Symbol:
Uchl1
Name:
ubiquitin C-terminal hydrolase L1
RGD ID:
3928
Description:
Predicted to enable several functions, including alpha-2A adrenergic receptor binding activity; peptidase activity; and ubiquitin protein ligase binding activity. Involved in ubiquitin-dependent protein catabolic process. Predicted to be located in several cellular components, including neuron projection terminus; neuronal cell body; and nucleoplasm. Predicted to be active in cytoplasm. Biomarker of retinal disease. Human ortholog(s) of this gene implicated in Alzheimer's disease; Parkinson's disease; hereditary spastic paraplegia 79A; and hereditary spastic paraplegia 79B. Orthologous to human UCHL1 (ubiquitin C-terminal hydrolase L1); PARTICIPATES IN Parkinson's disease pathway; INTERACTS WITH 1,3-dinitrobenzene; 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
neuron cytoplasmic protein 9.5; PGP 9.5; PGP9.5; ubiquitin carboxy-terminal hydrolase L1; ubiquitin carboxyl-terminal esterase L1; ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase); ubiquitin carboxyl-terminal hydrolase isozyme L1; ubiquitin thioesterase L1; UCH-L1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 41,838,859 - 41,849,743 (-) NCBI GRCr8 mRatBN7.2 14 41,485,031 - 41,495,590 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 41,485,031 - 41,495,590 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 41,831,048 - 41,841,616 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 43,131,128 - 43,141,696 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 41,611,942 - 41,622,510 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 43,133,224 - 43,143,942 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 43,133,218 - 43,143,973 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 42,928,247 - 42,938,981 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 44,114,392 - 44,124,947 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 44,116,782 - 44,127,338 (-) NCBI Celera 14 40,639,549 - 40,650,302 (-) NCBI Celera Cytogenetic Map 14 p11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Uchl1 Rat (1->4)-beta-D-glucan multiple interactions ISO Uchl1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of UCHL1 mRNA CTD PMID:36331819 Uchl1 Rat (S)-nicotine multiple interactions ISO Uchl1 (Mus musculus) 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Uchl1 Rat 1,2-dimethylhydrazine increases expression ISO Uchl1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of UCHL1 mRNA CTD PMID:22206623 Uchl1 Rat 1,2-naphthoquinone multiple interactions ISO UCHL1 (Homo sapiens) 6480464 1 more ... CTD PMID:24582816 Uchl1 Rat 1,3-dinitrobenzene affects expression EXP 6480464 3-dinitrobenzene affects the expression of UCHL1 mRNA CTD PMID:16988215 Uchl1 Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine multiple interactions ISO Uchl1 (Mus musculus) 6480464 [Caffeine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Uchl1 Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine decreases expression ISO Uchl1 (Mus musculus) 6480464 1-Methyl-4-phenyl-1 more ... CTD PMID:15329391 more ... Uchl1 Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine decreases response to substance ISO Uchl1 (Mus musculus) 6480464 UCHL1 protein results in decreased susceptibility to 1-Methyl-4-phenyl-1 more ... CTD PMID:23643664 Uchl1 Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine increases expression ISO Uchl1 (Mus musculus) 6480464 1-Methyl-4-phenyl-1 more ... CTD PMID:22342763 Uchl1 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of UCHL1 mRNA CTD PMID:30723492 Uchl1 Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of UCHL1 mRNA CTD PMID:12075121 Uchl1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of UCHL1 mRNA CTD PMID:22298810 Uchl1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of UCHL1 mRNA CTD PMID:34747641 Uchl1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Uchl1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of UCHL1 mRNA CTD PMID:24680724 Uchl1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether decreases expression EXP 6480464 2 more ... CTD PMID:19954255 Uchl1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether decreases expression ISO Uchl1 (Mus musculus) 6480464 2 more ... CTD PMID:18550172 Uchl1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether increases expression EXP 6480464 2 more ... CTD PMID:19954255 Uchl1 Rat 2-methoxyethanol increases expression EXP 6480464 methyl cellosolve results in increased expression of UCHL1 protein CTD PMID:15928459 Uchl1 Rat 4-hydroxynon-2-enal increases expression ISO Uchl1 (Mus musculus) 6480464 4-hydroxy-2-nonenal results in increased expression of UCHL1 mRNA CTD PMID:19191707 Uchl1 Rat 4-methylcatechol multiple interactions ISO Uchl1 (Mus musculus) 6480464 4-methylcatechol inhibits the reaction [resiniferatoxin results in decreased expression of UCHL1 protein] CTD PMID:18219259 Uchl1 Rat 4-phenylbutyric acid multiple interactions EXP 6480464 4-phenylbutyric acid inhibits the reaction [Streptozocin results in increased expression of UCHL1 protein] CTD PMID:30980806 Uchl1 Rat 5-aza-2'-deoxycytidine multiple interactions ISO UCHL1 (Homo sapiens) 6480464 [[Decitabine co-treated with trichostatin A] affects the methylation of UCHL1 promoter] which affects the expression of UCHL1 mRNA and Decitabine inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of UCHL1 mRNA] CTD PMID:18666234 and PMID:33040242 Uchl1 Rat 5-aza-2'-deoxycytidine increases expression ISO UCHL1 (Homo sapiens) 6480464 Decitabine results in increased expression of UCHL1 mRNA CTD PMID:19194470 and PMID:21856257 Uchl1 Rat 5-fluorouracil affects response to substance ISO UCHL1 (Homo sapiens) 6480464 UCHL1 protein affects the susceptibility to Fluorouracil CTD PMID:16217747 Uchl1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of UCHL1 mRNA CTD PMID:24780913 Uchl1 Rat acrylamide increases expression ISO UCHL1 (Homo sapiens) 6480464 Acrylamide results in increased expression of UCHL1 mRNA CTD PMID:32763439 Uchl1 Rat actinomycin D multiple interactions EXP 6480464 Dactinomycin inhibits the reaction [Mevinphos results in increased expression of UCHL1 protein] CTD PMID:15545831 Uchl1 Rat aflatoxin B1 increases expression ISO UCHL1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of UCHL1 mRNA CTD PMID:27153756 Uchl1 Rat aflatoxin M1 decreases expression ISO UCHL1 (Homo sapiens) 6480464 Aflatoxin M1 results in decreased expression of UCHL1 mRNA CTD PMID:30928695 Uchl1 Rat all-trans-retinoic acid multiple interactions EXP 6480464 Tretinoin inhibits the reaction [nitrofen results in decreased expression of UCHL1 protein] CTD PMID:21952554 Uchl1 Rat all-trans-retinoic acid decreases expression ISO UCHL1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of UCHL1 mRNA CTD PMID:33167477 Uchl1 Rat all-trans-retinol multiple interactions EXP 6480464 [Valproic Acid co-treated with Vitamin A deficiency] affects the expression of UCHL1 protein CTD PMID:32526256 Uchl1 Rat allopurinol increases expression EXP 6480464 Allopurinol results in increased expression of UCHL1 mRNA CTD PMID:37876353 Uchl1 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of UCHL1 mRNA CTD PMID:30047161 Uchl1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of UCHL1 mRNA CTD PMID:16483693 Uchl1 Rat antimycin A decreases expression ISO UCHL1 (Homo sapiens) 6480464 Antimycin A results in decreased expression of UCHL1 mRNA CTD PMID:33512557 Uchl1 Rat antirheumatic drug increases expression ISO UCHL1 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of UCHL1 mRNA CTD PMID:24449571 Uchl1 Rat aristolochic acid A increases expression ISO UCHL1 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of UCHL1 protein CTD PMID:33212167 Uchl1 Rat arsane multiple interactions ISO UCHL1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of UCHL1 mRNA more ... CTD PMID:32525701 more ... Uchl1 Rat arsenic atom multiple interactions ISO UCHL1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of UCHL1 mRNA more ... CTD PMID:32525701 more ... Uchl1 Rat arsenic trichloride multiple interactions ISO UCHL1 (Homo sapiens) 6480464 [Copper co-treated with [arsenic trichloride results in increased abundance of Arsenic]] results in increased expression of UCHL1 mRNA CTD PMID:35809665 Uchl1 Rat arsenite(3-) increases methylation ISO UCHL1 (Homo sapiens) 6480464 arsenite results in increased methylation of UCHL1 promoter CTD PMID:23974009 Uchl1 Rat arsenite(3-) decreases expression ISO UCHL1 (Homo sapiens) 6480464 arsenite results in decreased expression of UCHL1 mRNA CTD PMID:23974009 Uchl1 Rat arsenous acid increases expression ISO UCHL1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of UCHL1 mRNA CTD PMID:15725085 Uchl1 Rat azoxystrobin decreases expression ISO UCHL1 (Homo sapiens) 6480464 azoxystrobin results in decreased expression of UCHL1 mRNA CTD PMID:33512557 Uchl1 Rat benzatropine multiple interactions ISO UCHL1 (Homo sapiens) 6480464 [Cuprizone co-treated with Benztropine] results in decreased expression of UCHL1 protein CTD PMID:34122009 Uchl1 Rat benzo[a]pyrene increases expression ISO UCHL1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of UCHL1 mRNA CTD PMID:21871943 Uchl1 Rat benzo[a]pyrene increases methylation ISO UCHL1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of UCHL1 exon CTD PMID:27901495 Uchl1 Rat benzo[a]pyrene affects methylation ISO UCHL1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of UCHL1 promoter CTD PMID:27901495 Uchl1 Rat benzo[a]pyrene increases expression ISO Uchl1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of UCHL1 mRNA CTD PMID:21569818 more ... Uchl1 Rat benzo[b]fluoranthene increases expression ISO Uchl1 (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of UCHL1 mRNA CTD PMID:26377693 Uchl1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Uchl1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of UCHL1 mRNA CTD PMID:34319233 Uchl1 Rat bis(2-ethylhexyl) phthalate increases expression ISO Uchl1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of UCHL1 mRNA CTD PMID:33754040 Uchl1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of UCHL1 mRNA CTD PMID:12075121 Uchl1 Rat bisphenol A decreases expression ISO UCHL1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of UCHL1 protein CTD PMID:37567409 Uchl1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of UCHL1 mRNA CTD PMID:25181051 more ... Uchl1 Rat bisphenol F increases expression ISO UCHL1 (Homo sapiens) 6480464 bisphenol F results in increased expression of UCHL1 protein CTD PMID:34186270 Uchl1 Rat buta-1,3-diene increases expression ISO Uchl1 (Mus musculus) 6480464 1 and 3-butadiene results in increased expression of UCHL1 mRNA CTD PMID:29038090 Uchl1 Rat cadmium atom multiple interactions ISO UCHL1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of UCHL1 mRNA more ... CTD PMID:33040242 Uchl1 Rat cadmium dichloride increases expression ISO Uchl1 (Mus musculus) 6480464 Cadmium Chloride results in increased expression of UCHL1 mRNA CTD PMID:20061341 Uchl1 Rat cadmium dichloride multiple interactions ISO UCHL1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of UCHL1 mRNA more ... CTD PMID:33040242 Uchl1 Rat cadmium dichloride decreases expression ISO UCHL1 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of UCHL1 mRNA and Cadmium Chloride results in decreased expression of UCHL1 protein CTD PMID:24419708 and PMID:26472689 Uchl1 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of UCHL1 mRNA CTD PMID:33453195 Uchl1 Rat caffeine multiple interactions ISO Uchl1 (Mus musculus) 6480464 [Caffeine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Uchl1 Rat cannabidiol multiple interactions ISO UCHL1 (Homo sapiens) 6480464 [Cuprizone co-treated with Cannabidiol] results in decreased expression of UCHL1 protein CTD PMID:34122009 Uchl1 Rat carbon nanotube increases expression ISO Uchl1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Uchl1 Rat cefaloridine increases expression EXP 6480464 Cephaloridine results in increased expression of UCHL1 mRNA CTD PMID:18500788 Uchl1 Rat chlordecone increases expression ISO Uchl1 (Mus musculus) 6480464 Chlordecone results in increased expression of UCHL1 mRNA CTD PMID:33711761 Uchl1 Rat chloropicrin decreases expression ISO UCHL1 (Homo sapiens) 6480464 chloropicrin results in decreased expression of UCHL1 mRNA CTD PMID:26352163 Uchl1 Rat chloroprene increases expression ISO Uchl1 (Mus musculus) 6480464 Chloroprene results in increased expression of UCHL1 mRNA CTD PMID:23125180 Uchl1 Rat chlorpyrifos increases expression ISO Uchl1 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of UCHL1 mRNA CTD PMID:37019170 Uchl1 Rat choline multiple interactions ISO Uchl1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of UCHL1 mRNA CTD PMID:20938992 Uchl1 Rat cobalt atom multiple interactions ISO UCHL1 (Homo sapiens) 6480464 [tungsten carbide co-treated with Cobalt] results in increased expression of UCHL1 mRNA CTD PMID:23052192 Uchl1 Rat cocaine decreases expression ISO UCHL1 (Homo sapiens) 6480464 Cocaine results in decreased expression of UCHL1 mRNA CTD PMID:12629581 Uchl1 Rat copper atom increases expression ISO UCHL1 (Homo sapiens) 6480464 Copper results in increased expression of UCHL1 mRNA CTD PMID:20875833 Uchl1 Rat copper atom multiple interactions ISO UCHL1 (Homo sapiens) 6480464 [Copper co-treated with [arsenic trichloride results in increased abundance of Arsenic]] results in increased expression of UCHL1 mRNA CTD PMID:35809665 Uchl1 Rat copper atom increases expression EXP 6480464 Copper results in increased expression of UCHL1 mRNA CTD PMID:22465980 Uchl1 Rat copper(0) increases expression ISO UCHL1 (Homo sapiens) 6480464 Copper results in increased expression of UCHL1 mRNA CTD PMID:20875833 Uchl1 Rat copper(0) multiple interactions ISO UCHL1 (Homo sapiens) 6480464 [Copper co-treated with [arsenic trichloride results in increased abundance of Arsenic]] results in increased expression of UCHL1 mRNA CTD PMID:35809665 Uchl1 Rat copper(0) increases expression EXP 6480464 Copper results in increased expression of UCHL1 mRNA CTD PMID:22465980 Uchl1 Rat copper(II) chloride increases expression ISO Uchl1 (Mus musculus) 6480464 cupric chloride results in increased expression of UCHL1 protein CTD PMID:29617964 Uchl1 Rat copper(II) sulfate increases expression ISO UCHL1 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of UCHL1 mRNA CTD PMID:19549813 Uchl1 Rat crocidolite asbestos increases expression ISO Uchl1 (Mus musculus) 6480464 Asbestos and Crocidolite results in increased expression of UCHL1 mRNA CTD PMID:19446018 Uchl1 Rat CU-O LINKAGE decreases activity ISO UCHL1 (Homo sapiens) 6480464 cupric oxide results in decreased activity of UCHL1 protein CTD PMID:25470785 Uchl1 Rat Cuprizon multiple interactions ISO UCHL1 (Homo sapiens) 6480464 [Cuprizone co-treated with Benztropine] results in decreased expression of UCHL1 protein and [Cuprizone co-treated with Cannabidiol] results in decreased expression of UCHL1 protein CTD PMID:34122009 Uchl1 Rat cycloheximide multiple interactions EXP 6480464 Cycloheximide inhibits the reaction [Mevinphos results in increased expression of UCHL1 protein] CTD PMID:15545831 Uchl1 Rat cyclosporin A increases expression ISO UCHL1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of UCHL1 mRNA CTD PMID:27989131 and PMID:33631201 Uchl1 Rat daidzein multiple interactions ISO UCHL1 (Homo sapiens) 6480464 [Genistein co-treated with daidzein co-treated with glycitein] results in decreased expression of UCHL1 mRNA CTD PMID:16963248 Uchl1 Rat deguelin decreases expression ISO UCHL1 (Homo sapiens) 6480464 deguelin results in decreased expression of UCHL1 mRNA CTD PMID:33512557 Uchl1 Rat dexamethasone decreases expression ISO UCHL1 (Homo sapiens) 6480464 Dexamethasone results in decreased expression of UCHL1 mRNA CTD PMID:25047013 Uchl1 Rat diallyl trisulfide decreases expression ISO UCHL1 (Homo sapiens) 6480464 diallyl trisulfide results in decreased expression of UCHL1 protein CTD PMID:19550292 Uchl1 Rat diallyl trisulfide increases expression EXP 6480464 diallyl trisulfide results in increased expression of UCHL1 mRNA CTD PMID:34014027 Uchl1 Rat diarsenic trioxide increases expression ISO UCHL1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of UCHL1 mRNA CTD PMID:15725085 Uchl1 Rat diazinon affects expression EXP 6480464 Diazinon affects the expression of UCHL1 mRNA CTD PMID:22546817 Uchl1 Rat dioxygen increases expression ISO UCHL1 (Homo sapiens) 6480464 Oxygen deficiency results in increased expression of UCHL1 protein CTD PMID:32371398 Uchl1 Rat dioxygen multiple interactions ISO UCHL1 (Homo sapiens) 6480464 Oxygen deficiency affects the reaction [UCHL1 protein affects the reaction [TGFB1 protein results in increased expression of SERPINE1 mRNA]] CTD PMID:32371398 Uchl1 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of UCHL1 mRNA CTD PMID:21551480 Uchl1 Rat dorsomorphin multiple interactions ISO UCHL1 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Uchl1 Rat doxorubicin affects expression ISO UCHL1 (Homo sapiens) 6480464 Doxorubicin affects the expression of UCHL1 mRNA and Doxorubicin affects the expression of UCHL1 protein CTD PMID:29385562 and PMID:29803840 Uchl1 Rat doxorubicin increases expression ISO Uchl1 (Mus musculus) 6480464 Doxorubicin results in increased expression of UCHL1 mRNA CTD PMID:36227756 Uchl1 Rat doxorubicin decreases expression EXP 6480464 Doxorubicin results in decreased expression of UCHL1 mRNA CTD PMID:32289291 Uchl1 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of UCHL1 mRNA CTD PMID:29391264 Uchl1 Rat entinostat multiple interactions ISO UCHL1 (Homo sapiens) 6480464 entinostat inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of UCHL1 protein] CTD PMID:33040242 Uchl1 Rat enzyme inhibitor multiple interactions ISO UCHL1 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of UCHL1 protein CTD PMID:23301498 Uchl1 Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of UCHL1 protein CTD PMID:23702218 Uchl1 Rat ethanol affects splicing ISO Uchl1 (Mus musculus) 6480464 Ethanol affects the splicing of UCHL1 mRNA CTD PMID:30319688 Uchl1 Rat ethanol increases expression ISO Uchl1 (Mus musculus) 6480464 Ethanol results in increased expression of UCHL1 mRNA CTD PMID:30319688 Uchl1 Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of UCHL1 mRNA CTD PMID:31734597 Uchl1 Rat ferric oxide increases expression EXP 6480464 ferric oxide analog results in increased expression of UCHL1 mRNA CTD PMID:38615722 Uchl1 Rat flavonoids increases expression EXP 6480464 Flavonoids results in increased expression of UCHL1 mRNA CTD PMID:18035473 Uchl1 Rat folic acid multiple interactions ISO Uchl1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of UCHL1 mRNA CTD PMID:20938992 Uchl1 Rat furan increases expression EXP 6480464 furan results in increased expression of UCHL1 mRNA CTD PMID:27387713 Uchl1 Rat genistein multiple interactions ISO UCHL1 (Homo sapiens) 6480464 [Genistein co-treated with daidzein co-treated with glycitein] results in decreased expression of UCHL1 mRNA CTD PMID:16963248 Uchl1 Rat genistein decreases expression EXP 6480464 Genistein results in decreased expression of UCHL1 mRNA CTD PMID:12075121 Uchl1 Rat glutathione multiple interactions ISO UCHL1 (Homo sapiens) 6480464 Glutathione inhibits the reaction [1 and 2-naphthoquinone results in increased metabolism of and results in decreased activity of UCHL1 protein] CTD PMID:24582816 Uchl1 Rat glycitein multiple interactions ISO UCHL1 (Homo sapiens) 6480464 [Genistein co-treated with daidzein co-treated with glycitein] results in decreased expression of UCHL1 mRNA CTD PMID:16963248 Uchl1 Rat glyphosate decreases expression ISO Uchl1 (Mus musculus) 6480464 Glyphosate results in decreased expression of UCHL1 protein CTD PMID:37208198 Uchl1 Rat hydrogen peroxide affects expression ISO UCHL1 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of UCHL1 mRNA CTD PMID:20044591 Uchl1 Rat isoprenaline increases expression ISO Uchl1 (Mus musculus) 6480464 Isoproterenol results in increased expression of UCHL1 mRNA CTD PMID:20003209 Uchl1 Rat ivermectin decreases expression ISO UCHL1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of UCHL1 protein CTD PMID:32959892 Uchl1 Rat kainic acid increases expression EXP 6480464 Kainic Acid results in increased expression of UCHL1 protein CTD PMID:22790971 Uchl1 Rat L-methionine multiple interactions ISO Uchl1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of UCHL1 mRNA CTD PMID:20938992 Uchl1 Rat Licochalcone B increases expression ISO UCHL1 (Homo sapiens) 6480464 licochalcone B results in increased expression of UCHL1 mRNA CTD PMID:33647349 Uchl1 Rat lidocaine multiple interactions ISO Uchl1 (Mus musculus) 6480464 NGF protein inhibits the reaction [Lidocaine results in decreased expression of UCHL1 protein] and NNAT protein inhibits the reaction [Lidocaine results in decreased expression of UCHL1 protein] CTD PMID:34193770 Uchl1 Rat lidocaine decreases expression ISO Uchl1 (Mus musculus) 6480464 Lidocaine results in decreased expression of UCHL1 protein CTD PMID:34193770 Uchl1 Rat lidocaine decreases expression ISO UCHL1 (Homo sapiens) 6480464 Lidocaine results in decreased expression of UCHL1 protein CTD PMID:34193770 Uchl1 Rat lidocaine multiple interactions ISO UCHL1 (Homo sapiens) 6480464 NNAT protein inhibits the reaction [Lidocaine results in decreased expression of UCHL1 protein] CTD PMID:34193770 Uchl1 Rat maneb multiple interactions ISO Uchl1 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of UCHL1 protein and [Paraquat co-treated with Maneb] results in decreased expression of UCHL1 mRNA CTD PMID:18386188 and PMID:23562983 Uchl1 Rat manganese atom decreases expression EXP 6480464 Manganese results in decreased expression of UCHL1 protein CTD PMID:20798247 Uchl1 Rat manganese atom multiple interactions ISO UCHL1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of UCHL1 mRNA CTD PMID:39836092 Uchl1 Rat manganese(0) decreases expression EXP 6480464 Manganese results in decreased expression of UCHL1 protein CTD PMID:20798247 Uchl1 Rat manganese(0) multiple interactions ISO UCHL1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of UCHL1 mRNA CTD PMID:39836092 Uchl1 Rat manganese(II) chloride decreases expression EXP 6480464 manganese chloride results in decreased expression of UCHL1 protein CTD PMID:20798247 Uchl1 Rat manganese(II) chloride multiple interactions ISO UCHL1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of UCHL1 mRNA CTD PMID:39836092 Uchl1 Rat mercury dibromide increases expression ISO UCHL1 (Homo sapiens) 6480464 mercuric bromide results in increased expression of UCHL1 mRNA CTD PMID:26272509 Uchl1 Rat mercury dibromide multiple interactions ISO UCHL1 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of UCHL1 mRNA CTD PMID:27188386 Uchl1 Rat methamphetamine decreases expression ISO Uchl1 (Mus musculus) 6480464 Methamphetamine results in decreased expression of UCHL1 protein CTD PMID:16181420 Uchl1 Rat methamphetamine increases expression EXP 6480464 Methamphetamine results in increased expression of UCHL1 protein CTD PMID:19826936 Uchl1 Rat methylmercury chloride increases expression ISO Uchl1 (Mus musculus) 6480464 methylmercuric chloride results in increased expression of UCHL1 mRNA CTD PMID:20061341 Uchl1 Rat methylmercury chloride multiple interactions ISO UCHL1 (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of UCHL1 mRNA CTD PMID:27188386 Uchl1 Rat methylmercury chloride increases expression ISO UCHL1 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of UCHL1 mRNA CTD PMID:23179753 more ... Uchl1 Rat mevinphos increases expression EXP 6480464 Mevinphos results in increased expression of UCHL1 protein CTD PMID:15545831 Uchl1 Rat mevinphos multiple interactions EXP 6480464 Cycloheximide inhibits the reaction [Mevinphos results in increased expression of UCHL1 protein] and Dactinomycin inhibits the reaction [Mevinphos results in increased expression of UCHL1 protein] CTD PMID:15545831 Uchl1 Rat mitomycin C affects response to substance ISO UCHL1 (Homo sapiens) 6480464 UCHL1 protein affects the susceptibility to Mitomycin CTD PMID:16217747 Uchl1 Rat mitoxantrone affects response to substance ISO UCHL1 (Homo sapiens) 6480464 UCHL1 protein affects the susceptibility to Mitoxantrone CTD PMID:16217747 Uchl1 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal increases expression ISO Uchl1 (Mus musculus) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased expression of UCHL1 mRNA CTD PMID:20061341 Uchl1 Rat N-methyl-N'-nitro-N-nitrosoguanidine increases expression ISO UCHL1 (Homo sapiens) 6480464 Methylnitronitrosoguanidine results in increased expression of UCHL1 mRNA CTD PMID:12634122 Uchl1 Rat naphthalene increases expression ISO Uchl1 (Mus musculus) 6480464 naphthalene results in increased expression of UCHL1 mRNA and naphthalene results in increased expression of UCHL1 protein CTD PMID:18687389 and PMID:18978301 Uchl1 Rat nickel dichloride affects expression EXP 6480464 nickel chloride affects the expression of UCHL1 mRNA CTD PMID:22546817 Uchl1 Rat nicotine multiple interactions ISO Uchl1 (Mus musculus) 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Uchl1 Rat nitrofen multiple interactions EXP 6480464 Tretinoin inhibits the reaction [nitrofen results in decreased expression of UCHL1 protein] CTD PMID:21952554 Uchl1 Rat nitrofen decreases expression EXP 6480464 nitrofen results in decreased expression of UCHL1 protein CTD PMID:21952554 Uchl1 Rat oxidopamine increases expression EXP 6480464 Oxidopamine results in increased expression of UCHL1 mRNA CTD PMID:25129099 Uchl1 Rat oxidopamine multiple interactions EXP 6480464 isoquercitrin inhibits the reaction [Oxidopamine results in increased expression of UCHL1 mRNA] more ... CTD PMID:25129099 Uchl1 Rat ozone increases expression ISO Uchl1 (Mus musculus) 6480464 Ozone results in increased expression of UCHL1 mRNA CTD PMID:31626304 Uchl1 Rat ozone multiple interactions ISO Uchl1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of UCHL1 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of UCHL1 mRNA CTD PMID:34911549 Uchl1 Rat p-chloromercuribenzoic acid increases expression ISO UCHL1 (Homo sapiens) 6480464 p-Chloromercuribenzoic Acid results in increased expression of UCHL1 mRNA CTD PMID:26272509 Uchl1 Rat p-chloromercuribenzoic acid multiple interactions ISO UCHL1 (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of UCHL1 mRNA CTD PMID:27188386 Uchl1 Rat paclitaxel increases expression EXP 6480464 Paclitaxel results in increased expression of UCHL1 protein CTD PMID:16797537 Uchl1 Rat paracetamol affects expression ISO Uchl1 (Mus musculus) 6480464 Acetaminophen affects the expression of UCHL1 mRNA CTD PMID:17562736 Uchl1 Rat paracetamol decreases expression ISO UCHL1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of UCHL1 mRNA CTD PMID:26690555 Uchl1 Rat paracetamol increases expression ISO UCHL1 (Homo sapiens) 6480464 Acetaminophen results in increased expression of UCHL1 mRNA CTD PMID:21420995 Uchl1 Rat paraquat decreases expression ISO Uchl1 (Mus musculus) 6480464 Paraquat results in decreased expression of UCHL1 mRNA CTD PMID:21371552 Uchl1 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of UCHL1 mRNA CTD PMID:32680482 Uchl1 Rat paraquat multiple interactions ISO Uchl1 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of UCHL1 protein and [Paraquat co-treated with Maneb] results in decreased expression of UCHL1 mRNA CTD PMID:18386188 and PMID:23562983 Uchl1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Uchl1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of UCHL1 mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in increased expression of UCHL1 mRNA CTD PMID:36331819 Uchl1 Rat phenethyl isothiocyanate affects binding ISO UCHL1 (Homo sapiens) 6480464 UCHL1 protein binds to phenethyl isothiocyanate CTD PMID:21838287 Uchl1 Rat phenylephrine increases expression EXP 6480464 Phenylephrine results in increased expression of UCHL1 mRNA CTD PMID:18158353 Uchl1 Rat phenylmercury acetate increases expression ISO UCHL1 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of UCHL1 mRNA CTD PMID:26272509 Uchl1 Rat phenylmercury acetate multiple interactions ISO UCHL1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of UCHL1 mRNA CTD PMID:27188386 Uchl1 Rat pinosylvin increases expression ISO UCHL1 (Homo sapiens) 6480464 pinosylvin results in increased expression of UCHL1 mRNA CTD PMID:23333577 Uchl1 Rat pirinixic acid multiple interactions ISO UCHL1 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of UCHL1 mRNA CTD PMID:19710929 Uchl1 Rat pirinixic acid decreases expression ISO Uchl1 (Mus musculus) 6480464 pirinixic acid results in decreased expression of UCHL1 mRNA CTD PMID:16985257 Uchl1 Rat progesterone decreases expression EXP 6480464 Progesterone results in decreased expression of UCHL1 mRNA CTD PMID:20726854 Uchl1 Rat pyrogallol increases expression ISO Uchl1 (Mus musculus) 6480464 Pyrogallol results in increased expression of UCHL1 mRNA CTD PMID:20362636 Uchl1 Rat quercetin 3-O-beta-D-glucofuranoside multiple interactions EXP 6480464 isoquercitrin inhibits the reaction [Oxidopamine results in increased expression of UCHL1 mRNA] CTD PMID:25129099 Uchl1 Rat quercetin 3-O-beta-D-glucopyranoside multiple interactions EXP 6480464 isoquercitrin inhibits the reaction [Oxidopamine results in increased expression of UCHL1 mRNA] CTD PMID:25129099 Uchl1 Rat resiniferatoxin multiple interactions ISO Uchl1 (Mus musculus) 6480464 4-methylcatechol inhibits the reaction [resiniferatoxin results in decreased expression of UCHL1 protein] CTD PMID:18219259 Uchl1 Rat resiniferatoxin decreases expression ISO Uchl1 (Mus musculus) 6480464 resiniferatoxin results in decreased expression of UCHL1 protein CTD PMID:18219259 Uchl1 Rat rotenone decreases expression ISO Uchl1 (Mus musculus) 6480464 Rotenone results in decreased expression of UCHL1 mRNA CTD PMID:23186747 Uchl1 Rat rutin multiple interactions EXP 6480464 Rutin inhibits the reaction [Oxidopamine results in increased expression of UCHL1 mRNA] CTD PMID:25129099 Uchl1 Rat sarin affects expression EXP 6480464 Sarin affects the expression of UCHL1 protein CTD PMID:28973502 Uchl1 Rat SB 431542 multiple interactions ISO UCHL1 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Uchl1 Rat silicon dioxide decreases expression EXP 6480464 Silicon Dioxide analog results in decreased expression of UCHL1 protein CTD PMID:27613482 Uchl1 Rat silver atom increases expression ISO Uchl1 (Mus musculus) 6480464 Silver results in increased expression of UCHL1 mRNA CTD PMID:27131904 Uchl1 Rat silver(0) increases expression ISO Uchl1 (Mus musculus) 6480464 Silver results in increased expression of UCHL1 mRNA CTD PMID:27131904 Uchl1 Rat sodium arsenate multiple interactions ISO UCHL1 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of UCHL1 mRNA CTD PMID:32525701 Uchl1 Rat sodium arsenite decreases methylation ISO UCHL1 (Homo sapiens) 6480464 sodium arsenite results in decreased methylation of UCHL1 gene CTD PMID:25199682 Uchl1 Rat sodium arsenite decreases expression ISO Uchl1 (Mus musculus) 6480464 sodium arsenite results in decreased expression of UCHL1 mRNA CTD PMID:37682722 Uchl1 Rat sodium arsenite multiple interactions ISO UCHL1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of UCHL1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of UCHL1 mRNA CTD PMID:39836092 Uchl1 Rat sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of UCHL1 protein CTD PMID:29459688 Uchl1 Rat sodium arsenite increases expression ISO Uchl1 (Mus musculus) 6480464 sodium arsenite results in increased expression of UCHL1 mRNA CTD PMID:16014739 and PMID:25270620 Uchl1 Rat sodium arsenite increases expression ISO UCHL1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of UCHL1 mRNA CTD PMID:21281968 and PMID:38568856 Uchl1 Rat sodium chromate multiple interactions ISO UCHL1 (Homo sapiens) 6480464 ERRFI1 protein inhibits the reaction [sodium chromate(VI) results in increased expression of UCHL1 protein] CTD PMID:28688920 Uchl1 Rat sodium chromate increases expression ISO UCHL1 (Homo sapiens) 6480464 sodium chromate(VI) results in increased expression of UCHL1 protein CTD PMID:28688920 Uchl1 Rat sodium fluoride decreases expression ISO Uchl1 (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of UCHL1 protein CTD PMID:28918527 Uchl1 Rat streptozocin multiple interactions EXP 6480464 4-phenylbutyric acid inhibits the reaction [Streptozocin results in increased expression of UCHL1 protein] CTD PMID:30980806 Uchl1 Rat streptozocin decreases expression EXP 6480464 Streptozocin results in decreased expression of UCHL1 protein CTD PMID:30583000 Uchl1 Rat streptozocin increases expression EXP 6480464 Streptozocin results in increased expression of UCHL1 protein CTD PMID:30980806 Uchl1 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of UCHL1 mRNA CTD PMID:30047161 Uchl1 Rat sunitinib increases expression ISO UCHL1 (Homo sapiens) 6480464 Sunitinib results in increased expression of UCHL1 mRNA CTD PMID:31533062 Uchl1 Rat T-2 toxin affects expression EXP 6480464 T-2 Toxin affects the expression of UCHL1 protein CTD PMID:26141394 Uchl1 Rat tebufenpyrad decreases expression ISO UCHL1 (Homo sapiens) 6480464 4-chloro-N-((4-(1 and 1-dimethylethyl)phenyl)methyl)-3-ethyl-1-methyl-1H-pyrazole-5-carboxamide results in decreased expression of UCHL1 mRNA CTD PMID:33512557 Uchl1 Rat thapsigargin increases expression EXP 6480464 Thapsigargin results in increased expression of UCHL1 protein CTD PMID:35544339 Uchl1 Rat theophylline affects expression EXP 6480464 Theophylline affects the expression of UCHL1 mRNA CTD PMID:16988215 Uchl1 Rat titanium dioxide increases expression ISO Uchl1 (Mus musculus) 6480464 titanium dioxide results in increased expression of UCHL1 mRNA CTD PMID:27760801 Uchl1 Rat titanium dioxide decreases methylation ISO Uchl1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of UCHL1 gene CTD PMID:35295148 Uchl1 Rat titanium dioxide decreases expression ISO Uchl1 (Mus musculus) 6480464 titanium dioxide results in decreased expression of UCHL1 mRNA CTD PMID:23557971 Uchl1 Rat topotecan affects response to substance ISO UCHL1 (Homo sapiens) 6480464 UCHL1 protein affects the susceptibility to Topotecan CTD PMID:16217747 Uchl1 Rat trans-pinosylvin increases expression ISO UCHL1 (Homo sapiens) 6480464 pinosylvin results in increased expression of UCHL1 mRNA CTD PMID:23333577 Uchl1 Rat trichostatin A multiple interactions ISO UCHL1 (Homo sapiens) 6480464 [[Decitabine co-treated with trichostatin A] affects the methylation of UCHL1 promoter] which affects the expression of UCHL1 mRNA and trichostatin A inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of UCHL1 protein] CTD PMID:18666234 and PMID:33040242 Uchl1 Rat triptonide increases expression ISO Uchl1 (Mus musculus) 6480464 triptonide results in increased expression of UCHL1 mRNA CTD PMID:33045310 Uchl1 Rat Tungsten carbide multiple interactions ISO UCHL1 (Homo sapiens) 6480464 [tungsten carbide co-treated with Cobalt] results in increased expression of UCHL1 mRNA CTD PMID:23052192 Uchl1 Rat valproic acid increases expression ISO Uchl1 (Mus musculus) 6480464 Valproic Acid results in increased expression of UCHL1 mRNA CTD PMID:19136453 and PMID:21427059 Uchl1 Rat valproic acid multiple interactions EXP 6480464 [Valproic Acid co-treated with Vitamin A deficiency] affects the expression of UCHL1 protein CTD PMID:32526256 Uchl1 Rat valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of UCHL1 mRNA and Valproic Acid results in decreased expression of UCHL1 protein CTD PMID:32526256 Uchl1 Rat valproic acid affects expression ISO UCHL1 (Homo sapiens) 6480464 Valproic Acid affects the expression of UCHL1 mRNA CTD PMID:25979313 Uchl1 Rat valproic acid multiple interactions ISO UCHL1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of UCHL1 mRNA CTD PMID:27188386 Uchl1 Rat valproic acid increases expression ISO UCHL1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of UCHL1 mRNA CTD PMID:23179753 more ... Uchl1 Rat vincristine increases expression EXP 6480464 Vincristine results in increased expression of UCHL1 protein CTD PMID:16797537 Uchl1 Rat vitamin E increases expression ISO UCHL1 (Homo sapiens) 6480464 Vitamin E results in increased expression of UCHL1 mRNA CTD PMID:19244175 Uchl1 Rat zearalenone decreases expression ISO Uchl1 (Mus musculus) 6480464 Zearalenone results in decreased expression of UCHL1 protein CTD PMID:36252740
Imported Annotations - KEGG (archival)
(1->4)-beta-D-glucan (ISO) (S)-nicotine (ISO) 1,2-dimethylhydrazine (ISO) 1,2-naphthoquinone (ISO) 1,3-dinitrobenzene (EXP) 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO) 1-naphthyl isothiocyanate (EXP) 17alpha-ethynylestradiol (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP,ISO) 2-methoxyethanol (EXP) 4-hydroxynon-2-enal (ISO) 4-methylcatechol (ISO) 4-phenylbutyric acid (EXP) 5-aza-2'-deoxycytidine (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (ISO) actinomycin D (EXP) aflatoxin B1 (ISO) aflatoxin M1 (ISO) all-trans-retinoic acid (EXP,ISO) all-trans-retinol (EXP) allopurinol (EXP) amitrole (EXP) ammonium chloride (EXP) antimycin A (ISO) antirheumatic drug (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenic trichloride (ISO) arsenite(3-) (ISO) arsenous acid (ISO) azoxystrobin (ISO) benzatropine (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) buta-1,3-diene (ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) caffeine (ISO) cannabidiol (ISO) carbon nanotube (ISO) cefaloridine (EXP) chlordecone (ISO) chloropicrin (ISO) chloroprene (ISO) chlorpyrifos (ISO) choline (ISO) cobalt atom (ISO) cocaine (ISO) copper atom (EXP,ISO) copper(0) (EXP,ISO) copper(II) chloride (ISO) copper(II) sulfate (ISO) crocidolite asbestos (ISO) CU-O LINKAGE (ISO) Cuprizon (ISO) cycloheximide (EXP) cyclosporin A (ISO) daidzein (ISO) deguelin (ISO) dexamethasone (ISO) diallyl trisulfide (EXP,ISO) diarsenic trioxide (ISO) diazinon (EXP) dioxygen (ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (EXP,ISO) endosulfan (EXP) entinostat (ISO) enzyme inhibitor (ISO) ethanol (EXP,ISO) fenvalerate (EXP) ferric oxide (EXP) flavonoids (EXP) folic acid (ISO) furan (EXP) genistein (EXP,ISO) glutathione (ISO) glycitein (ISO) glyphosate (ISO) hydrogen peroxide (ISO) isoprenaline (ISO) ivermectin (ISO) kainic acid (EXP) L-methionine (ISO) Licochalcone B (ISO) lidocaine (ISO) maneb (ISO) manganese atom (EXP,ISO) manganese(0) (EXP,ISO) manganese(II) chloride (EXP,ISO) mercury dibromide (ISO) methamphetamine (EXP,ISO) methylmercury chloride (ISO) mevinphos (EXP) mitomycin C (ISO) mitoxantrone (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) N-methyl-N'-nitro-N-nitrosoguanidine (ISO) naphthalene (ISO) nickel dichloride (EXP) nicotine (ISO) nitrofen (EXP) oxidopamine (EXP) ozone (ISO) p-chloromercuribenzoic acid (ISO) paclitaxel (EXP) paracetamol (ISO) paraquat (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) phenethyl isothiocyanate (ISO) phenylephrine (EXP) phenylmercury acetate (ISO) pinosylvin (ISO) pirinixic acid (ISO) progesterone (EXP) pyrogallol (ISO) quercetin 3-O-beta-D-glucofuranoside (EXP) quercetin 3-O-beta-D-glucopyranoside (EXP) resiniferatoxin (ISO) rotenone (ISO) rutin (EXP) sarin (EXP) SB 431542 (ISO) silicon dioxide (EXP) silver atom (ISO) silver(0) (ISO) sodium arsenate (ISO) sodium arsenite (EXP,ISO) sodium chromate (ISO) sodium fluoride (ISO) streptozocin (EXP) sulfadimethoxine (EXP) sunitinib (ISO) T-2 toxin (EXP) tebufenpyrad (ISO) thapsigargin (EXP) theophylline (EXP) titanium dioxide (ISO) topotecan (ISO) trans-pinosylvin (ISO) trichostatin A (ISO) triptonide (ISO) Tungsten carbide (ISO) valproic acid (EXP,ISO) vincristine (EXP) vitamin E (ISO) zearalenone (ISO)
Biological Process
adult walking behavior (IEA,ISO) axon target recognition (IEA,ISO) axonal transport of mitochondrion (IEA,ISO) axonogenesis (IEA,ISO) cellular response to xenobiotic stimulus (IEA,ISO) eating behavior (IEA,ISO) male germ cell proliferation (IEA,ISO) muscle cell development (IEA,ISO) negative regulation of MAPK cascade (ISO) neuromuscular process (IEA,ISO) positive regulation of glycolytic process (IEA,ISO) protein catabolic process (IBA) protein deubiquitination (IEA,ISO) proteolysis (IEA) response to ischemia (IEA,ISO) substantia nigra development (ISO) ubiquitin-dependent protein catabolic process (IDA,IEA)
1.
Oxidative modifications and down-regulation of ubiquitin carboxyl-terminal hydrolase L1 associated with idiopathic Parkinson's and Alzheimer's diseases.
Choi J, etal., J Biol Chem. 2004 Mar 26;279(13):13256-64. Epub 2004 Jan 13.
2.
The ubiquitin proteasome system in neurodegenerative diseases: sometimes the chicken, sometimes the egg.
Ciechanover A and Brundin P, Neuron 2003 Oct 9;40(2):427-46.
3.
Changes in ocular aquaporin-4 (AQP4) expression following retinal injury.
Dibas A, etal., Mol Vis. 2008 Sep 25;14:1770-83.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
6.
Patient education: how we designed our own program.
Hoffman LE Jr Group Pract 1976 Sep-Oct;25(5):21-4.
7.
cDNA cloning and tissue distribution of a rat ubiquitin carboxyl-terminal hydrolase PGP9.5.
Kajimoto Y, etal., J Biochem (Tokyo) 1992 Jul;112(1):28-32.
8.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
9.
Loss of Uch-L1 and Uch-L3 leads to neurodegeneration, posterior paralysis and dysphagia.
Kurihara LJ, etal., Hum Mol Genet 2001 Sep 1;10(18):1963-70.
10.
The ubiquitin pathway in Parkinson's disease.
Leroy E, etal., Nature 1998 Oct 1;395(6701):451-2.
11.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
12.
A role of the ubiquitin-proteasome system in neuropathic pain.
Moss A, etal., J Neurosci 2002 Feb 15;22(4):1363-72.
13.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
14.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
15.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
16.
GOA pipeline
RGD automated data pipeline
17.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
18.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
19.
Intragenic deletion in the gene encoding ubiquitin carboxy-terminal hydrolase in gad mice.
Saigoh K, etal., Nat Genet 1999 Sep;23(1):47-51.
20.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
Uchl1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 41,838,859 - 41,849,743 (-) NCBI GRCr8 mRatBN7.2 14 41,485,031 - 41,495,590 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 41,485,031 - 41,495,590 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 41,831,048 - 41,841,616 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 43,131,128 - 43,141,696 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 41,611,942 - 41,622,510 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 43,133,224 - 43,143,942 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 43,133,218 - 43,143,973 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 42,928,247 - 42,938,981 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 44,114,392 - 44,124,947 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 44,116,782 - 44,127,338 (-) NCBI Celera 14 40,639,549 - 40,650,302 (-) NCBI Celera Cytogenetic Map 14 p11 NCBI
UCHL1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 41,256,928 - 41,268,455 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 41,256,413 - 41,268,455 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 41,258,945 - 41,270,472 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 40,953,686 - 40,965,203 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 4 41,099,856 - 41,111,373 NCBI Celera 4 41,702,199 - 41,713,746 (+) NCBI Celera Cytogenetic Map 4 p13 NCBI HuRef 4 40,580,844 - 40,592,391 (+) NCBI HuRef CHM1_1 4 41,259,044 - 41,270,591 (+) NCBI CHM1_1 T2T-CHM13v2.0 4 41,230,716 - 41,242,242 (+) NCBI T2T-CHM13v2.0
Uchl1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 66,833,464 - 66,844,577 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 66,833,434 - 66,844,577 (+) Ensembl GRCm39 Ensembl GRCm38 5 66,676,121 - 66,687,234 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 66,676,091 - 66,687,234 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 67,067,360 - 67,078,473 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 66,955,425 - 66,966,369 (+) NCBI MGSCv36 mm8 Celera 5 63,976,841 - 63,987,914 (+) NCBI Celera Cytogenetic Map 5 C3.1 NCBI cM Map 5 35.95 NCBI
Uchl1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955443 6,367,460 - 6,380,462 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955443 6,367,519 - 6,379,638 (-) NCBI ChiLan1.0 ChiLan1.0
UCHL1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 41,440,064 - 41,451,601 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 41,633,489 - 41,645,029 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 35,580,755 - 35,592,314 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 41,432,367 - 41,440,129 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 41,428,759 - 41,440,129 (+) Ensembl panpan1.1 panPan2
UCHL1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 3 71,396,694 - 71,430,395 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 3 71,370,822 - 71,411,350 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 3 73,946,978 - 73,961,370 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 3 72,157,557 - 72,171,966 (-) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 3 71,427,585 - 71,441,983 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 3 71,589,640 - 71,604,050 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 3 71,972,745 - 71,987,146 (-) NCBI UU_Cfam_GSD_1.0
Uchl1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405285 37,734,649 - 37,746,530 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936482 8,551,603 - 8,563,651 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936482 8,551,749 - 8,563,586 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
UCHL1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 8 32,353,246 - 32,367,332 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 8 32,353,766 - 32,367,288 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 8 33,970,620 - 33,982,399 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
UCHL1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 27 9,074,961 - 9,086,606 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 27 9,074,923 - 9,086,517 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666047 55,406,774 - 55,418,174 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Uchl1
.
Predicted Target Of
Count of predictions: 70 Count of miRNA genes: 57 Interacting mature miRNAs: 65 Transcripts: ENSRNOT00000003248 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2313089 Bss81 Bone structure and strength QTL 81 3.4 0.0001 body length (VT:0001256) body length, nose to rump (CMO:0000079) 14 37669719 82669719 Rat 1581500 Renag1 Renal agenesis QTL 1 kidney development trait (VT:0000527) percentage of study population developing unilateral renal agenesis during a period of time (CMO:0000940) 14 8170668 68298175 Rat 10755459 Coatc15 Coat color QTL 15 0.01681 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 14 19836944 64836944 Rat 70214 Niddm28 Non-insulin dependent diabetes mellitus QTL 28 4.06 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 14 39998251 75582726 Rat 1300154 Bp189 Blood pressure QTL 189 3.04 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 14 30883777 68757901 Rat 70187 Pancm5 Pancreatic morphology QTL 5 16.7 pancreas mass (VT:0010144) pancreas weight to body weight ratio (CMO:0000630) 14 30320092 80829842 Rat 631523 Pia13 Pristane induced arthritis QTL 13 3.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 14 40793460 98037301 Rat 1358296 Ael3 Aortic elastin QTL 3 3.7 0.00051 aorta elastin amount (VT:0003905) aortic elastin 14 8267090 53267090 Rat 71117 Niddm17 Non-insulin dependent diabetes mellitus QTL 17 2.35 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 14 17593761 42336881 Rat 61420 Pia6 Pristane induced arthritis QTL 6 4.9 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 14 18631345 42337007 Rat 2313100 Bss82 Bone structure and strength QTL 82 3 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 14 37669719 82669719 Rat 7387267 Uae42 Urinary albumin excretion QTL 42 0.61 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 14 22167967 67167967 Rat 631839 Niddm37 Non-insulin dependent diabetes mellitus QTL 37 3.37 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 14 11030622 95876975 Rat 2313397 Coatc1 Coat color QTL1 coat/hair pigmentation trait (VT:0010463) coat/hair color measurement (CMO:0001808) 14 18541332 63541332 Rat 631262 Tcas4 Tongue tumor susceptibility QTL 4 7.29 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 14 17622561 42337007 Rat 2313048 Bss84 Bone structure and strength QTL 84 3.1 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 14 37669719 82669719 Rat 2302045 Pia39 Pristane induced arthritis QTL 39 4.9 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G2a level (CMO:0002116) 14 8267090 53267090 Rat 738037 Hcas6 Hepatocarcinoma susceptibility QTL 6 2.93 liver integrity trait (VT:0010547) liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464) 14 39057237 83368335 Rat 2313084 Bss83 Bone structure and strength QTL 83 2.9 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 14 37669719 82669719 Rat
RH128109
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 41,485,066 - 41,485,252 (+) MAPPER mRatBN7.2 Rnor_6.0 14 43,133,258 - 43,133,443 NCBI Rnor6.0 Rnor_5.0 14 42,928,281 - 42,928,466 UniSTS Rnor5.0 RGSC_v3.4 14 44,114,426 - 44,114,611 UniSTS RGSC3.4 Celera 14 40,639,583 - 40,639,768 UniSTS Cytogenetic Map 14 p11 UniSTS
BF399140
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 41,492,213 - 41,492,422 (+) MAPPER mRatBN7.2 Rnor_6.0 14 43,140,568 - 43,140,776 NCBI Rnor6.0 Rnor_5.0 14 42,935,591 - 42,935,799 UniSTS Rnor5.0 RGSC_v3.4 14 44,121,573 - 44,121,781 UniSTS RGSC3.4 Celera 14 40,646,926 - 40,647,134 UniSTS Cytogenetic Map 14 p11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
85
84
53
25
53
6
212
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000003248 ⟹ ENSRNOP00000003248
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 41,485,031 - 41,495,590 (-) Ensembl Rnor_6.0 Ensembl 14 43,133,218 - 43,143,973 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000094226 ⟹ ENSRNOP00000086461
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 41,485,031 - 41,495,590 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000106879 ⟹ ENSRNOP00000082700
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 41,485,031 - 41,495,590 (-) Ensembl
RefSeq Acc Id:
NM_017237 ⟹ NP_058933
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 41,838,859 - 41,849,417 (-) NCBI mRatBN7.2 14 41,485,031 - 41,495,590 (-) NCBI Rnor_6.0 14 43,133,224 - 43,143,942 (-) NCBI Rnor_5.0 14 42,928,247 - 42,938,981 (-) NCBI RGSC_v3.4 14 44,114,392 - 44,124,947 (-) RGD Celera 14 40,639,549 - 40,650,302 (-) RGD
Sequence:
GGCTGTTTTTTGGCTCCTGCGCTTGTTCTTCCCTGTGCACTCCGCAAAGATGCAGCTGAAACCGATGGAGATTAACCCCGAGATGCTGAACAAAGTGTTGGCCAAGCTGGGGGTCGCCGGGCAGTGGC
hide sequence
RefSeq Acc Id:
XM_063273003 ⟹ XP_063129073
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 41,839,356 - 41,849,493 (-) NCBI
RefSeq Acc Id:
XM_063273004 ⟹ XP_063129074
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 41,838,859 - 41,849,743 (-) NCBI
RefSeq Acc Id:
NP_058933 ⟸ NM_017237
- UniProtKB:
Q6P9V8 (UniProtKB/Swiss-Prot), Q00981 (UniProtKB/Swiss-Prot), A6JDB6 (UniProtKB/TrEMBL), A0A8L2Q0S4 (UniProtKB/TrEMBL), A6JDB5 (UniProtKB/TrEMBL)
- Sequence:
MQLKPMEINPEMLNKVLAKLGVAGQWRFADVLGLEEETLGSVPSPACALLLLFPLTAQHENFRKKQIEELKGQEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLEFEDGSVLKQFLSETEKLSPED
hide sequence
Ensembl Acc Id:
ENSRNOP00000003248 ⟸ ENSRNOT00000003248
Ensembl Acc Id:
ENSRNOP00000086461 ⟸ ENSRNOT00000094226
Ensembl Acc Id:
ENSRNOP00000082700 ⟸ ENSRNOT00000106879
RefSeq Acc Id:
XP_063129074 ⟸ XM_063273004
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6G7R6 (UniProtKB/TrEMBL), A0A8L2Q0S4 (UniProtKB/TrEMBL), A6JDB5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063129073 ⟸ XM_063273003
- Peptide Label:
isoform X1
- UniProtKB:
A0A8L2Q0S4 (UniProtKB/TrEMBL), A6JDB5 (UniProtKB/TrEMBL)
RGD ID: 13699307 Promoter ID: EPDNEW_R9832 Type: multiple initiation site Name: Uchl1_1 Description: ubiquitin C-terminal hydrolase L1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 14 43,143,942 - 43,144,002 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-11-19
Uchl1
ubiquitin C-terminal hydrolase L1
Uchl1
ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-08-29
Uchl1
ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase)
Uchl1
ubiquitin carboxy-terminal hydrolase L1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Uchl1
ubiquitin carboxy-terminal hydrolase L1
Name updated
70584 APPROVED
