in increased expression of YY1 mRNA CTD PMID:19643169 Yy1 Rat 2-methylcholine affects expression ISO YY1 (Homo sapiens) 6480464 beta-methylcholine affects the expression of YY1 mRNA CTD PMID:21179406 Yy1 Rat 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione multiple interactions ISO YY1 (Homo sapiens) 6480464 bisindolylmaleimide I inhibits the reaction [bisphenol A results in increased expression of YY1 protein] CTD PMID:32363662 Yy1 Rat 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione decreases expression ISO YY1 (Homo sapiens) 6480464 bisindolylmaleimide I results in decreased expression of YY1 protein CTD PMID:32363662 Yy1 Rat 4,4'-sulfonyldiphenol decreases expression ISO Yy1 (Mus musculus) 6480464 bisphenol S results in decreased expression of YY1 mRNA CTD PMID:39298647 Yy1 Rat acrolein multiple interactions ISO YY1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of YY1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of YY1 mRNA CTD PMID:32699268 Yy1 Rat acrylamide increases expression ISO YY1 (Homo sapiens) 6480464 Acrylamide results in increased expression of YY1 mRNA CTD PMID:32763439 Yy1 Rat aflatoxin B1 increases expression ISO Yy1 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of YY1 mRNA CTD PMID:19770486 Yy1 Rat aflatoxin B1 affects binding ISO YY1 (Homo sapiens) 6480464 Aflatoxin B1 binds to YY1 protein CTD PMID:39368342 Yy1 Rat aflatoxin B1 decreases methylation ISO YY1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of YY1 gene and Aflatoxin B1 results in decreased methylation of YY1 intron CTD PMID:27153756 and PMID:30157460 Yy1 Rat aflatoxin B1 decreases expression ISO YY1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of YY1 mRNA CTD PMID:21641981 Yy1 Rat aldehydo-D-glucose multiple interactions ISO YY1 (Homo sapiens) 6480464 [Glucose co-treated with Fatty Acids more ... CTD PMID:35445903 and PMID:39059604 Yy1 Rat aldehydo-D-glucose multiple interactions ISO Yy1 (Mus musculus) 6480464 Sirolimus inhibits the reaction [Glucose results in increased phosphorylation of YY1 protein] CTD PMID:35445903 Yy1 Rat all-trans-retinoic acid multiple interactions ISO Yy1 (Mus musculus) 6480464 Tretinoin promotes the reaction [YY1 protein binds to HOXD4 promoter] CTD PMID:16757478 Yy1 Rat alpha-pinene multiple interactions ISO YY1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of YY1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of YY1 mRNA CTD PMID:32699268 Yy1 Rat AM-251 multiple interactions ISO Yy1 (Mus musculus) 6480464 AM 251 inhibits the reaction [Ethanol results in increased expression of YY1 mRNA] CTD PMID:28095641 Yy1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of YY1 mRNA CTD PMID:16483693 Yy1 Rat anthra[1,9-cd]pyrazol-6(2H)-one multiple interactions EXP 6480464 [pyrazolanthrone co-treated with cypermethrin] results in decreased expression of YY1 protein CTD PMID:34794910 Yy1 Rat antirheumatic drug increases expression ISO YY1 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of YY1 mRNA CTD PMID:24449571 Yy1 Rat arsenous acid affects methylation ISO YY1 (Homo sapiens) 6480464 Arsenic Trioxide affects the methylation of YY1 promoter CTD PMID:26046465 Yy1 Rat arsenous acid decreases expression ISO YY1 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of YY1 mRNA and Arsenic Trioxide results in decreased expression of YY1 protein CTD PMID:21792014 Yy1 Rat artesunate decreases expression ISO YY1 (Homo sapiens) 6480464 artesunate results in decreased expression of YY1 protein CTD PMID:19513562 Yy1 Rat benzo[a]pyrene decreases expression ISO YY1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of YY1 mRNA CTD PMID:26238291 Yy1 Rat benzo[a]pyrene affects methylation ISO YY1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of YY1 intron CTD PMID:30157460 Yy1 Rat benzo[a]pyrene diol epoxide I affects expression ISO YY1 (Homo sapiens) 6480464 7 more ... CTD PMID:20018196 Yy1 Rat benzo[a]pyrene diol epoxide I decreases expression ISO YY1 (Homo sapiens) 6480464 7 more ... CTD PMID:26238291 Yy1 Rat bis(2-chloroethyl) sulfide increases expression ISO Yy1 (Mus musculus) 6480464 Mustard Gas results in increased expression of YY1 mRNA CTD PMID:15674843 Yy1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Yy1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of YY1 mRNA CTD PMID:33754040 Yy1 Rat bisphenol A affects methylation ISO Yy1 (Mus musculus) 6480464 bisphenol A affects the methylation of YY1 promoter CTD PMID:27334623 Yy1 Rat bisphenol A affects binding ISO YY1 (Homo sapiens) 6480464 bisphenol A binds to YY1 protein CTD PMID:39368342 Yy1 Rat bisphenol A increases expression ISO YY1 (Homo sapiens) 6480464 bisphenol A results in increased expression of YY1 protein CTD PMID:32363662 Yy1 Rat bisphenol A multiple interactions ISO YY1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of YY1 gene more ... CTD PMID:31601247 and PMID:32363662 Yy1 Rat cadmium sulfate multiple interactions ISO YY1 (Homo sapiens) 6480464 [cadmium sulfate co-treated with cobaltous chloride co-treated with lead chloride] affects the expression of YY1 mRNA CTD PMID:18654764 Yy1 Rat calyculin a increases expression ISO Yy1 (Mus musculus) 6480464 calyculin A results in increased expression of YY1 mRNA CTD PMID:25270620 Yy1 Rat choline multiple interactions ISO Yy1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of YY1 gene CTD PMID:20938992 Yy1 Rat cisplatin increases expression ISO Yy1 (Mus musculus) 6480464 Cisplatin results in increased expression of YY1 mRNA CTD PMID:21151649 Yy1 Rat cisplatin increases expression ISO YY1 (Homo sapiens) 6480464 Cisplatin results in increased expression of YY1 protein CTD PMID:39368342 Yy1 Rat cisplatin affects response to substance ISO YY1 (Homo sapiens) 6480464 YY1 affects the susceptibility to Cisplatin CTD PMID:39368342 Yy1 Rat cisplatin affects binding ISO YY1 (Homo sapiens) 6480464 Cisplatin binds to YY1 protein CTD PMID:39368342 Yy1 Rat clobetasol decreases expression ISO Yy1 (Mus musculus) 6480464 Clobetasol results in decreased expression of YY1 mRNA CTD PMID:27462272 Yy1 Rat clofibrate affects binding ISO YY1 (Homo sapiens) 6480464 Clofibrate binds to YY1 protein CTD PMID:39368342 Yy1 Rat cobalt dichloride multiple interactions ISO YY1 (Homo sapiens) 6480464 [cadmium sulfate co-treated with cobaltous chloride co-treated with lead chloride] affects the expression of YY1 mRNA CTD PMID:18654764 Yy1 Rat cobalt dichloride increases expression ISO YY1 (Homo sapiens) 6480464 cobaltous chloride results in increased expression of YY1 mRNA CTD PMID:19376846 Yy1 Rat copper(II) sulfate increases expression ISO YY1 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of YY1 mRNA CTD PMID:19549813 Yy1 Rat cypermethrin decreases expression EXP 6480464 cypermethrin results in decreased expression of YY1 mRNA and cypermethrin results in decreased expression of YY1 protein CTD PMID:34794910 Yy1 Rat cypermethrin multiple interactions EXP 6480464 [diallyl trisulfide co-treated with cypermethrin] results in decreased expression of YY1 protein and [pyrazolanthrone co-treated with cypermethrin] results in decreased expression of YY1 protein CTD PMID:34794910 Yy1 Rat cypermethrin decreases expression ISO Yy1 (Mus musculus) 6480464 cypermethrin results in decreased expression of YY1 protein CTD PMID:34794910 Yy1 Rat D-glucose multiple interactions ISO YY1 (Homo sapiens) 6480464 [Glucose co-treated with Fatty Acids more ... CTD PMID:35445903 and PMID:39059604 Yy1 Rat D-glucose multiple interactions ISO Yy1 (Mus musculus) 6480464 Sirolimus inhibits the reaction [Glucose results in increased phosphorylation of YY1 protein] CTD PMID:35445903 Yy1 Rat decabromodiphenyl ether increases expression EXP 6480464 decabromobiphenyl ether results in increased expression of YY1 mRNA CTD PMID:23640034 Yy1 Rat diallyl trisulfide multiple interactions EXP 6480464 [diallyl trisulfide co-treated with cypermethrin] results in decreased expression of YY1 protein CTD PMID:34794910 Yy1 Rat diarsenic trioxide decreases expression ISO YY1 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of YY1 mRNA and Arsenic Trioxide results in decreased expression of YY1 protein CTD PMID:21792014 Yy1 Rat diarsenic trioxide affects methylation ISO YY1 (Homo sapiens) 6480464 Arsenic Trioxide affects the methylation of YY1 promoter CTD PMID:26046465 Yy1 Rat diethyldithiocarbamic acid multiple interactions ISO YY1 (Homo sapiens) 6480464 Ditiocarb inhibits the reaction [YY1 protein inhibits the reaction [jujuboside A inhibits the reaction [[Fatty Acids more ... CTD PMID:39059604 Yy1 Rat Diosbulbin B increases response to substance ISO YY1 (Homo sapiens) 6480464 YY1 results in increased susceptibility to diosbulbin B CTD PMID:39368342 Yy1 Rat Diosbulbin B affects binding ISO YY1 (Homo sapiens) 6480464 diosbulbin B binds to YY1 protein CTD PMID:39368342 Yy1 Rat Diosbulbin B multiple interactions ISO YY1 (Homo sapiens) 6480464 diosbulbin B results in increased expression of and affects the localization of YY1 protein CTD PMID:39368342 Yy1 Rat Diosbulbin B increases expression ISO YY1 (Homo sapiens) 6480464 diosbulbin B results in increased expression of YY1 mRNA CTD PMID:39368342 Yy1 Rat Diosbulbin B increases expression ISO Yy1 (Mus musculus) 6480464 diosbulbin B results in increased expression of YY1 mRNA and diosbulbin B results in increased expression of YY1 protein CTD PMID:39368342 Yy1 Rat disodium selenite increases expression ISO YY1 (Homo sapiens) 6480464 Sodium Selenite results in increased expression of YY1 mRNA CTD PMID:18175754 Yy1 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of YY1 mRNA CTD PMID:25152437 Yy1 Rat enzyme inhibitor multiple interactions ISO YY1 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of YY1 protein CTD PMID:23301498 Yy1 Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of YY1 mRNA CTD PMID:17920746 Yy1 Rat ethanol increases expression ISO Yy1 (Mus musculus) 6480464 Ethanol results in increased expression of YY1 mRNA and Ethanol results in increased expression of YY1 protein CTD PMID:28095641 Yy1 Rat ethanol multiple interactions ISO Yy1 (Mus musculus) 6480464 AM 251 inhibits the reaction [Ethanol results in increased expression of YY1 mRNA] more ... CTD PMID:28095641 Yy1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of YY1 mRNA CTD PMID:24136188 Yy1 Rat flutamide affects binding ISO YY1 (Homo sapiens) 6480464 Flutamide binds to YY1 protein CTD PMID:39368342 Yy1 Rat folic acid multiple interactions ISO Yy1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of YY1 gene CTD PMID:20938992 Yy1 Rat folic acid decreases expression ISO Yy1 (Mus musculus) 6480464 Folic Acid results in decreased expression of YY1 mRNA CTD PMID:25629700 Yy1 Rat fulvestrant multiple interactions ISO YY1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of YY1 gene CTD PMID:31601247 Yy1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of YY1 mRNA CTD PMID:22061828 Yy1 Rat gentamycin affects binding ISO YY1 (Homo sapiens) 6480464 Gentamicins binds to YY1 protein CTD PMID:39368342 Yy1 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of YY1 mRNA CTD PMID:22061828 Yy1 Rat glucose multiple interactions ISO Yy1 (Mus musculus) 6480464 Sirolimus inhibits the reaction [Glucose results in increased phosphorylation of YY1 protein] CTD PMID:35445903 Yy1 Rat glucose multiple interactions ISO YY1 (Homo sapiens) 6480464 [Glucose co-treated with Fatty Acids more ... CTD PMID:35445903 and PMID:39059604 Yy1 Rat hesperidin multiple interactions ISO YY1 (Homo sapiens) 6480464 Hesperidin inhibits the reaction [[manganese chloride results in increased abundance of Manganese] promotes the reaction [YY1 protein binds to HDAC1 protein]] more ... CTD PMID:34800614 Yy1 Rat hydrogen peroxide multiple interactions ISO Yy1 (Mus musculus) 6480464 [Hydrogen Peroxide co-treated with N-(oxo-5 more ... CTD PMID:31494107 Yy1 Rat hydrogen peroxide affects expression ISO YY1 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of YY1 mRNA CTD PMID:21179406 Yy1 Rat isoprenaline increases expression ISO Yy1 (Mus musculus) 6480464 Isoproterenol results in increased expression of YY1 mRNA CTD PMID:20003209 Yy1 Rat Jujuboside A multiple interactions ISO Yy1 (Mus musculus) 6480464 jujuboside A inhibits the reaction [LEPR mutant form results in increased expression of YY1 protein] CTD PMID:39059604 Yy1 Rat Jujuboside A multiple interactions ISO YY1 (Homo sapiens) 6480464 Ditiocarb inhibits the reaction [YY1 protein inhibits the reaction [jujuboside A inhibits the reaction [[Fatty Acids more ... CTD PMID:39059604 Yy1 Rat ketamine decreases expression EXP 6480464 Ketamine results in decreased expression of YY1 mRNA CTD PMID:20080153 Yy1 Rat L-methionine multiple interactions ISO Yy1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of YY1 gene CTD PMID:20938992 Yy1 Rat lead diacetate decreases methylation EXP 6480464 lead acetate results in decreased methylation of YY1 gene CTD PMID:29571894 Yy1 Rat lead(II) chloride multiple interactions ISO YY1 (Homo sapiens) 6480464 [cadmium sulfate co-treated with cobaltous chloride co-treated with lead chloride] affects the expression of YY1 mRNA CTD PMID:18654764 Yy1 Rat lithocholic acid increases expression ISO YY1 (Homo sapiens) 6480464 Lithocholic Acid results in increased expression of YY1 protein CTD PMID:39368342 Yy1 Rat lithocholic acid affects binding ISO YY1 (Homo sapiens) 6480464 Lithocholic Acid binds to YY1 protein CTD PMID:39368342 Yy1 Rat lithocholic acid increases expression ISO Yy1 (Mus musculus) 6480464 Lithocholic Acid results in increased expression of YY1 protein CTD PMID:39368342 Yy1 Rat manganese atom multiple interactions EXP 6480464 Manganese promotes the reaction [YY1 protein binds to HDAC1 protein] more ... CTD PMID:24469401 Yy1 Rat manganese atom multiple interactions ISO YY1 (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] promotes the reaction [YY1 protein binds to HDAC1 protein] more ... CTD PMID:34310962 and PMID:34800614 Yy1 Rat manganese atom increases expression EXP 6480464 Manganese results in increased expression of YY1 mRNA and Manganese results in increased expression of YY1 protein CTD PMID:24469401 Yy1 Rat manganese(0) increases expression EXP 6480464 Manganese results in increased expression of YY1 mRNA and Manganese results in increased expression of YY1 protein CTD PMID:24469401 Yy1 Rat manganese(0) multiple interactions ISO YY1 (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] promotes the reaction [YY1 protein binds to HDAC1 protein] more ... CTD PMID:34310962 and PMID:34800614 Yy1 Rat manganese(0) multiple interactions EXP 6480464 Manganese promotes the reaction [YY1 protein binds to HDAC1 protein] more ... CTD PMID:24469401 Yy1 Rat manganese(II) chloride multiple interactions ISO YY1 (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] promotes the reaction [YY1 protein binds to HDAC1 protein] more ... CTD PMID:34310962 and PMID:34800614 Yy1 Rat melatonin multiple interactions ISO Yy1 (Mus musculus) 6480464 Melatonin inhibits the reaction [Ethanol results in increased expression of YY1 mRNA] more ... CTD PMID:28095641 Yy1 Rat melatonin decreases expression ISO Yy1 (Mus musculus) 6480464 Melatonin results in decreased expression of YY1 mRNA CTD PMID:28095641 Yy1 Rat methapyrilene increases methylation ISO YY1 (Homo sapiens) 6480464 Methapyrilene results in increased methylation of YY1 intron CTD PMID:30157460 Yy1 Rat N-acetyl-L-cysteine multiple interactions ISO YY1 (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [[manganese chloride results in increased abundance of Manganese] which results in increased expression of YY1 mRNA] and Acetylcysteine inhibits the reaction [[manganese chloride results in increased abundance of Manganese] which results in increased expression of YY1 protein] CTD PMID:34310962 Yy1 Rat N-methyl-N'-nitro-N-nitrosoguanidine multiple interactions ISO YY1 (Homo sapiens) 6480464 Methylnitronitrosoguanidine promotes the reaction [YY1 protein binds to RRM2 promoter] and Methylnitronitrosoguanidine promotes the reaction [YY1 protein results in increased expression of RRM2 mRNA] CTD PMID:26921499 Yy1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 caffeic acid phenethyl ester inhibits the reaction [Diethylnitrosamine results in decreased expression of YY1 mRNA] CTD PMID:20360939 Yy1 Rat N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of YY1 mRNA CTD PMID:20360939 Yy1 Rat nitrates multiple interactions ISO Yy1 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of YY1 mRNA CTD PMID:35964746 Yy1 Rat ozone multiple interactions ISO YY1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of YY1 mRNA more ... CTD PMID:32699268 Yy1 Rat paracetamol affects expression ISO Yy1 (Mus musculus) 6480464 Acetaminophen affects the expression of YY1 mRNA CTD PMID:17562736 Yy1 Rat paracetamol increases expression ISO YY1 (Homo sapiens) 6480464 Acetaminophen results in increased expression of YY1 protein CTD PMID:39368342 Yy1 Rat paracetamol affects binding ISO YY1 (Homo sapiens) 6480464 Acetaminophen binds to YY1 protein CTD PMID:39368342 Yy1 Rat paracetamol affects response to substance ISO YY1 (Homo sapiens) 6480464 YY1 affects the susceptibility to Acetaminophen CTD PMID:39368342 Yy1 Rat phenethyl caffeate multiple interactions EXP 6480464 caffeic acid phenethyl ester inhibits the reaction [Diethylnitrosamine results in decreased expression of YY1 mRNA] CTD PMID:20360939 Yy1 Rat phorbol 13-acetate 12-myristate increases expression ISO YY1 (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate results in increased expression of YY1 protein CTD PMID:32363662 Yy1 Rat phorbol 13-acetate 12-myristate multiple interactions ISO YY1 (Homo sapiens) 6480464 [bisphenol A co-treated with Tetradecanoylphorbol Acetate] results in increased expression of YY1 protein CTD PMID:32363662 Yy1 Rat potassium chloride multiple interactions ISO YY1 (Homo sapiens) 6480464 [Dronabinol results in decreased susceptibility to Potassium Chloride] which results in increased expression of YY1 mRNA CTD PMID:29691375 Yy1 Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of YY1 mRNA CTD PMID:19013527 Yy1 Rat silmitasertib multiple interactions ISO YY1 (Homo sapiens) 6480464 silmitasertib inhibits the reaction [[manganese chloride results in increased abundance of Manganese] promotes the reaction [YY1 protein binds to HDAC3 protein]] more ... CTD PMID:34800614 Yy1 Rat silver atom decreases expression ISO Yy1 (Mus musculus) 6480464 Silver results in decreased expression of YY1 mRNA CTD PMID:27131904 Yy1 Rat silver(0) decreases expression ISO Yy1 (Mus musculus) 6480464 Silver results in decreased expression of YY1 mRNA CTD PMID:27131904 Yy1 Rat sirolimus multiple interactions ISO Yy1 (Mus musculus) 6480464 Sirolimus inhibits the reaction [Glucose results in increased phosphorylation of YY1 protein] CTD PMID:35445903 Yy1 Rat sodium arsenite affects expression ISO YY1 (Homo sapiens) 6480464 sodium arsenite affects the expression of YY1 mRNA CTD PMID:29319823 Yy1 Rat sodium arsenite increases expression ISO Yy1 (Mus musculus) 6480464 sodium arsenite results in increased expression of YY1 mRNA CTD PMID:35364107 Yy1 Rat sodium arsenite multiple interactions ISO Yy1 (Mus musculus) 6480464 GSK-2816126 promotes the reaction [sodium arsenite results in increased expression of YY1 mRNA] CTD PMID:35364107 Yy1 Rat sodium arsenite increases expression ISO YY1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of YY1 mRNA CTD PMID:38568856 Yy1 Rat sunitinib increases expression ISO YY1 (Homo sapiens) 6480464 Sunitinib results in increased expression of YY1 mRNA CTD PMID:31533062 Yy1 Rat sunitinib affects binding ISO YY1 (Homo sapiens) 6480464 Sunitinib binds to YY1 protein CTD PMID:39368342 Yy1 Rat tetrachloromethane increases expression ISO Yy1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of YY1 mRNA CTD PMID:31919559 Yy1 Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of YY1 mRNA CTD PMID:25151969 Yy1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of YY1 mRNA CTD PMID:34492290 Yy1 Rat thioacetamide affects methylation EXP 6480464 Thioacetamide affects the methylation of YY1 promoter CTD PMID:25151969 Yy1 Rat titanium dioxide increases methylation ISO Yy1 (Mus musculus) 6480464 titanium dioxide results in increased methylation of YY1 gene CTD PMID:35295148 Yy1 Rat titanium dioxide decreases methylation ISO Yy1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of YY1 gene and titanium dioxide results in decreased methylation of YY1 promoter CTD PMID:35295148 Yy1 Rat troglitazone decreases expression ISO Yy1 (Mus musculus) 6480464 troglitazone results in decreased expression of YY1 mRNA CTD PMID:28973697 Yy1 Rat troglitazone affects binding ISO YY1 (Homo sapiens) 6480464 Troglitazone binds to YY1 protein CTD PMID:39368342 Yy1 Rat valproic acid decreases expression ISO Yy1 (Mus musculus) 6480464 Valproic Acid results in decreased expression of YY1 mRNA CTD PMID:21427059 Yy1 Rat valproic acid affects binding ISO YY1 (Homo sapiens) 6480464 Valproic Acid binds to YY1 protein CTD PMID:39368342 Yy1 Rat valproic acid increases methylation ISO YY1 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of YY1 gene CTD PMID:29154799 Yy1 Rat valproic acid decreases expression ISO YY1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of YY1 mRNA CTD PMID:23179753 Yy1 Rat valproic acid affects expression ISO YY1 (Homo sapiens) 6480464 Valproic Acid affects the expression of YY1 mRNA CTD PMID:25979313 Yy1 Rat vitamin E decreases expression ISO YY1 (Homo sapiens) 6480464 Vitamin E results in decreased expression of YY1 mRNA CTD PMID:19244175
Imported Annotations - PID (archival)
(R,R,R)-alpha-tocopherol (ISO) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4-dinitrotoluene (EXP) 2-arachidonoylglycerol (ISO) 2-ethoxyethanol (EXP) 2-methoxyethanol (EXP) 2-methylcholine (ISO) 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione (ISO) 4,4'-sulfonyldiphenol (ISO) acrolein (ISO) acrylamide (ISO) aflatoxin B1 (ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) AM-251 (ISO) ammonium chloride (EXP) anthra[1,9-cd]pyrazol-6(2H)-one (EXP) antirheumatic drug (ISO) arsenous acid (ISO) artesunate (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (ISO) cadmium sulfate (ISO) calyculin a (ISO) choline (ISO) cisplatin (ISO) clobetasol (ISO) clofibrate (ISO) cobalt dichloride (ISO) copper(II) sulfate (ISO) cypermethrin (EXP,ISO) D-glucose (ISO) decabromodiphenyl ether (EXP) diallyl trisulfide (EXP) diarsenic trioxide (ISO) diethyldithiocarbamic acid (ISO) Diosbulbin B (ISO) disodium selenite (ISO) diuron (EXP) enzyme inhibitor (ISO) ethanol (EXP,ISO) flutamide (EXP,ISO) folic acid (ISO) fulvestrant (ISO) gentamycin (EXP,ISO) glucose (ISO) hesperidin (ISO) hydrogen peroxide (ISO) isoprenaline (ISO) Jujuboside A (ISO) ketamine (EXP) L-methionine (ISO) lead diacetate (EXP) lead(II) chloride (ISO) lithocholic acid (ISO) manganese atom (EXP,ISO) manganese(0) (EXP,ISO) manganese(II) chloride (ISO) melatonin (ISO) methapyrilene (ISO) N-acetyl-L-cysteine (ISO) N-methyl-N'-nitro-N-nitrosoguanidine (ISO) N-nitrosodiethylamine (EXP) nitrates (ISO) ozone (ISO) paracetamol (ISO) phenethyl caffeate (EXP) phorbol 13-acetate 12-myristate (ISO) potassium chloride (ISO) rotenone (EXP) silmitasertib (ISO) silver atom (ISO) silver(0) (ISO) sirolimus (ISO) sodium arsenite (ISO) sunitinib (ISO) tetrachloromethane (ISO) thioacetamide (EXP) titanium dioxide (ISO) troglitazone (ISO) valproic acid (ISO) vitamin E (ISO)
Biological Process
anterior/posterior pattern specification (IEA,ISO) B cell differentiation (IEA,ISO) camera-type eye morphogenesis (IEA,ISO) cellular response to interleukin-1 (IDA) cellular response to UV (IEA,ISO) chromatin remodeling (IEA,ISO) chromosome organization (IEA,ISO) DNA damage response (IEA,ISO) double-strand break repair via homologous recombination (IEA,ISO) gene expression (IEA,ISO) hemopoiesis (IEA,ISO) immunoglobulin heavy chain V-D-J recombination (IEA,ISO) negative regulation of cell growth involved in cardiac muscle cell development (IMP) negative regulation of gene expression (IEA,ISO) negative regulation of interferon-beta production (IEA,ISO) negative regulation of miRNA transcription (IEA,ISO) negative regulation of transcription by RNA polymerase II (IEA,IMP,ISO) positive regulation of DNA repair (IEA,ISO) positive regulation of DNA-templated transcription (IEA,ISO) positive regulation of gene expression (IEA,ISO) positive regulation of telomere maintenance in response to DNA damage (IEA,ISO) positive regulation of transcription by RNA polymerase II (IMP) regulation of cell cycle (IEA,ISO) regulation of chromosome organization (IEA,ISO) regulation of DNA repair (IEA,ISO) regulation of DNA replication (IEA,ISO) regulation of DNA strand elongation (IEA,ISO) regulation of DNA-templated transcription (IDA,IEA,ISO) regulation of embryonic development (IEA,ISO) regulation of transcription by RNA polymerase II (IBA,IEA,ISO) response to prostaglandin F (IEP) response to UV-C (IEA,ISO) RNA localization (IEA,ISO) spermatogenesis (IEA,ISO) telomere maintenance (IEA,ISO)
Cellular Component
chromatin (IBA,IEA,ISO) chromatin silencing complex (IEA,ISO) Ino80 complex (IEA,ISO) nuclear matrix (IDA) nucleus (IEA,ISO) PcG protein complex (IBA,IEA,ISO) transcription regulator complex (IBA,IDA,IEA,ISO)
Molecular Function
chromatin binding (IEA,ISO) cis-regulatory region sequence-specific DNA binding (IEA,ISO) DNA binding (IEA,ISO) DNA-binding transcription activator activity, RNA polymerase II-specific (IEA,ISO) DNA-binding transcription factor activity (IEA,ISO) DNA-binding transcription factor activity, RNA polymerase II-specific (IBA,IEA,ISO) DNA-binding transcription factor binding (IEA,ISO) DNA-binding transcription repressor activity, RNA polymerase II-specific (IEA,ISO) four-way junction DNA binding (IEA,ISO) metal ion binding (IEA) protein binding (IPI,ISO) RNA binding (IEA,ISO) RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA,IEA,ISO) sequence-specific DNA binding (IDA,IEA,ISO) sequence-specific double-stranded DNA binding (IEA,ISO) SMAD binding (IEA,ISO) transcription cis-regulatory region binding (IEA,ISO) zinc ion binding (IEA)
1.
Interplay between heme oxygenase-1 and the multifunctional transcription factor yin yang 1 in the inhibition of intimal hyperplasia.
Beck K, etal., Circ Res. 2010 Dec 10;107(12):1490-7. doi: 10.1161/CIRCRESAHA.110.231985. Epub 2010 Oct 28.
2.
Yin-yang 1 and glucocorticoid receptor participate in the Stat5-mediated growth hormone response of the serine protease inhibitor 2.1 gene.
Bergad PL, etal., J Biol Chem. 2000 Mar 17;275(11):8114-20.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
5.
Yin Yang 1 is a repressor of glutamate transporter EAAT2, and it mediates manganese-induced decrease of EAAT2 expression in astrocytes.
Karki P, etal., Mol Cell Biol. 2014 Apr;34(7):1280-9. doi: 10.1128/MCB.01176-13. Epub 2014 Jan 27.
6.
Genetic variation in the multifunctional transcription factor Yy1 and type 1 diabetes mellitus in the BB rat.
Kloting N and Kloting I, Mol Genet Metab. 2004 Jul;82(3):255-9.
7.
Diabetes per se and metabolic state influence gene expression in tissue-dependent manner of BB/OK rats.
Kloting N, etal., Diabetes Metab Res Rev. 2005 May-Jun;21(3):281-7.
8.
Subcellular partitioning of transcription factors during osteoblast differentiation: developmental association of the AML/CBF alpha/PEBP2 alpha-related transcription factor-NMP-2 with the nuclear matrix.
Lindenmuth DM, etal., J Cell Biochem. 1997 Jul 1;66(1):123-32.
9.
Yin Yang 1 represses alpha-myosin heavy chain gene expression in pathologic cardiac hypertrophy.
Mariner PD, etal., Biochem Biophys Res Commun. 2005 Jan 7;326(1):79-86.
10.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
11.
A novel transcriptional element which regulates expression of the CYP2D4 gene by Oct-1 and YY-1 binding.
Mizuno D, etal., Biochim Biophys Acta 2003 Jun 19;1627(2-3):121-8.
12.
Repression of the steroidogenic acute regulatory gene by the multifunctional transcription factor Yin Yang 1.
Nackley AC, etal., Endocrinology 2002 Mar;143(3):1085-96.
13.
The transcription factor Yin Yang 1 is an activator of BACE1 expression.
Nowak K, etal., J Neurochem. 2006 Mar;96(6):1696-707.
14.
IL-1 beta increases abundance and activity of the negative transcriptional regulator yin yang-1 (YY1) in neonatal rat cardiac myocytes.
Patten M, etal., J Mol Cell Cardiol. 2000 Jul;32(7):1341-52.
15.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
16.
GOA pipeline
RGD automated data pipeline
17.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
18.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
19.
Induction of the transcriptional repressor Yin Yang-1 by vascular cell injury. Autocrine/paracrine role of endogenous fibroblast growth factor-2.
Santiago FS, etal., J Biol Chem 2001 Nov 2;276(44):41143-9.
20.
Yin Yang 1 is increased in human heart failure and represses the activity of the human alpha-myosin heavy chain promoter.
Sucharov CC, etal., J Biol Chem. 2003 Aug 15;278(33):31233-9. Epub 2003 May 16.
21.
YY1 protects cardiac myocytes from pathologic hypertrophy by interacting with HDAC5.
Sucharov CC, etal., Mol Biol Cell. 2008 Oct;19(10):4141-53. doi: 10.1091/mbc.E07-12-1217. Epub 2008 Jul 16.
22.
The INO80 family of chromatin-remodeling enzymes: regulators of histone variant dynamics.
Watanabe S and Peterson CL, Cold Spring Harb Symp Quant Biol. 2010;75:35-42. doi: 10.1101/sqb.2010.75.063. Epub 2011 Apr 18.
Yy1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 133,471,615 - 133,500,875 (+) NCBI GRCr8 mRatBN7.2 6 127,706,739 - 127,736,499 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 127,707,596 - 127,732,747 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 127,830,843 - 127,855,090 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 128,125,889 - 128,150,136 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 127,484,792 - 127,509,137 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 132,702,443 - 132,726,848 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 132,702,448 - 132,727,046 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 141,872,505 - 141,896,924 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 133,132,419 - 133,156,686 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 133,138,605 - 133,162,873 (+) NCBI Celera 6 125,273,530 - 125,282,803 (+) NCBI Celera Cytogenetic Map 6 q32 NCBI
YY1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 14 100,239,144 - 100,282,788 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 14 100,238,298 - 100,282,788 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 14 100,705,481 - 100,749,125 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 14 99,774,855 - 99,814,557 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 14 99,774,854 - 99,814,557 NCBI Celera 14 80,759,739 - 80,799,431 (+) NCBI Celera Cytogenetic Map 14 q32.2 NCBI HuRef 14 80,888,079 - 80,926,725 (+) NCBI HuRef CHM1_1 14 100,642,915 - 100,683,150 (+) NCBI CHM1_1 T2T-CHM13v2.0 14 94,472,191 - 94,515,818 (+) NCBI T2T-CHM13v2.0
Yy1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 12 108,758,841 - 108,786,074 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 12 108,758,899 - 108,786,074 (+) Ensembl GRCm39 Ensembl GRCm38 12 108,792,945 - 108,820,148 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 12 108,792,973 - 108,820,148 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 12 110,031,521 - 110,054,842 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 12 109,241,118 - 109,264,439 (+) NCBI MGSCv36 mm8 Celera 12 110,029,534 - 110,052,930 (+) NCBI Celera Cytogenetic Map 12 F1 NCBI cM Map 12 59.58 NCBI
Yy1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955438 21,341,374 - 21,377,674 (+) NCBI ChiLan1.0 ChiLan1.0
YY1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 15 101,390,655 - 101,434,179 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 14 100,607,371 - 100,650,673 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 14 80,859,491 - 80,903,651 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 14 100,173,287 - 100,217,651 (+) NCBI panpan1.1 PanPan1.1 panPan2
YY1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 8 68,539,511 - 68,572,796 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 8 68,539,353 - 68,568,058 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 8 68,058,331 - 68,091,508 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 8 68,823,410 - 68,856,669 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 8 68,823,416 - 68,851,926 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 8 68,485,332 - 68,518,533 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 8 68,551,498 - 68,584,736 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 8 68,948,873 - 68,982,099 (+) NCBI UU_Cfam_GSD_1.0
Yy1
YY1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 121,132,191 - 121,170,697 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 121,132,168 - 121,170,699 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 128,602,231 - 128,613,935 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
YY1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 24 78,199,172 - 78,243,081 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 24 78,199,039 - 78,237,165 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666053 65,338,296 - 65,383,353 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Yy1
.
Predicted Target Of
Count of predictions: 39 Count of miRNA genes: 33 Interacting mature miRNAs: 39 Transcripts: ENSRNOT00000005743 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
12801411 Schws8 Schwannoma susceptibility QTL 8 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 6 94968928 139968928 Rat 1331797 Bp213 Blood pressure QTL 213 3.291 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 104085867 128713626 Rat 1331799 Bp211 Blood pressure QTL 211 3.66407 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 72202632 130919985 Rat 71111 Iddm8 Insulin dependent diabetes mellitus QTL 8 1.9 0.002 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 6 105156861 140994061 Rat 1358355 Srcrt4 Stress Responsive Cort QTL 4 6.39 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 100364669 140994061 Rat 61329 Eae9 Experimental allergic encephalomyelitis QTL 9 3.7 body mass (VT:0001259) change in body weight (CMO:0002045) 6 122549046 140994061 Rat 2312560 Pur20 Proteinuria QTL 20 2.1 0.005 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 6 125628133 137801795 Rat 2313399 Anxrr28 Anxiety related response QTL 28 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 6 100671796 132340886 Rat 1331725 Bp212 Blood pressure QTL 212 3.52475 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 93701310 128713626 Rat 8552796 Vie3 Viral induced encephalitis QTL 3 2.6 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 6 96833997 140994061 Rat 4145118 Mcs26 Mammary carcinoma susceptibility QTL 26 0.0001 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 6 106752656 132339866 Rat 1581563 Uae33 Urinary albumin excretion QTL 33 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 72227641 130729205 Rat 10054138 Gmadr3 Adrenal mass QTL 3 3.68 0.00045 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 6 85140138 130140138 Rat 1641917 Colcr5 Colorectal carcinoma resistance QTL 5 3.18 0.0009 intestine integrity trait (VT:0010554) benign colorectal tumor number (CMO:0001795) 6 122549046 137801795 Rat 61414 Pia3 Pristane induced arthritis QTL 3 4.5 joint integrity trait (VT:0010548) post-insult time to onset of experimental arthritis (CMO:0001450) 6 94968928 137848904 Rat 724513 Uae14 Urinary albumin excretion QTL 14 6.5 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 85311061 133478515 Rat 2303624 Vencon5 Ventilatory control QTL 5 4.45 respiration trait (VT:0001943) minute ventilation (CMO:0000132) 6 88047916 133047916 Rat 731173 Uae22 Urinary albumin excretion QTL 22 10.1 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 10054123 Srcrt6 Stress Responsive Cort QTL 6 2.5 0.0043 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 85140138 130140138 Rat 724536 Uae7 Urinary albumin excretion QTL 7 3.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 6 72202632 130729475 Rat 737976 Pia24 Pristane induced arthritis QTL 24 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 6 112636280 140994061 Rat 1298087 Iddm18 Insulin dependent diabetes mellitus QTL 18 0.0001 urine glucose amount (VT:0001758) percentage of study population developing diabetes mellitus during a period of time (CMO:0001114) 6 116506292 130245370 Rat 1581550 Pur8 Proteinuria QTL 8 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 6 72227641 130729205 Rat 738034 Anxrr5 Anxiety related response QTL 5 5.9 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 6 84130881 129130881 Rat 2290393 Uae37 Urinary albumin excretion QTL 37 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 1300076 Glom8 Glomerulus QTL 8 7 9e-09 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli directly contacting the kidney surface (CMO:0001001) 6 86894788 131894788 Rat 2293085 Iddm29 Insulin dependent diabetes mellitus QTL 29 7.66 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 6 122549046 140286318 Rat
AW488674
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 127,734,241 - 127,734,334 (+) MAPPER mRatBN7.2 Rnor_6.0 6 132,729,183 - 132,729,275 NCBI Rnor6.0 Rnor_5.0 6 141,899,259 - 141,899,351 UniSTS Rnor5.0 RGSC_v3.4 6 133,159,021 - 133,159,113 UniSTS RGSC3.4 Celera 6 125,285,138 - 125,285,230 UniSTS Cytogenetic Map 6 q32 UniSTS
RH131280
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 127,706,741 - 127,706,961 (+) MAPPER mRatBN7.2 Rnor_6.0 6 132,701,686 - 132,701,905 NCBI Rnor6.0 Rnor_5.0 6 141,871,762 - 141,871,981 UniSTS Rnor5.0 RGSC_v3.4 6 133,131,523 - 133,131,742 UniSTS RGSC3.4 Celera 6 125,258,019 - 125,258,238 UniSTS Cytogenetic Map 6 q32 UniSTS
RH139545
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 127,734,146 - 127,734,334 (+) MAPPER mRatBN7.2 Rnor_6.0 6 132,729,088 - 132,729,275 NCBI Rnor6.0 Rnor_5.0 6 141,899,164 - 141,899,351 UniSTS Rnor5.0 RGSC_v3.4 6 133,158,926 - 133,159,113 UniSTS RGSC3.4 Celera 6 125,285,043 - 125,285,230 UniSTS RH 3.4 Map 6 788.1 UniSTS Cytogenetic Map 6 q32 UniSTS
RH140410
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 6 133,470,356 - 133,470,550 (+) Marker Load Pipeline mRatBN7.2 6 127,705,978 - 127,706,172 (+) MAPPER mRatBN7.2 Rnor_6.0 6 132,700,923 - 132,701,116 NCBI Rnor6.0 Rnor_5.0 6 141,870,999 - 141,871,192 UniSTS Rnor5.0 RGSC_v3.4 6 133,130,760 - 133,130,953 UniSTS RGSC3.4 Celera 6 125,257,256 - 125,257,449 UniSTS RH 3.4 Map 6 787.5 UniSTS Cytogenetic Map 6 q32 UniSTS
AI231795
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 127,736,071 - 127,736,204 (+) MAPPER mRatBN7.2 Rnor_6.0 6 132,731,013 - 132,731,145 NCBI Rnor6.0 Rnor_5.0 6 141,901,089 - 141,901,221 UniSTS Rnor5.0 RGSC_v3.4 6 133,160,851 - 133,160,983 UniSTS RGSC3.4 Celera 6 125,286,968 - 125,287,100 UniSTS RH 3.4 Map 6 787.0 UniSTS Cytogenetic Map 6 q32 UniSTS
G36215
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 127,722,669 - 127,722,765 (+) MAPPER mRatBN7.2 Rnor_6.0 6 132,717,611 - 132,717,706 NCBI Rnor6.0 Rnor_5.0 6 141,887,687 - 141,887,782 UniSTS Rnor5.0 RGSC_v3.4 6 133,147,449 - 133,147,544 UniSTS RGSC3.4 Celera 6 125,273,566 - 125,273,661 UniSTS Cytogenetic Map 6 q32 UniSTS
PMC84716P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 127,707,884 - 127,708,096 (+) MAPPER mRatBN7.2 Rnor_6.0 6 132,702,828 - 132,703,039 NCBI Rnor6.0 Rnor_5.0 6 141,872,904 - 141,873,115 UniSTS Rnor5.0 RGSC_v3.4 6 133,132,666 - 133,132,877 UniSTS RGSC3.4 Cytogenetic Map 6 q32 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000005743 ⟹ ENSRNOP00000005743
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 127,707,596 - 127,731,999 (+) Ensembl Rnor_6.0 Ensembl 6 132,702,448 - 132,727,046 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000097604 ⟹ ENSRNOP00000089643
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 127,707,596 - 127,732,747 (+) Ensembl
RefSeq Acc Id:
NM_173290 ⟹ NP_775412
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 133,471,615 - 133,500,875 (+) NCBI mRatBN7.2 6 127,707,237 - 127,736,499 (+) NCBI Rnor_6.0 6 132,702,581 - 132,726,848 (+) NCBI Rnor_5.0 6 141,872,505 - 141,896,924 (+) NCBI RGSC_v3.4 6 133,132,419 - 133,156,686 (+) RGD Celera 6 125,273,530 - 125,282,803 (+) RGD
Sequence:
ATGGCCTCGGGCGACACCCTCTACATTGCCACGGACGGCTCGGAGATGCCAGCCGAGATCGTGGAACTGCATGAGATTGAGGTGGAGACCATCCCGGTGGAGACTATCGAGACCACGGTGGTGGGCGA
hide sequence
RefSeq Acc Id:
NP_775412 ⟸ NM_173290
- UniProtKB:
Q8CHJ4 (UniProtKB/TrEMBL), A0A8I6A7Q7 (UniProtKB/TrEMBL)
- Sequence:
MASGDTLYIATDGSEMPAEIVELHEIEVETIPVETIETTVVGEEEDDDEDDEDGGGGDHGGGGGHGHAGHHHHHHHHHHPPMIALQPLVTDDPTQVHHHQEVILVQTREEVVGGDDSDGLRAEDGFED
hide sequence
Ensembl Acc Id:
ENSRNOP00000005743 ⟸ ENSRNOT00000005743
Ensembl Acc Id:
ENSRNOP00000089643 ⟸ ENSRNOT00000097604
RGD ID: 13694821 Promoter ID: EPDNEW_R5345 Type: initiation region Name: Yy1_1 Description: YY1 transcription factor SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 6 132,702,480 - 132,702,540 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-06-10
Yy1
YY1 transcription factor
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_expression
expressed in the rat vascular smooth muscle cells after injury
628455
gene_function
GL1-Kruppel-type zinc finger nuclear factor
628455
gene_process
represses or activates the expression of many growth factors and inhibits smooth muscle growth
628455
gene_regulation
mRNA and protein expression increased by growth factors which stimulate binding and transcription and expression blocked by neutralizing antibodies against fibroblast growth factors
628455
