Symbol:
Sod3
Name:
superoxide dismutase 3
RGD ID:
3733
Description:
Enables superoxide dismutase activity. Involved in blood vessel diameter maintenance; response to copper ion; and response to oxidative stress. Located in collagen-containing extracellular matrix and extracellular space. Used to study hypertension. Human ortholog(s) of this gene implicated in several diseases, including coronary artery disease (multiple); diabetes mellitus (multiple); diabetic retinopathy; lung disease (multiple); and polyneuropathy. Orthologous to human SOD3 (superoxide dismutase 3); PARTICIPATES IN cardiovascular system disease pathway; diabetes mellitus pathway; INTERACTS WITH 1,2-dimethylhydrazine; 17alpha-ethynylestradiol; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
EC-SOD; ECSODPT; extracellular superoxide dismutase; extracellular superoxide dismutase [Cu-Zn]; Superoxide dimutase 3; superoxide dismutase 3, extracellular; superoxide dismutase B
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SOD3 (superoxide dismutase 3) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Sod3 (superoxide dismutase 3, extracellular) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Sod3 (superoxide dismutase 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SOD3 (superoxide dismutase 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SOD3 (superoxide dismutase 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SOD3 (superoxide dismutase 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SOD3 (superoxide dismutase 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Sod3 (superoxide dismutase 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Sod3 (superoxide dismutase 3, extracellular)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
SOD3 (superoxide dismutase 3)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
sod3b (superoxide dismutase 3, extracellular b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
sod3a (superoxide dismutase 3, extracellular a)
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
CG5948
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Saccharomyces cerevisiae (baker's yeast):
SOD1
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Caenorhabditis elegans (roundworm):
sod-1
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Caenorhabditis elegans (roundworm):
sod-5
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Xenopus tropicalis (tropical clawed frog):
sod3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Allele / Splice:
Sod3m1Mcwi
Genetic Models:
SS-Sod3m1Mcwi
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 62,822,865 - 62,828,602 (-) NCBI GRCr8 mRatBN7.2 14 58,610,104 - 58,615,845 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 58,609,958 - 58,615,990 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 63,014,801 - 63,020,544 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 64,328,499 - 64,334,244 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 60,725,263 - 60,731,010 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 60,958,583 - 60,971,143 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 60,958,592 - 60,964,324 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 61,071,304 - 61,083,776 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 63,381,447 - 63,387,180 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 63,383,838 - 63,389,571 (-) NCBI Celera 14 57,707,717 - 57,713,440 (-) NCBI Celera Cytogenetic Map 14 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Sod3 Rat (+)-catechin multiple interactions ISO SOD3 (Homo sapiens) 6480464 [Oxygen deficiency co-treated with Catechin] results in decreased expression of SOD3 mRNA CTD PMID:35883890 Sod3 Rat (-)-epigallocatechin 3-gallate decreases expression ISO SOD3 (Homo sapiens) 6480464 epigallocatechin gallate results in decreased expression of SOD3 mRNA CTD PMID:20706672 Sod3 Rat (E)-cinnamyl alcohol increases expression ISO SOD3 (Homo sapiens) 6480464 cinnamyl alcohol results in increased expression of SOD3 mRNA CTD PMID:20566472 Sod3 Rat 1,1-dichloroethene decreases expression ISO Sod3 (Mus musculus) 6480464 vinylidene chloride results in decreased expression of SOD3 mRNA CTD PMID:26682919 Sod3 Rat 1,2-dimethylhydrazine decreases expression EXP 6480464 1 and 2-Dimethylhydrazine results in decreased expression of SOD3 mRNA CTD PMID:32387197 Sod3 Rat 1-chloro-2,4-dinitrobenzene increases expression ISO SOD3 (Homo sapiens) 6480464 Dinitrochlorobenzene results in increased expression of SOD3 mRNA CTD PMID:20566472 Sod3 Rat 17alpha-ethynylestradiol affects expression ISO Sod3 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of SOD3 mRNA CTD PMID:17555576 Sod3 Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of SOD3 mRNA CTD PMID:17557909 and PMID:29097150 Sod3 Rat 17alpha-ethynylestradiol multiple interactions ISO Sod3 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of SOD3 mRNA CTD PMID:17942748 Sod3 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of SOD3 mRNA and Estradiol results in decreased expression of SOD3 protein CTD PMID:23027624 and PMID:24894866 Sod3 Rat 17beta-estradiol decreases expression ISO Sod3 (Mus musculus) 6480464 Estradiol results in decreased expression of SOD3 mRNA CTD PMID:39298647 Sod3 Rat 17beta-estradiol multiple interactions ISO SOD3 (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of SOD3 mRNA more ... CTD PMID:25130429 and PMID:30165855 Sod3 Rat 17beta-estradiol decreases expression ISO SOD3 (Homo sapiens) 6480464 Estradiol results in decreased expression of SOD3 mRNA and Estradiol results in decreased expression of SOD3 protein CTD PMID:25130429 and PMID:28960787 Sod3 Rat 17beta-estradiol decreases activity EXP 6480464 Estradiol results in decreased activity of SOD3 protein CTD PMID:23027624 Sod3 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of SOD3 mRNA CTD PMID:12816884 more ... Sod3 Rat 17beta-estradiol increases stability EXP 6480464 Estradiol results in increased stability of SOD3 mRNA CTD PMID:12816884 Sod3 Rat 17beta-estradiol multiple interactions ISO Sod3 (Mus musculus) 6480464 Estradiol inhibits the reaction [Progesterone results in decreased expression of SOD3 mRNA] CTD PMID:16195479 Sod3 Rat 17beta-estradiol affects expression ISO Sod3 (Mus musculus) 6480464 Estradiol affects the expression of SOD3 mRNA CTD PMID:16195479 Sod3 Rat 17beta-estradiol multiple interactions EXP 6480464 Ascorbic Acid inhibits the reaction [Estradiol inhibits the reaction [NFE2L2 protein binds to SOD3 promoter]] more ... CTD PMID:12816884 more ... Sod3 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression EXP 6480464 2 more ... CTD PMID:21394737 Sod3 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO SOD3 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Sod3 Rat 2,2,2-tetramine multiple interactions EXP 6480464 Trientine inhibits the reaction [Streptozocin results in decreased expression of SOD3 mRNA] and Trientine inhibits the reaction [Streptozocin results in decreased expression of SOD3 protein] CTD PMID:16973718 Sod3 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Sod3 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of SOD3 mRNA and actein inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of SOD3 mRNA] CTD PMID:17942748 and PMID:28836330 Sod3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of SOD3 mRNA CTD PMID:32109520 more ... Sod3 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Sod3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of SOD3 mRNA CTD PMID:28836330 and PMID:33956508 Sod3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Sod3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of SOD3 mRNA CTD PMID:15034205 and PMID:15667827 Sod3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Sod3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of SOD3 mRNA CTD PMID:21570461 Sod3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO SOD3 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of SOD3 mRNA CTD PMID:21296121 Sod3 Rat 2,5-hexanedione increases expression EXP 6480464 2 and 5-hexanedione results in increased expression of SOD3 mRNA CTD PMID:22952946 and PMID:27466211 Sod3 Rat 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine decreases expression EXP 6480464 Puromycin Aminonucleoside results in decreased expression of SOD3 mRNA CTD PMID:20685819 Sod3 Rat 3,3',4,4',5-pentachlorobiphenyl affects expression ISO Sod3 (Mus musculus) 6480464 3 more ... CTD PMID:37080397 Sod3 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of SOD3 mRNA CTD PMID:28522335 Sod3 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO Sod3 (Mus musculus) 6480464 [Dexamethasone co-treated with rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in decreased expression of SOD3 mRNA CTD PMID:16054899 Sod3 Rat 4,4'-sulfonyldiphenol increases expression ISO Sod3 (Mus musculus) 6480464 bisphenol S results in increased expression of SOD3 mRNA CTD PMID:30951980 and PMID:39298647 Sod3 Rat 4,4'-sulfonyldiphenol decreases methylation ISO Sod3 (Mus musculus) 6480464 bisphenol S results in decreased methylation of SOD3 exon CTD PMID:33297965 Sod3 Rat 4-(ethoxymethylene)-2-phenyloxazol-5-one decreases expression EXP 6480464 Oxazolone results in decreased expression of SOD3 mRNA CTD PMID:21893156 Sod3 Rat 4-hydroxyphenyl retinamide decreases expression ISO Sod3 (Mus musculus) 6480464 Fenretinide results in decreased expression of SOD3 mRNA CTD PMID:28973697 Sod3 Rat 4-phenylbutyric acid multiple interactions EXP 6480464 4-phenylbutyric acid inhibits the reaction [cobaltous chloride results in decreased expression of SOD3 mRNA] CTD PMID:21804221 Sod3 Rat 4-phenylbutyric acid increases expression EXP 6480464 4-phenylbutyric acid results in increased expression of SOD3 mRNA CTD PMID:21804221 Sod3 Rat 5-methyl-4-oxido-2-pyrazin-4-iumcarboxylic acid increases expression ISO SOD3 (Homo sapiens) 6480464 acipimox results in increased expression of SOD3 mRNA CTD PMID:25352640 Sod3 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of SOD3 mRNA CTD PMID:24780913 and PMID:36843608 Sod3 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of SOD3 mRNA CTD PMID:30047161 Sod3 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of SOD3 mRNA CTD PMID:31881176 Sod3 Rat acrolein increases expression ISO Sod3 (Mus musculus) 6480464 Acrolein results in increased expression of SOD3 protein CTD PMID:28482051 Sod3 Rat Actein multiple interactions ISO Sod3 (Mus musculus) 6480464 actein inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of SOD3 mRNA] CTD PMID:28836330 Sod3 Rat aldehydo-D-glucose decreases expression EXP 6480464 Glucose results in decreased expression of SOD3 mRNA CTD PMID:21818840 Sod3 Rat all-trans-retinoic acid decreases expression ISO SOD3 (Homo sapiens) 6480464 Tretinoin results in decreased expression of SOD3 mRNA CTD PMID:15498508 Sod3 Rat alpha-hexylcinnamaldehyde increases expression ISO SOD3 (Homo sapiens) 6480464 hexyl cinnamic aldehyde results in increased expression of SOD3 mRNA CTD PMID:20566472 Sod3 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of SOD3 mRNA CTD PMID:30047161 Sod3 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of SOD3 mRNA CTD PMID:16483693 Sod3 Rat aristolochic acid A increases expression ISO SOD3 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of SOD3 mRNA CTD PMID:33212167 Sod3 Rat arsenite(3-) increases methylation ISO SOD3 (Homo sapiens) 6480464 arsenite results in increased methylation of SOD3 promoter CTD PMID:23974009 Sod3 Rat arsenous acid decreases expression ISO SOD3 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of SOD3 mRNA CTD PMID:29633893 Sod3 Rat asbestos increases secretion ISO Sod3 (Mus musculus) 6480464 Asbestos results in increased secretion of SOD3 protein CTD PMID:21362472 Sod3 Rat asbestos multiple interactions ISO Sod3 (Mus musculus) 6480464 SOD3 gene polymorphism promotes the reaction [Asbestos results in increased secretion of SOD3 protein] CTD PMID:21362472 Sod3 Rat asbestos affects response to substance ISO Sod3 (Mus musculus) 6480464 SOD3 gene polymorphism affects the susceptibility to Asbestos and SOD3 protein affects the susceptibility to Asbestos CTD PMID:16458190 and PMID:21362472 Sod3 Rat atorvastatin calcium increases expression EXP 6480464 Atorvastatin results in increased expression of SOD3 protein CTD PMID:19451411 Sod3 Rat atrazine multiple interactions ISO Sod3 (Mus musculus) 6480464 Lycopene inhibits the reaction [Atrazine results in increased expression of SOD3 mRNA] CTD PMID:36216167 Sod3 Rat atrazine increases expression ISO Sod3 (Mus musculus) 6480464 Atrazine results in increased expression of SOD3 mRNA CTD PMID:36216167 Sod3 Rat azoxystrobin multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of SOD3 mRNA CTD PMID:33854195 Sod3 Rat Bandrowski's base increases expression ISO SOD3 (Homo sapiens) 6480464 Bandrowski's base results in increased expression of SOD3 mRNA CTD PMID:20566472 Sod3 Rat benzo[a]pyrene decreases expression ISO Sod3 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of SOD3 mRNA CTD PMID:15034205 Sod3 Rat benzo[a]pyrene increases methylation ISO SOD3 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of SOD3 5' UTR CTD PMID:27901495 Sod3 Rat benzo[a]pyrene affects methylation ISO SOD3 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of SOD3 promoter CTD PMID:27901495 Sod3 Rat benzo[a]pyrene multiple interactions ISO Sod3 (Mus musculus) 6480464 [lipopolysaccharide more ... CTD PMID:14625279 and PMID:28987381 Sod3 Rat benzo[a]pyrene increases expression ISO Sod3 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of SOD3 mRNA CTD PMID:14625279 Sod3 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Sod3 (Mus musculus) 6480464 Lycopene inhibits the reaction [Diethylhexyl Phthalate results in increased expression of SOD3 mRNA] CTD PMID:35917956 and PMID:36610486 Sod3 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Sod3 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of SOD3 mRNA CTD PMID:34319233 Sod3 Rat bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 Genistein inhibits the reaction [Diethylhexyl Phthalate results in increased expression of SOD3 mRNA] CTD PMID:26316063 Sod3 Rat bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of SOD3 mRNA CTD PMID:26316063 Sod3 Rat bis(2-ethylhexyl) phthalate increases expression ISO Sod3 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of SOD3 mRNA CTD PMID:33360214 more ... Sod3 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of SOD3 mRNA CTD PMID:25181051 Sod3 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of SOD3 mRNA CTD PMID:38750585 Sod3 Rat bisphenol A affects expression ISO Sod3 (Mus musculus) 6480464 bisphenol A affects the expression of SOD3 mRNA CTD PMID:35341816 Sod3 Rat bisphenol A decreases expression ISO SOD3 (Homo sapiens) 6480464 bisphenol A results in decreased expression of SOD3 protein CTD PMID:31675489 Sod3 Rat bisphenol A decreases methylation ISO SOD3 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of SOD3 gene CTD PMID:31601247 Sod3 Rat bisphenol A decreases expression ISO Sod3 (Mus musculus) 6480464 bisphenol A results in decreased expression of SOD3 mRNA CTD PMID:30245210 more ... Sod3 Rat bisphenol A increases expression ISO Sod3 (Mus musculus) 6480464 bisphenol A results in increased expression of SOD3 mRNA CTD PMID:30951980 and PMID:37755785 Sod3 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of SOD3 gene CTD PMID:28505145 Sod3 Rat bisphenol F increases expression ISO Sod3 (Mus musculus) 6480464 bisphenol F results in increased expression of SOD3 mRNA CTD PMID:30951980 Sod3 Rat buspirone decreases expression EXP 6480464 Buspirone results in decreased expression of SOD3 mRNA CTD PMID:24136188 Sod3 Rat butylated hydroxyanisole increases activity EXP 6480464 Butylated Hydroxyanisole results in increased activity of SOD3 protein CTD PMID:23027624 Sod3 Rat butylated hydroxyanisole increases expression EXP 6480464 Butylated Hydroxyanisole results in increased expression of SOD3 mRNA and Butylated Hydroxyanisole results in increased expression of SOD3 protein CTD PMID:23027624 Sod3 Rat butylated hydroxyanisole multiple interactions EXP 6480464 Butylated Hydroxyanisole inhibits the reaction [Estradiol inhibits the reaction [NFE2L2 protein binds to SOD3 promoter]] more ... CTD PMID:23027624 Sod3 Rat cadmium atom multiple interactions ISO SOD3 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of SOD3 mRNA CTD PMID:35301059 Sod3 Rat cadmium dichloride increases expression ISO Sod3 (Mus musculus) 6480464 Cadmium Chloride results in increased expression of SOD3 mRNA CTD PMID:30375035 Sod3 Rat cadmium dichloride multiple interactions ISO SOD3 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of SOD3 mRNA CTD PMID:35301059 Sod3 Rat calcitriol decreases expression ISO SOD3 (Homo sapiens) 6480464 Calcitriol results in decreased expression of SOD3 mRNA CTD PMID:26485663 Sod3 Rat carbendazim increases expression EXP 6480464 carbendazim results in increased expression of SOD3 mRNA CTD PMID:27466211 Sod3 Rat CGP 52608 multiple interactions ISO SOD3 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to SOD3 gene] CTD PMID:28238834 Sod3 Rat chloroethene decreases expression ISO Sod3 (Mus musculus) 6480464 Vinyl Chloride results in decreased expression of SOD3 protein CTD PMID:34717031 Sod3 Rat chlorogenic acid decreases expression ISO SOD3 (Homo sapiens) 6480464 Chlorogenic Acid results in decreased expression of SOD3 mRNA CTD PMID:20706672 Sod3 Rat chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of SOD3 mRNA CTD PMID:17452286 Sod3 Rat chlorpyrifos multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of SOD3 mRNA CTD PMID:33854195 Sod3 Rat cholic acid multiple interactions ISO Sod3 (Mus musculus) 6480464 NR1H4 gene mutant form inhibits the reaction [Cholic Acid results in increased expression of SOD3 mRNA] CTD PMID:25496033 Sod3 Rat cholic acid increases expression ISO Sod3 (Mus musculus) 6480464 Cholic Acid results in increased expression of SOD3 mRNA CTD PMID:25496033 Sod3 Rat ciglitazone decreases expression EXP 6480464 ciglitazone results in decreased expression of SOD3 mRNA CTD PMID:22193206 Sod3 Rat cinnamyl alcohol increases expression ISO SOD3 (Homo sapiens) 6480464 cinnamyl alcohol results in increased expression of SOD3 mRNA CTD PMID:20566472 Sod3 Rat cisplatin affects response to substance ISO SOD3 (Homo sapiens) 6480464 SOD3 protein affects the susceptibility to Cisplatin CTD PMID:16217747 Sod3 Rat cisplatin increases expression ISO SOD3 (Homo sapiens) 6480464 Cisplatin results in increased expression of SOD3 mRNA CTD PMID:25450742 Sod3 Rat cisplatin decreases expression ISO Sod3 (Mus musculus) 6480464 Cisplatin results in decreased expression of SOD3 mRNA CTD PMID:24865317 Sod3 Rat cisplatin multiple interactions ISO Sod3 (Mus musculus) 6480464 [Cisplatin co-treated with Lutein] results in decreased expression of SOD3 mRNA CTD PMID:24865317 Sod3 Rat cisplatin decreases expression EXP 6480464 Cisplatin results in decreased expression of SOD3 mRNA CTD PMID:23603837 Sod3 Rat cisplatin increases expression ISO Sod3 (Mus musculus) 6480464 Cisplatin results in increased expression of SOD3 mRNA CTD PMID:21151649 Sod3 Rat clofibrate decreases expression ISO Sod3 (Mus musculus) 6480464 Clofibrate results in decreased expression of SOD3 mRNA CTD PMID:17585979 Sod3 Rat clofibrate increases expression EXP 6480464 Clofibrate results in increased expression of SOD3 mRNA CTD PMID:11328961 Sod3 Rat clozapine increases expression EXP 6480464 Clozapine results in increased expression of SOD3 mRNA CTD PMID:15860345 Sod3 Rat cobalt dichloride multiple interactions EXP 6480464 4-phenylbutyric acid inhibits the reaction [cobaltous chloride results in decreased expression of SOD3 mRNA] and Acetylcysteine inhibits the reaction [cobaltous chloride results in decreased expression of SOD3 mRNA] CTD PMID:21804221 Sod3 Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of SOD3 mRNA CTD PMID:21804221 and PMID:24386269 Sod3 Rat cobalt dichloride decreases expression ISO Sod3 (Mus musculus) 6480464 cobaltous chloride results in decreased expression of SOD3 mRNA CTD PMID:20594416 Sod3 Rat copper atom multiple interactions ISO Sod3 (Mus musculus) 6480464 [Copper co-treated with ATOX1 protein] results in increased activity of SOD3 protein more ... CTD PMID:18165226 more ... Sod3 Rat copper atom increases expression ISO Sod3 (Mus musculus) 6480464 Copper results in increased expression of SOD3 mRNA CTD PMID:16629173 and PMID:18977292 Sod3 Rat copper(0) multiple interactions ISO Sod3 (Mus musculus) 6480464 [Copper co-treated with ATOX1 protein] results in increased activity of SOD3 protein more ... CTD PMID:18165226 more ... Sod3 Rat copper(0) increases expression ISO Sod3 (Mus musculus) 6480464 Copper results in increased expression of SOD3 mRNA CTD PMID:16629173 and PMID:18977292 Sod3 Rat crocidolite asbestos multiple interactions ISO Sod3 (Mus musculus) 6480464 Asbestos and Crocidolite affects the expression of and affects the activity of SOD3 protein CTD PMID:15298984 Sod3 Rat crocidolite asbestos affects response to substance ISO Sod3 (Mus musculus) 6480464 SOD3 protein affects the susceptibility to Asbestos and Crocidolite CTD PMID:18165226 Sod3 Rat cumene multiple interactions ISO Sod3 (Mus musculus) 6480464 [cumene co-treated with KRAS gene mutant form] results in decreased expression of SOD3 mRNA CTD PMID:18648096 Sod3 Rat D-glucose decreases expression EXP 6480464 Glucose results in decreased expression of SOD3 mRNA CTD PMID:21818840 Sod3 Rat DDT increases expression EXP 6480464 DDT results in increased expression of SOD3 mRNA CTD PMID:30207508 Sod3 Rat decabromodiphenyl ether increases expression ISO SOD3 (Homo sapiens) 6480464 decabromobiphenyl ether results in increased expression of SOD3 protein CTD PMID:31675489 Sod3 Rat dexamethasone multiple interactions ISO Sod3 (Mus musculus) 6480464 [Dexamethasone co-treated with rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in decreased expression of SOD3 mRNA CTD PMID:16054899 Sod3 Rat diarsenic trioxide decreases expression ISO SOD3 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of SOD3 mRNA CTD PMID:29633893 Sod3 Rat diazinon decreases expression EXP 6480464 Diazinon results in decreased expression of SOD3 mRNA CTD PMID:17452286 Sod3 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of SOD3 mRNA CTD PMID:21266533 Sod3 Rat dimethyl sulfoxide increases expression EXP 6480464 Dimethyl Sulfoxide results in increased expression of SOD3 mRNA CTD PMID:22193206 Sod3 Rat dioxygen decreases expression ISO Sod3 (Mus musculus) 6480464 Oxygen deficiency results in decreased expression of SOD3 mRNA CTD PMID:20594416 Sod3 Rat dioxygen multiple interactions ISO SOD3 (Homo sapiens) 6480464 [Oxygen deficiency co-treated with Catechin] results in decreased expression of SOD3 mRNA CTD PMID:35883890 Sod3 Rat disulfiram increases expression ISO SOD3 (Homo sapiens) 6480464 Disulfiram results in increased expression of SOD3 mRNA CTD PMID:20566472 Sod3 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of SOD3 mRNA CTD PMID:25152437 Sod3 Rat diuron increases expression EXP 6480464 Diuron results in increased expression of SOD3 mRNA CTD PMID:21551480 Sod3 Rat donepezil hydrochloride multiple interactions EXP 6480464 Donepezil inhibits the reaction [[Dietary Fats co-treated with Cholesterol and Dietary] results in decreased expression of SOD3 mRNA] CTD PMID:28734741 Sod3 Rat doxorubicin decreases expression ISO Sod3 (Mus musculus) 6480464 Doxorubicin results in decreased expression of SOD3 mRNA and Doxorubicin results in decreased expression of SOD3 protein CTD PMID:26822305 Sod3 Rat doxorubicin multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [Doxorubicin results in decreased expression of SOD3 protein] and Phosphocreatine inhibits the reaction [Doxorubicin results in decreased expression of SOD3 protein] CTD PMID:34358621 Sod3 Rat doxorubicin decreases expression EXP 6480464 Doxorubicin results in decreased expression of SOD3 protein CTD PMID:34358621 Sod3 Rat doxorubicin affects expression ISO SOD3 (Homo sapiens) 6480464 Doxorubicin affects the expression of SOD3 mRNA CTD PMID:29803840 Sod3 Rat doxorubicin multiple interactions ISO Sod3 (Mus musculus) 6480464 Doxorubicin promotes the reaction [ABCC1 gene mutant form results in decreased expression of SOD3 mRNA] and Doxorubicin promotes the reaction [ABCC1 gene mutant form results in decreased expression of SOD3 protein] CTD PMID:26822305 Sod3 Rat ellagic acid decreases expression ISO SOD3 (Homo sapiens) 6480464 Ellagic Acid results in decreased expression of SOD3 mRNA CTD PMID:12002526 Sod3 Rat epoxiconazole decreases expression ISO Sod3 (Mus musculus) 6480464 epoxiconazole results in decreased expression of SOD3 mRNA CTD PMID:35436446 Sod3 Rat ethanol increases expression ISO Sod3 (Mus musculus) 6480464 Ethanol results in increased expression of SOD3 mRNA CTD PMID:30319688 Sod3 Rat eugenol increases expression ISO SOD3 (Homo sapiens) 6480464 Eugenol results in increased expression of SOD3 mRNA CTD PMID:20566472 Sod3 Rat fenthion increases expression ISO Sod3 (Mus musculus) 6480464 Fenthion results in increased expression of SOD3 mRNA CTD PMID:34813904 Sod3 Rat finasteride affects expression EXP 6480464 Finasteride affects the expression of SOD3 mRNA and Finasteride affects the expression of SOD3 protein CTD PMID:18811921 Sod3 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of SOD3 mRNA CTD PMID:24136188 Sod3 Rat formaldehyde increases expression ISO SOD3 (Homo sapiens) 6480464 Formaldehyde results in increased expression of SOD3 mRNA CTD PMID:28937961 Sod3 Rat fulvestrant multiple interactions EXP 6480464 fulvestrant inhibits the reaction [Estradiol results in increased expression of SOD3 mRNA] CTD PMID:12816884 Sod3 Rat genistein decreases expression ISO SOD3 (Homo sapiens) 6480464 Genistein results in decreased expression of SOD3 mRNA CTD PMID:20706672 Sod3 Rat genistein multiple interactions EXP 6480464 Genistein inhibits the reaction [Diethylhexyl Phthalate results in increased expression of SOD3 mRNA] CTD PMID:26316063 Sod3 Rat glucose decreases expression EXP 6480464 Glucose results in decreased expression of SOD3 mRNA CTD PMID:21818840 Sod3 Rat glycyrrhetinate multiple interactions ISO Sod3 (Mus musculus) 6480464 Glycyrrhetinic Acid inhibits the reaction [Carbon Tetrachloride results in decreased expression of SOD3 mRNA] CTD PMID:23341968 Sod3 Rat glycyrrhetinic acid multiple interactions ISO Sod3 (Mus musculus) 6480464 Glycyrrhetinic Acid inhibits the reaction [Carbon Tetrachloride results in decreased expression of SOD3 mRNA] CTD PMID:23341968 Sod3 Rat glyphosate multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of SOD3 mRNA CTD PMID:33854195 Sod3 Rat GW 4064 multiple interactions ISO SOD3 (Homo sapiens) 6480464 GW 4064 promotes the reaction [NR1H4 protein binds to SOD3 promoter] more ... CTD PMID:25496033 Sod3 Rat GW 4064 multiple interactions ISO Sod3 (Mus musculus) 6480464 NR1H4 gene mutant form inhibits the reaction [GW 4064 results in increased expression of SOD3 mRNA] CTD PMID:25496033 Sod3 Rat GW 4064 increases expression ISO Sod3 (Mus musculus) 6480464 GW 4064 results in increased expression of SOD3 mRNA CTD PMID:25496033 Sod3 Rat GW 4064 increases expression ISO SOD3 (Homo sapiens) 6480464 GW 4064 results in increased expression of SOD3 mRNA CTD PMID:25496033 Sod3 Rat GW 501516 multiple interactions ISO SOD3 (Homo sapiens) 6480464 GW 501516 inhibits the reaction [APP gene mutant form results in decreased expression of SOD3 protein] CTD PMID:22886847 Sod3 Rat haloperidol increases expression EXP 6480464 Haloperidol results in increased expression of SOD3 mRNA CTD PMID:15860345 Sod3 Rat hexachlorobenzene affects expression EXP 6480464 Hexachlorobenzene affects the expression of SOD3 mRNA CTD PMID:15159207 Sod3 Rat hyaluronic acid affects binding ISO Sod3 (Mus musculus) 6480464 SOD3 protein binds to Hyaluronic Acid CTD PMID:18165226 Sod3 Rat hyaluronic acid multiple interactions ISO Sod3 (Mus musculus) 6480464 SOD3 protein inhibits the reaction [[Copper co-treated with Hydrogen Peroxide] results in increased degradation of Hyaluronic Acid] CTD PMID:18165226 Sod3 Rat hydrogen cyanide decreases expression ISO Sod3 (Mus musculus) 6480464 Hydrogen Cyanide results in decreased expression of SOD3 mRNA CTD PMID:33914522 Sod3 Rat hydrogen peroxide multiple interactions ISO Sod3 (Mus musculus) 6480464 SOD3 protein inhibits the reaction [[Copper co-treated with Hydrogen Peroxide] results in increased degradation of Hyaluronic Acid] CTD PMID:18165226 Sod3 Rat hydrogen peroxide multiple interactions ISO SOD3 (Homo sapiens) 6480464 SOD3 promotes the reaction [GW 4064 inhibits the reaction [Hydrogen Peroxide results in increased phosphorylation of MAPK8 protein]] and SOD3 promotes the reaction [GW 4064 inhibits the reaction [Hydrogen Peroxide results in increased phosphorylation of MAPK9 protein]] CTD PMID:25496033 Sod3 Rat imidacloprid multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of SOD3 mRNA CTD PMID:33854195 Sod3 Rat inulin multiple interactions ISO Sod3 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of SOD3 mRNA CTD PMID:36331819 Sod3 Rat isoeugenol increases expression ISO SOD3 (Homo sapiens) 6480464 isoeugenol results in increased expression of SOD3 mRNA CTD PMID:20566472 Sod3 Rat ketamine increases expression EXP 6480464 Ketamine results in increased expression of SOD3 mRNA CTD PMID:20080153 Sod3 Rat L-ascorbic acid increases activity EXP 6480464 Ascorbic Acid results in increased activity of SOD3 protein CTD PMID:23027624 Sod3 Rat L-ascorbic acid multiple interactions ISO SOD3 (Homo sapiens) 6480464 Ascorbic Acid inhibits the reaction [Estradiol results in decreased expression of SOD3 mRNA] and Ascorbic Acid inhibits the reaction [Estradiol results in decreased expression of SOD3 protein] CTD PMID:25130429 Sod3 Rat L-ascorbic acid affects localization EXP 6480464 Ascorbic Acid affects the localization of SOD3 protein CTD PMID:23027624 Sod3 Rat L-ascorbic acid increases expression EXP 6480464 Ascorbic Acid results in increased expression of SOD3 protein CTD PMID:23027624 Sod3 Rat L-ascorbic acid multiple interactions EXP 6480464 Ascorbic Acid inhibits the reaction [Estradiol inhibits the reaction [NFE2L2 protein binds to SOD3 promoter]] more ... CTD PMID:23027624 Sod3 Rat lead diacetate affects expression EXP 6480464 lead acetate affects the expression of SOD3 mRNA CTD PMID:21864555 Sod3 Rat lead diacetate increases expression ISO Sod3 (Mus musculus) 6480464 lead acetate results in increased expression of SOD3 mRNA CTD PMID:29746905 Sod3 Rat lead(0) increases expression EXP 6480464 Lead results in increased expression of SOD3 protein CTD PMID:25596430 Sod3 Rat losartan multiple interactions ISO Sod3 (Mus musculus) 6480464 Losartan inhibits the reaction [AGT protein results in increased expression of SOD3 protein] CTD PMID:10400907 Sod3 Rat lutein multiple interactions ISO Sod3 (Mus musculus) 6480464 [Cisplatin co-treated with Lutein] results in decreased expression of SOD3 mRNA CTD PMID:24865317 Sod3 Rat lutein decreases expression ISO Sod3 (Mus musculus) 6480464 Lutein results in decreased expression of SOD3 mRNA CTD PMID:24865317 Sod3 Rat lycopene multiple interactions ISO Sod3 (Mus musculus) 6480464 Lycopene inhibits the reaction [Atrazine results in increased expression of SOD3 mRNA] and Lycopene inhibits the reaction [Diethylhexyl Phthalate results in increased expression of SOD3 mRNA] CTD PMID:35917956 more ... Sod3 Rat mercury dichloride increases expression EXP 6480464 Mercuric Chloride results in increased expression of SOD3 protein CTD PMID:18599595 and PMID:23415682 Sod3 Rat methotrexate increases expression ISO SOD3 (Homo sapiens) 6480464 Methotrexate results in increased expression of SOD3 mRNA CTD PMID:21678067 Sod3 Rat methyl tert-butyl ether increases activity EXP 6480464 methyl tert-butyl ether results in increased activity of SOD3 protein CTD PMID:19150650 Sod3 Rat methylmercury chloride decreases expression EXP 6480464 methylmercuric chloride results in decreased expression of SOD3 protein CTD PMID:29258870 Sod3 Rat mifepristone multiple interactions EXP 6480464 Mifepristone inhibits the reaction [Progesterone results in decreased expression of SOD3 mRNA] CTD PMID:16195479 Sod3 Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Pyridostigmine Bromide co-treated with DEET co-treated with Permethrin] results in increased expression of SOD3 mRNA CTD PMID:28659758 Sod3 Rat N-acetyl-L-cysteine multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [cobaltous chloride results in decreased expression of SOD3 mRNA] and Acetylcysteine inhibits the reaction [Doxorubicin results in decreased expression of SOD3 protein] CTD PMID:21804221 and PMID:34358621 Sod3 Rat N-phosphocreatine multiple interactions EXP 6480464 Phosphocreatine inhibits the reaction [Doxorubicin results in decreased expression of SOD3 protein] CTD PMID:34358621 Sod3 Rat nickel sulfate increases expression ISO SOD3 (Homo sapiens) 6480464 nickel sulfate results in increased expression of SOD3 mRNA CTD PMID:20566472 Sod3 Rat nimesulide decreases expression EXP 6480464 nimesulide results in decreased expression of SOD3 mRNA CTD PMID:24136188 Sod3 Rat nitrogen dioxide multiple interactions ISO SOD3 (Homo sapiens) 6480464 [[Vehicle Emissions results in increased abundance of Soot] co-treated with [Air Pollutants results in increased abundance of [Sulfur Dioxide co-treated with Nitrogen Dioxide]]] results in increased expression of SOD3 mRNA CTD PMID:35736886 Sod3 Rat ochratoxin A increases expression ISO SOD3 (Homo sapiens) 6480464 ochratoxin A results in increased expression of SOD3 mRNA CTD PMID:17316727 Sod3 Rat Osajin decreases expression ISO SOD3 (Homo sapiens) 6480464 osajin results in decreased expression of SOD3 mRNA CTD PMID:20706672 Sod3 Rat ozone multiple interactions ISO Sod3 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of SOD3 mRNA and SOD3 protein inhibits the reaction [Ozone results in increased expression of IL6 protein] CTD PMID:11999998 and PMID:34911549 Sod3 Rat paracetamol multiple interactions ISO Sod3 (Mus musculus) 6480464 Rotenone inhibits the reaction [Acetaminophen results in decreased expression of SOD3 mRNA] and SOD3 inhibits the reaction [Acetaminophen results in increased activity of CASP3 protein] CTD PMID:11529661 and PMID:30099449 Sod3 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of SOD3 mRNA CTD PMID:33387578 Sod3 Rat paracetamol decreases expression ISO Sod3 (Mus musculus) 6480464 Acetaminophen results in decreased expression of SOD3 mRNA CTD PMID:30099449 Sod3 Rat paraquat decreases expression ISO Sod3 (Mus musculus) 6480464 Paraquat results in decreased expression of SOD3 mRNA CTD PMID:17215068 and PMID:26108578 Sod3 Rat paraquat multiple interactions ISO SOD3 (Homo sapiens) 6480464 [Quercetin co-treated with Paraquat] results in increased expression of SOD3 mRNA CTD PMID:22996356 Sod3 Rat paraquat increases expression ISO SOD3 (Homo sapiens) 6480464 Paraquat results in increased expression of SOD3 mRNA CTD PMID:22996356 Sod3 Rat paraquat multiple interactions ISO Sod3 (Mus musculus) 6480464 APOD protein affects the reaction [Paraquat results in increased expression of SOD3 mRNA] CTD PMID:21688324 Sod3 Rat paraquat increases expression ISO Sod3 (Mus musculus) 6480464 Paraquat results in increased expression of SOD3 mRNA CTD PMID:12732627 and PMID:21688324 Sod3 Rat paricalcitol multiple interactions ISO SOD3 (Homo sapiens) 6480464 [Phosphorus co-treated with paricalcitol] results in increased expression of SOD3 mRNA CTD PMID:17715259 Sod3 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Sod3 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of SOD3 mRNA CTD PMID:36331819 Sod3 Rat permethrin multiple interactions EXP 6480464 [Pyridostigmine Bromide co-treated with DEET co-treated with Permethrin] results in increased expression of SOD3 mRNA CTD PMID:28659758 Sod3 Rat peroxynitrous acid multiple interactions ISO Sod3 (Mus musculus) 6480464 [Streptozocin results in decreased activity of SOD3 protein] which results in increased chemical synthesis of Peroxynitrous Acid CTD PMID:23884884 Sod3 Rat phenobarbital multiple interactions ISO Sod3 (Mus musculus) 6480464 NR1I3 protein affects the reaction [Phenobarbital results in decreased expression of SOD3 mRNA] CTD PMID:19482888 Sod3 Rat phenobarbital affects expression ISO Sod3 (Mus musculus) 6480464 Phenobarbital affects the expression of SOD3 mRNA CTD PMID:23091169 Sod3 Rat phenobarbital decreases expression EXP 6480464 Phenobarbital results in decreased expression of SOD3 mRNA CTD PMID:19162173 Sod3 Rat phenobarbital decreases expression ISO Sod3 (Mus musculus) 6480464 Phenobarbital results in decreased expression of SOD3 mRNA CTD PMID:19482888 Sod3 Rat phosgene affects expression ISO Sod3 (Mus musculus) 6480464 Phosgene affects the expression of SOD3 mRNA CTD PMID:16300373 Sod3 Rat phosphorus atom multiple interactions ISO SOD3 (Homo sapiens) 6480464 [Phosphorus co-treated with paricalcitol] results in increased expression of SOD3 mRNA CTD PMID:17715259 Sod3 Rat phosphorus(.) multiple interactions ISO SOD3 (Homo sapiens) 6480464 [Phosphorus co-treated with paricalcitol] results in increased expression of SOD3 mRNA CTD PMID:17715259 Sod3 Rat Pomiferin decreases expression ISO SOD3 (Homo sapiens) 6480464 pomiferin results in decreased expression of SOD3 mRNA CTD PMID:20706672 Sod3 Rat potassium chromate multiple interactions ISO Sod3 (Mus musculus) 6480464 [Potassium Dichromate co-treated with potassium chromate(VI)] inhibits the reaction [Benzo(a)pyrene results in increased expression of SOD3 mRNA] CTD PMID:14625279 Sod3 Rat potassium cyanide increases expression ISO Sod3 (Mus musculus) 6480464 Potassium Cyanide results in increased expression of SOD3 mRNA CTD PMID:33914522 Sod3 Rat potassium dichromate multiple interactions ISO Sod3 (Mus musculus) 6480464 [Potassium Dichromate co-treated with potassium chromate(VI)] inhibits the reaction [Benzo(a)pyrene results in increased expression of SOD3 mRNA] CTD PMID:14625279 Sod3 Rat pregnenolone 16alpha-carbonitrile decreases expression EXP 6480464 Pregnenolone Carbonitrile results in decreased expression of SOD3 mRNA CTD PMID:19162173 Sod3 Rat probucol multiple interactions EXP 6480464 Probucol inhibits the reaction [[Dietary Fats co-treated with Cholesterol and Dietary] results in decreased expression of SOD3 mRNA] CTD PMID:28734741 Sod3 Rat progesterone decreases expression ISO Sod3 (Mus musculus) 6480464 Progesterone results in decreased expression of SOD3 mRNA CTD PMID:16195479 Sod3 Rat progesterone decreases activity EXP 6480464 Progesterone results in decreased activity of SOD3 protein CTD PMID:16195479 Sod3 Rat progesterone decreases expression EXP 6480464 Progesterone results in decreased expression of SOD3 mRNA CTD PMID:16195479 Sod3 Rat progesterone multiple interactions EXP 6480464 Mifepristone inhibits the reaction [Progesterone results in decreased expression of SOD3 mRNA] and Progesterone inhibits the reaction [Estradiol results in increased expression of SOD3 mRNA] CTD PMID:16195479 Sod3 Rat progesterone multiple interactions ISO Sod3 (Mus musculus) 6480464 Estradiol inhibits the reaction [Progesterone results in decreased expression of SOD3 mRNA] CTD PMID:16195479 Sod3 Rat puerarin decreases expression ISO SOD3 (Homo sapiens) 6480464 puerarin results in decreased expression of SOD3 mRNA CTD PMID:20706672 Sod3 Rat Pyridostigmine bromide multiple interactions EXP 6480464 [Pyridostigmine Bromide co-treated with DEET co-treated with Permethrin] results in increased expression of SOD3 mRNA CTD PMID:28659758 Sod3 Rat quercetin increases expression ISO SOD3 (Homo sapiens) 6480464 Quercetin results in increased expression of SOD3 mRNA CTD PMID:22996356 Sod3 Rat quercetin multiple interactions ISO SOD3 (Homo sapiens) 6480464 [Quercetin co-treated with Paraquat] results in increased expression of SOD3 mRNA CTD PMID:22996356 Sod3 Rat raloxifene increases expression EXP 6480464 Raloxifene Hydrochloride results in increased expression of SOD3 mRNA CTD PMID:15576828 Sod3 Rat resveratrol increases expression EXP 6480464 resveratrol results in increased expression of SOD3 mRNA and resveratrol results in increased expression of SOD3 protein CTD PMID:24894866 Sod3 Rat resveratrol multiple interactions ISO SOD3 (Homo sapiens) 6480464 resveratrol inhibits the reaction [Estradiol results in decreased expression of SOD3 mRNA] and resveratrol inhibits the reaction [Estradiol results in decreased expression of SOD3 protein] CTD PMID:25130429 Sod3 Rat resveratrol increases expression ISO Sod3 (Mus musculus) 6480464 resveratrol results in increased expression of SOD3 mRNA CTD PMID:20610621 Sod3 Rat resveratrol increases expression ISO SOD3 (Homo sapiens) 6480464 Resveratrol results in increased expression of SOD3 more ... CTD PMID:20610621 and PMID:28960787 Sod3 Rat resveratrol decreases expression ISO SOD3 (Homo sapiens) 6480464 resveratrol results in decreased expression of SOD3 mRNA CTD PMID:20706672 Sod3 Rat resveratrol multiple interactions EXP 6480464 resveratrol inhibits the reaction [Estradiol results in decreased expression of SOD3 mRNA] and resveratrol inhibits the reaction [Estradiol results in decreased expression of SOD3 protein] CTD PMID:24894866 Sod3 Rat Rosavin decreases expression ISO SOD3 (Homo sapiens) 6480464 rosavin results in decreased expression of SOD3 mRNA CTD PMID:20706672 Sod3 Rat rotenone multiple interactions ISO Sod3 (Mus musculus) 6480464 Rotenone inhibits the reaction [Acetaminophen results in decreased expression of SOD3 mRNA] CTD PMID:30099449 Sod3 Rat serpentine asbestos decreases expression ISO Sod3 (Mus musculus) 6480464 Asbestos and Serpentine results in decreased expression of SOD3 mRNA CTD PMID:16251409 Sod3 Rat silicon dioxide decreases expression ISO Sod3 (Mus musculus) 6480464 Silicon Dioxide results in decreased expression of SOD3 mRNA and Silicon Dioxide results in decreased expression of SOD3 protein CTD PMID:30453980 Sod3 Rat silicon dioxide increases expression ISO Sod3 (Mus musculus) 6480464 Silicon Dioxide results in increased expression of SOD3 mRNA CTD PMID:38403151 Sod3 Rat silicon dioxide increases response to substance ISO Sod3 (Mus musculus) 6480464 SOD3 gene mutant form results in increased susceptibility to Silicon Dioxide CTD PMID:30453980 Sod3 Rat silicon dioxide multiple interactions ISO Sod3 (Mus musculus) 6480464 [SOD3 gene mutant form results in increased susceptibility to Silicon Dioxide] which results in increased expression of CCL2 mRNA more ... CTD PMID:30453980 Sod3 Rat silver atom decreases expression ISO Sod3 (Mus musculus) 6480464 Silver results in decreased expression of SOD3 mRNA CTD PMID:19429238 Sod3 Rat silver(0) decreases expression ISO Sod3 (Mus musculus) 6480464 Silver results in decreased expression of SOD3 mRNA CTD PMID:19429238 Sod3 Rat simvastatin multiple interactions EXP 6480464 Simvastatin inhibits the reaction [[Dietary Fats co-treated with Cholesterol and Dietary] results in decreased expression of SOD3 mRNA] CTD PMID:28734741 Sod3 Rat sodium arsenite decreases expression ISO Sod3 (Mus musculus) 6480464 sodium arsenite results in decreased expression of SOD3 mRNA CTD PMID:21396911 Sod3 Rat sodium arsenite increases expression ISO Sod3 (Mus musculus) 6480464 sodium arsenite results in increased expression of SOD3 mRNA CTD PMID:37682722 Sod3 Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of SOD3 mRNA CTD PMID:12325037 Sod3 Rat streptozocin multiple interactions EXP 6480464 cobaltiprotoporphyrin inhibits the reaction [Streptozocin results in decreased expression of SOD3 protein] more ... CTD PMID:15821039 and PMID:16973718 Sod3 Rat streptozocin multiple interactions ISO Sod3 (Mus musculus) 6480464 [Streptozocin results in decreased activity of SOD3 protein] which results in increased chemical synthesis of Peroxynitrous Acid more ... CTD PMID:23884884 Sod3 Rat streptozocin decreases expression EXP 6480464 Streptozocin results in decreased expression of SOD3 mRNA and Streptozocin results in decreased expression of SOD3 protein CTD PMID:15821039 and PMID:16973718 Sod3 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of SOD3 mRNA CTD PMID:30047161 Sod3 Rat sulfasalazine decreases expression ISO Sod3 (Mus musculus) 6480464 Sulfasalazine results in decreased expression of SOD3 mRNA CTD PMID:31830553 Sod3 Rat sulfur dioxide multiple interactions ISO SOD3 (Homo sapiens) 6480464 [[Vehicle Emissions results in increased abundance of Soot] co-treated with [Air Pollutants results in increased abundance of [Sulfur Dioxide co-treated with Nitrogen Dioxide]]] results in increased expression of SOD3 mRNA CTD PMID:35736886 Sod3 Rat sunitinib decreases expression ISO SOD3 (Homo sapiens) 6480464 Sunitinib results in decreased expression of SOD3 mRNA CTD PMID:31533062 Sod3 Rat superoxide multiple interactions ISO Sod3 (Mus musculus) 6480464 [ATP7A protein results in increased activity of SOD3 protein] which results in decreased chemical synthesis of Superoxides more ... CTD PMID:16864745 and PMID:23884884 Sod3 Rat tamibarotene decreases expression ISO SOD3 (Homo sapiens) 6480464 tamibarotene results in decreased expression of SOD3 mRNA CTD PMID:15498508 Sod3 Rat tetrachloromethane affects expression ISO Sod3 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of SOD3 mRNA CTD PMID:17484886 Sod3 Rat tetrachloromethane decreases expression ISO Sod3 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of SOD3 mRNA CTD PMID:23341968 Sod3 Rat tetrachloromethane multiple interactions ISO Sod3 (Mus musculus) 6480464 Glycyrrhetinic Acid inhibits the reaction [Carbon Tetrachloride results in decreased expression of SOD3 mRNA] CTD PMID:23341968 Sod3 Rat thiabendazole multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of SOD3 mRNA CTD PMID:33854195 Sod3 Rat thymoquinone multiple interactions EXP 6480464 thymoquinone inhibits the reaction [[Dietary Fats co-treated with Cholesterol and Dietary] results in decreased expression of SOD3 mRNA] CTD PMID:28734741 Sod3 Rat titanium dioxide increases methylation ISO Sod3 (Mus musculus) 6480464 titanium dioxide results in increased methylation of SOD3 gene CTD PMID:35295148 Sod3 Rat trans-isoeugenol increases expression ISO SOD3 (Homo sapiens) 6480464 isoeugenol results in increased expression of SOD3 mRNA CTD PMID:20566472 Sod3 Rat triclosan decreases expression ISO SOD3 (Homo sapiens) 6480464 Triclosan results in decreased expression of SOD3 mRNA CTD PMID:30510588 Sod3 Rat trimellitic anhydride decreases expression EXP 6480464 trimellitic anhydride results in decreased expression of SOD3 mRNA CTD PMID:21893156 Sod3 Rat troglitazone decreases expression ISO Sod3 (Mus musculus) 6480464 troglitazone results in decreased expression of SOD3 mRNA CTD PMID:28973697 Sod3 Rat valproic acid increases methylation ISO SOD3 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of SOD3 gene CTD PMID:29154799 Sod3 Rat vancomycin increases expression ISO Sod3 (Mus musculus) 6480464 Vancomycin results in increased expression of SOD3 mRNA CTD PMID:18930951 Sod3 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of SOD3 mRNA CTD PMID:23034163 Sod3 Rat zoledronic acid increases expression ISO SOD3 (Homo sapiens) 6480464 zoledronic acid results in increased expression of SOD3 mRNA CTD PMID:24714768
(+)-catechin (ISO) (-)-epigallocatechin 3-gallate (ISO) (E)-cinnamyl alcohol (ISO) 1,1-dichloroethene (ISO) 1,2-dimethylhydrazine (EXP) 1-chloro-2,4-dinitrobenzene (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP,ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP,ISO) 2,2,2-tetramine (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,5-hexanedione (EXP) 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine (EXP) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3-chloropropane-1,2-diol (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-(ethoxymethylene)-2-phenyloxazol-5-one (EXP) 4-hydroxyphenyl retinamide (ISO) 4-phenylbutyric acid (EXP) 5-methyl-4-oxido-2-pyrazin-4-iumcarboxylic acid (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) acrolein (ISO) Actein (ISO) aldehydo-D-glucose (EXP) all-trans-retinoic acid (ISO) alpha-hexylcinnamaldehyde (ISO) amitrole (EXP) ammonium chloride (EXP) aristolochic acid A (ISO) arsenite(3-) (ISO) arsenous acid (ISO) asbestos (ISO) atorvastatin calcium (EXP) atrazine (ISO) azoxystrobin (EXP) Bandrowski's base (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) buspirone (EXP) butylated hydroxyanisole (EXP) cadmium atom (ISO) cadmium dichloride (ISO) calcitriol (ISO) carbendazim (EXP) CGP 52608 (ISO) chloroethene (ISO) chlorogenic acid (ISO) chlorpyrifos (EXP) cholic acid (ISO) ciglitazone (EXP) cinnamyl alcohol (ISO) cisplatin (EXP,ISO) clofibrate (EXP,ISO) clozapine (EXP) cobalt dichloride (EXP,ISO) copper atom (ISO) copper(0) (ISO) crocidolite asbestos (ISO) cumene (ISO) D-glucose (EXP) DDT (EXP) decabromodiphenyl ether (ISO) dexamethasone (ISO) diarsenic trioxide (ISO) diazinon (EXP) dibutyl phthalate (EXP) dimethyl sulfoxide (EXP) dioxygen (ISO) disulfiram (ISO) diuron (EXP) donepezil hydrochloride (EXP) doxorubicin (EXP,ISO) ellagic acid (ISO) epoxiconazole (ISO) ethanol (ISO) eugenol (ISO) fenthion (ISO) finasteride (EXP) flutamide (EXP) formaldehyde (ISO) fulvestrant (EXP) genistein (EXP,ISO) glucose (EXP) glycyrrhetinate (ISO) glycyrrhetinic acid (ISO) glyphosate (EXP) GW 4064 (ISO) GW 501516 (ISO) haloperidol (EXP) hexachlorobenzene (EXP) hyaluronic acid (ISO) hydrogen cyanide (ISO) hydrogen peroxide (ISO) imidacloprid (EXP) inulin (ISO) isoeugenol (ISO) ketamine (EXP) L-ascorbic acid (EXP,ISO) lead diacetate (EXP,ISO) lead(0) (EXP) losartan (ISO) lutein (ISO) lycopene (ISO) mercury dichloride (EXP) methotrexate (ISO) methyl tert-butyl ether (EXP) methylmercury chloride (EXP) mifepristone (EXP) N,N-diethyl-m-toluamide (EXP) N-acetyl-L-cysteine (EXP) N-phosphocreatine (EXP) nickel sulfate (ISO) nimesulide (EXP) nitrogen dioxide (ISO) ochratoxin A (ISO) Osajin (ISO) ozone (ISO) paracetamol (EXP,ISO) paraquat (ISO) paricalcitol (ISO) perfluorooctane-1-sulfonic acid (ISO) permethrin (EXP) peroxynitrous acid (ISO) phenobarbital (EXP,ISO) phosgene (ISO) phosphorus atom (ISO) phosphorus(.) (ISO) Pomiferin (ISO) potassium chromate (ISO) potassium cyanide (ISO) potassium dichromate (ISO) pregnenolone 16alpha-carbonitrile (EXP) probucol (EXP) progesterone (EXP,ISO) puerarin (ISO) Pyridostigmine bromide (EXP) quercetin (ISO) raloxifene (EXP) resveratrol (EXP,ISO) Rosavin (ISO) rotenone (ISO) serpentine asbestos (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) simvastatin (EXP) sodium arsenite (ISO) sodium dichromate (EXP) streptozocin (EXP,ISO) sulfadimethoxine (EXP) sulfasalazine (ISO) sulfur dioxide (ISO) sunitinib (ISO) superoxide (ISO) tamibarotene (ISO) tetrachloromethane (ISO) thiabendazole (EXP) thymoquinone (EXP) titanium dioxide (ISO) trans-isoeugenol (ISO) triclosan (ISO) trimellitic anhydride (EXP) troglitazone (ISO) valproic acid (ISO) vancomycin (ISO) vinclozolin (EXP) zoledronic acid (ISO)
1.
Relationship of plasma extracellular-superoxide dismutase level with insulin resistance in type 2 diabetic patients.
Adachi T, etal., J Endocrinol. 2004 Jun;181(3):413-7.
2.
Transgenic extracellular superoxide dismutase protects postnatal alveolar epithelial proliferation and development during hyperoxia.
Auten RL, etal., Am J Physiol Lung Cell Mol Physiol. 2006 Jan;290(1):L32-40. Epub 2005 Aug 12.
3.
Amelioration of salt-induced vascular dysfunction in mesenteric arteries of Dahl salt-sensitive rats by missense mutation of extracellular superoxide dismutase.
Beyer AM, etal., Am J Physiol Heart Circ Physiol. 2014 Feb;306(3):H339-47. doi: 10.1152/ajpheart.00619.2012. Epub 2013 Dec 6.
4.
Role of extracellular superoxide dismutase in bleomycin-induced pulmonary fibrosis.
Bowler RP, etal., Am J Physiol Lung Cell Mol Physiol. 2002 Apr;282(4):L719-26.
5.
Furin proteolytically processes the heparin-binding region of extracellular superoxide dismutase.
Bowler RP, etal., J Biol Chem 2002 May 10;277(19):16505-11.
6.
The rat extracellular superoxide dismutase dimer is converted to a tetramer by the exchange of a single amino acid.
Carlsson LM, etal., Proc Natl Acad Sci U S A 1996 May 28;93(11):5219-22.
7.
Altered expression profile of superoxide dismutase isoforms in nasal polyps from nonallergic patients.
Cheng YK, etal., Laryngoscope. 2006 Mar;116(3):417-22.
8.
Gene transfer of extracellular superoxide dismutase reduces arterial pressure in spontaneously hypertensive rats: role of heparin-binding domain.
Chu Y, etal., Circ Res. 2003 Mar 7;92(4):461-8. Epub 2003 Jan 23.
9.
Long-term hyperglycaemia decreases vascular fraction of extracellular superoxide dismutase.
Ciechanowski K, etal., Diabetologia. 2003 Jul;46(7):1026-7. Epub 2003 Jun 27.
10.
Regulation of lung oxidative damage by endogenous superoxide dismutase in sepsis.
Constantino L, etal., Intensive Care Med Exp. 2014 Dec;2(1):17. doi: 10.1186/2197-425X-2-17. Epub 2014 May 23.
11.
Association of genetic polymorphisms in SOD2, SOD3, GPX3, and GSTT1 with hypertriglyceridemia and low HDL-C level in subjects with high risk of coronary artery disease.
Decharatchakul N, etal., PeerJ. 2019 Aug 1;7:e7407. doi: 10.7717/peerj.7407. eCollection 2019.
12.
Superoxide dismutase responds to hyperoxia in rat hippocampus.
Freiberger J, etal., Undersea Hyperb Med. 2004 Summer;31(2):227-32.
13.
Reduction of renal superoxide dismutase in progressive diabetic nephropathy.
Fujita H, etal., J Am Soc Nephrol. 2009 Jun;20(6):1303-13. Epub 2009 May 21.
14.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
15.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
16.
Role of extracellular superoxide dismutase in hypertension.
Gongora MC, etal., Hypertension. 2006 Sep;48(3):473-81. Epub 2006 Jul 24.
17.
Kidney failure, arterial hypertension and left ventricular hypertrophy in rats with loss of function mutation of SOD3.
Guo H, etal., Free Radic Biol Med. 2020 May 20;152:787-796. doi: 10.1016/j.freeradbiomed.2020.01.023. Epub 2020 Jan 21.
18.
Upregulation of vascular extracellular superoxide dismutase in patients with acute coronary syndromes.
Horiuchi M, etal., Arterioscler Thromb Vasc Biol. 2004 Jan;24(1):106-11. Epub 2003 Oct 30.
19.
Gene transfer of extracellular superoxide dismutase improves endothelial function in rats with heart failure.
Iida S, etal., Am J Physiol Heart Circ Physiol. 2005 Aug;289(2):H525-32.
20.
Vascular effects of a common gene variant of extracellular superoxide dismutase in heart failure.
Iida S, etal., Am J Physiol Heart Circ Physiol. 2006 Aug;291(2):H914-20.
21.
Serum superoxide dismutase 3 (extracellular superoxide dismutase) activity is a sensitive indicator of Cu status in rats.
Johnson WT, etal., J Nutr Biochem. 2005 Nov;16(11):682-92. Epub 2005 Aug 2.
22.
Genetically increased antioxidative protection and decreased chronic obstructive pulmonary disease.
Juul K, etal., Am J Respir Crit Care Med. 2006 Apr 15;173(8):858-64. Epub 2006 Jan 6.
23.
Serum extracellular superoxide dismutase in patients with type 2 diabetes: relationship to the development of micro- and macrovascular complications.
Kimura F, etal., Diabetes Care. 2003 Apr;26(4):1246-50.
24.
Extracellular superoxide dismutase has a highly specific localization in idiopathic pulmonary fibrosis/usual interstitial pneumonia.
Kinnula VL, etal., Histopathology. 2006 Jul;49(1):66-74.
25.
Vascular extracellular superoxide dismutase activity in patients with coronary artery disease: relation to endothelium-dependent vasodilation.
Landmesser U, etal., Circulation. 2000 May 16;101(19):2264-70.
26.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
27.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
28.
Skeletal muscle reperfusion injury is enhanced in extracellular superoxide dismutase knockout mouse.
Park JW, etal., Am J Physiol Heart Circ Physiol. 2005 Jul;289(1):H181-7. Epub 2005 Mar 18.
29.
Superoxide dismutase in the prostate lobes of aging Brown Norway rats.
Pechenino AS and Brown TR, Prostate. 2006 Apr 1;66(5):522-35.
30.
Isolation and characterization of a rat cDNA clone encoding a secreted superoxide dismutase reveals the epididymis to be a major site of its expression.
Perry AC, etal., Biochem J 1993 Jul 1;293 ( Pt 1):21-5.
31.
GOA pipeline
RGD automated data pipeline
32.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
33.
Mice overexpressing extracellular superoxide dismutase have increased resistance to global cerebral ischemia.
Sheng H, etal., Exp Neurol. 2000 Jun;163(2):392-8.
34.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
35.
Extracellular superoxide dismutase gene polymorphism is associated with insulin resistance and the susceptibility to type 2 diabetes.
Tamai M, etal., Diabetes Res Clin Pract. 2006 Feb;71(2):140-5. Epub 2005 Jun 28.
36.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
37.
Comparison of the effect of adenoviral delivery of three superoxide dismutase genes against hepatic ischemia-reperfusion injury.
Wheeler MD, etal., Hum Gene Ther. 2001 Dec 10;12(18):2167-77.
38.
Purification and sequence of rat extracellular superoxide dismutase B secreted by C6 glioma.
Willems J, etal., J Biol Chem 1993 Nov 25;268(33):24614-21.
39.
Exacerbated pulmonary arterial hypertension and right ventricular hypertrophy in animals with loss of function of extracellular superoxide dismutase.
Xu D, etal., Hypertension. 2011 Aug;58(2):303-9. doi: 10.1161/HYPERTENSIONAHA.110.166819. Epub 2011 Jul 5.
40.
Extracellular superoxide dismutase functions as a major repressor of hypoxia-induced erythropoietin gene expression.
Zelko IN and Folz RJ, Endocrinology. 2005 Jan;146(1):332-40. Epub 2004 Sep 16.
41.
[Correlation of the polymorphism of EC-SOD and GSTM1 and smoking with oral cancer risk].
Zhang C, etal., Wei Sheng Yan Jiu. 2012 Jul;41(4):555-61.
42.
[Association of the SOD2 Ala(-9)Val and SOD3 Arg213Gly polymorphisms with diabetic polyneuropathy in patients with diabetes mellitus type 1]
Zotova EV, etal., Mol Biol (Mosk). 2003 May-Jun;37(3):404-8.
Sod3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 62,822,865 - 62,828,602 (-) NCBI GRCr8 mRatBN7.2 14 58,610,104 - 58,615,845 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 58,609,958 - 58,615,990 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 63,014,801 - 63,020,544 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 64,328,499 - 64,334,244 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 60,725,263 - 60,731,010 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 60,958,583 - 60,971,143 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 60,958,592 - 60,964,324 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 61,071,304 - 61,083,776 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 63,381,447 - 63,387,180 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 63,383,838 - 63,389,571 (-) NCBI Celera 14 57,707,717 - 57,713,440 (-) NCBI Celera Cytogenetic Map 14 q11 NCBI
SOD3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 24,795,573 - 24,800,842 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 24,789,912 - 24,800,842 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 24,797,195 - 24,802,464 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 24,406,183 - 24,411,565 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 4 24,472,323 - 24,478,733 NCBI Celera 4 25,246,551 - 25,251,936 (+) NCBI Celera Cytogenetic Map 4 p15.2 NCBI HuRef 4 24,139,594 - 24,144,972 (+) NCBI HuRef CHM1_1 4 24,796,442 - 24,801,824 (+) NCBI CHM1_1 T2T-CHM13v2.0 4 24,777,502 - 24,782,774 (+) NCBI T2T-CHM13v2.0
Sod3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 52,521,146 - 52,527,080 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 52,521,133 - 52,528,760 (+) Ensembl GRCm39 Ensembl GRCm38 5 52,363,804 - 52,369,738 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 52,363,791 - 52,371,418 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 52,755,043 - 52,760,977 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 52,652,052 - 52,657,986 (+) NCBI MGSCv36 mm8 Celera 5 49,732,370 - 49,738,292 (+) NCBI Celera Cytogenetic Map 5 C1 NCBI cM Map 5 27.92 NCBI
Sod3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955480 257,716 - 263,149 (-) NCBI ChiLan1.0 ChiLan1.0
SOD3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 25,042,416 - 25,047,841 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 25,239,089 - 25,248,284 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 19,195,941 - 19,201,298 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 24,480,912 - 24,486,382 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 24,485,059 - 24,485,781 (+) Ensembl panpan1.1 panPan2
SOD3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 3 85,382,698 - 85,387,144 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 3 85,382,484 - 85,387,455 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 3 87,896,595 - 87,901,009 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 3 86,357,866 - 86,362,385 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 3 86,357,992 - 86,359,248 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 3 85,490,694 - 85,495,210 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 3 85,596,388 - 85,600,748 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 3 85,980,631 - 85,986,057 (-) NCBI UU_Cfam_GSD_1.0
SOD3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 8 18,796,637 - 18,802,152 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 8 18,796,633 - 18,802,156 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 8 19,293,239 - 19,293,972 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SOD3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 27 25,554,474 - 25,559,873 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 27 25,555,082 - 25,555,804 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666047 72,074,072 - 72,079,449 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Sod3
.
Predicted Target Of
Count of predictions: 287 Count of miRNA genes: 163 Interacting mature miRNAs: 180 Transcripts: ENSRNOT00000005155 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2313089 Bss81 Bone structure and strength QTL 81 3.4 0.0001 body length (VT:0001256) body length, nose to rump (CMO:0000079) 14 37669719 82669719 Rat 1581500 Renag1 Renal agenesis QTL 1 kidney development trait (VT:0000527) percentage of study population developing unilateral renal agenesis during a period of time (CMO:0000940) 14 8170668 68298175 Rat 9590294 Uminl4 Urine mineral level QTL 4 5.66 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 14 55624247 100624247 Rat 2300197 Scl59 Serum cholesterol level QTL 59 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 14 55147478 100147478 Rat 10755459 Coatc15 Coat color QTL 15 0.01681 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 14 19836944 64836944 Rat 70214 Niddm28 Non-insulin dependent diabetes mellitus QTL 28 4.06 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 14 39998251 75582726 Rat 1300154 Bp189 Blood pressure QTL 189 3.04 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 14 30883777 68757901 Rat 70187 Pancm5 Pancreatic morphology QTL 5 16.7 pancreas mass (VT:0010144) pancreas weight to body weight ratio (CMO:0000630) 14 30320092 80829842 Rat 631523 Pia13 Pristane induced arthritis QTL 13 3.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 14 40793460 98037301 Rat 2313100 Bss82 Bone structure and strength QTL 82 3 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 14 37669719 82669719 Rat 634328 Hc5 Hypercalciuria QTL 5 2.3 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 14 58184885 103184885 Rat 7387267 Uae42 Urinary albumin excretion QTL 42 0.61 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 14 22167967 67167967 Rat 2317879 Alcrsp27 Alcohol response QTL 27 3.3 0.63 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 14 56631369 101631369 Rat 631839 Niddm37 Non-insulin dependent diabetes mellitus QTL 37 3.37 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 14 11030622 95876975 Rat 2313397 Coatc1 Coat color QTL1 coat/hair pigmentation trait (VT:0010463) coat/hair color measurement (CMO:0001808) 14 18541332 63541332 Rat 9589034 Epfw11 Epididymal fat weight QTL 11 6 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 14 55624247 100624247 Rat 2313048 Bss84 Bone structure and strength QTL 84 3.1 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 14 37669719 82669719 Rat 1300136 Rf22 Renal function QTL 22 3.9 renal blood flow trait (VT:2000006) absolute change in renal vascular resistance (CMO:0001900) 14 42262529 95023211 Rat 1549834 Scl45 Serum cholesterol level QTL 45 5.8 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 14 50023211 95023211 Rat 738037 Hcas6 Hepatocarcinoma susceptibility QTL 6 2.93 liver integrity trait (VT:0010547) liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464) 14 39057237 83368335 Rat 2313084 Bss83 Bone structure and strength QTL 83 2.9 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 14 37669719 82669719 Rat
This gene Sod3 is modified in the following models/strains:
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000005155 ⟹ ENSRNOP00000005155
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 58,609,958 - 58,615,990 (-) Ensembl Rnor_6.0 Ensembl 14 60,958,592 - 60,964,324 (-) Ensembl
RefSeq Acc Id:
NM_012880 ⟹ NP_037012
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 62,822,865 - 62,828,602 (-) NCBI mRatBN7.2 14 58,610,104 - 58,615,845 (-) NCBI Rnor_6.0 14 60,958,591 - 60,964,324 (-) NCBI Rnor_5.0 14 61,071,304 - 61,083,776 (-) NCBI RGSC_v3.4 14 63,381,447 - 63,387,180 (-) RGD Celera 14 57,707,717 - 57,713,440 (-) RGD
Sequence:
GGCTCACAAGCAGCTGGCCAGTTCTGGGGAGGCAGCTCAGAGGCTCTTTCTCAGGCCTCTAGCTGGGTCTGTCCTGTACTTCACCAGAGGAAAAACGTTCTTGGGAGAGCTTGTCAGGTGTGGAACCT
hide sequence
RefSeq Acc Id:
NP_037012 ⟸ NM_012880
- Peptide Label:
precursor
- UniProtKB:
Q64667 (UniProtKB/Swiss-Prot), Q08420 (UniProtKB/Swiss-Prot), A6IJH8 (UniProtKB/TrEMBL)
- Sequence:
MVAFLFCNLLLVACGSVTWTMSDTGESGVDLADRLDLVEKIGDTHSKDLEIWMELGKQREADAREMHAVCRVQPSAMLPPDQPQITGLVLFRQLGPSSRLEASFNLEGFPAEQNTSNHAIHVHEFGDL
hide sequence
Ensembl Acc Id:
ENSRNOP00000005155 ⟸ ENSRNOT00000005155
RGD ID: 13699337 Promoter ID: EPDNEW_R9862 Type: initiation region Name: Sod3_1 Description: superoxide dismutase 3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 14 60,964,292 - 60,964,352 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2017-01-24
Sod3
superoxide dismutase 3
Sod3
superoxide dismutase 3, extracellular
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Sod3
superoxide dismutase 3, extracellular
superoxide dismutase 3
Name updated
1299863 APPROVED
2003-04-09
Sod3
superoxide dismutase 3
Superoxide dismutase 3
Name updated
629478 APPROVED
2001-12-21
Sod3
Superoxide dismutase 3
Name updated
69729 APPROVED
Note Type
Note
Reference
gene_expression
expressed in epididymis
730184
gene_homology
presence of Asp28 is associated with dimerization of the rat protein rather than tetramer formation observed in mice and human homologs, which contain Val28
730025
gene_mutations_overexpression
D28V mutant forms a tetramer and has high affinity for heparin sulfate
730025
gene_physical_interaction
binds to heparin
730119
gene_process
may be involved in preserving spermatozoa fertility by preventing lipid peroxidation
730184
gene_protein
forms a dimer; a copper-zinc containing glycoprotein
730025
