Symbol:
Mapk10
Name:
mitogen activated protein kinase 10
RGD ID:
3663
Description:
Enables ATP binding activity and JUN kinase activity. Involved in several processes, including JUN phosphorylation; cellular hyperosmotic response; and neurotransmitter receptor transport to postsynaptic membrane. Located in perikaryon. Is active in glutamatergic synapse and postsynaptic Golgi apparatus. Human ortholog(s) of this gene implicated in pancreatic adenocarcinoma. Orthologous to human MAPK10 (mitogen-activated protein kinase 10); PARTICIPATES IN c-Jun N-terminal kinases MAPK signaling pathway; FasL mediated signaling pathway; platelet-derived growth factor signaling pathway; INTERACTS WITH 2,3,7,8-Tetrachlorodibenzofuran; 2-ethoxyethanol; 2-methoxyethanol.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
c-Jun N-terminal kinase 3; Jnk3; MAP kinase 10; MAPK 10; mitogen-activated protein kinase 10; p54-beta; SAPb; SAPK-beta; SAPKC; Serk2; Stress activated protein kinase beta; stress-activated protein kinase JNK3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 6,802,247 - 7,094,103 (+) NCBI GRCr8 mRatBN7.2 14 6,497,662 - 6,790,109 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 6,497,707 - 6,786,201 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 6,475,683 - 6,751,915 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 7,775,937 - 8,052,130 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 6,467,375 - 6,743,050 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 8,079,955 - 8,371,508 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 8,080,275 - 8,368,254 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 8,053,697 - 8,344,225 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 7,719,595 - 8,010,694 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 7,719,594 - 8,010,694 (+) NCBI Celera 14 6,636,411 - 6,919,118 (+) NCBI Celera Cytogenetic Map 14 p22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Mapk10 Rat (-)-anisomycin multiple interactions ISO RGD:733441 6480464 Dicumarol inhibits the reaction [Anisomycin results in increased activity of MAPK10 protein] CTD PMID:10531305 Mapk10 Rat (-)-anisomycin increases activity ISO RGD:733441 6480464 Anisomycin results in increased activity of MAPK10 protein CTD PMID:10531305 Mapk10 Rat (R)-noradrenaline multiple interactions ISO RGD:11285 6480464 MAPK10 protein affects the reaction [MAPK9 protein affects the susceptibility to Norepinephrine] CTD PMID:16949803 Mapk10 Rat 1,2-dibromoethane increases expression ISO RGD:11285 6480464 Ethylene Dibromide results in increased expression of MAPK10 mRNA CTD PMID:15612046 Mapk10 Rat 1,2-dichloroethane increases expression ISO RGD:11285 6480464 ethylene dichloride results in increased expression of MAPK10 mRNA CTD PMID:28960355 Mapk10 Rat 17alpha-ethynylestradiol affects expression ISO RGD:11285 6480464 Ethinyl Estradiol affects the expression of MAPK10 mRNA CTD PMID:17555576 Mapk10 Rat 17beta-hydroxy-5alpha-androstan-3-one multiple interactions ISO RGD:733441 6480464 APOE gene polymorphism affects the reaction [Dihydrotestosterone affects the phosphorylation of MAPK10 protein] CTD PMID:17395708 Mapk10 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2,3,7,8-tetrachlorodibenzofuran results in decreased expression of MAPK10 mRNA CTD PMID:32109520 Mapk10 Rat 2-ethoxyethanol increases expression EXP 6480464 2-ethoxyethanol results in increased expression of MAPK10 mRNA CTD PMID:19643169 Mapk10 Rat 2-methoxyethanol increases expression EXP 6480464 methyl cellosolve results in increased expression of MAPK10 mRNA CTD PMID:19643169 Mapk10 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO RGD:11285 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in decreased expression of MAPK10 mRNA CTD PMID:26251327 Mapk10 Rat 4,4'-sulfonyldiphenol decreases expression ISO RGD:11285 6480464 bisphenol S results in decreased expression of MAPK10 mRNA CTD PMID:30951980 Mapk10 Rat 4,4'-sulfonyldiphenol affects methylation ISO RGD:733441 6480464 bisphenol S affects the methylation of MAPK10 gene CTD PMID:31601247 Mapk10 Rat 8-Br-cAMP decreases expression ISO RGD:733441 6480464 8-Bromo Cyclic Adenosine Monophosphate results in decreased expression of MAPK10 mRNA CTD PMID:22079614 Mapk10 Rat acetohydrazide decreases expression ISO RGD:11285 6480464 acetylhydrazine results in decreased expression of MAPK10 mRNA CTD PMID:15282401 Mapk10 Rat aflatoxin B1 decreases methylation ISO RGD:733441 6480464 Aflatoxin B1 results in decreased methylation of MAPK10 gene CTD PMID:27153756 Mapk10 Rat all-trans-retinoic acid decreases expression ISO RGD:733441 6480464 Tretinoin results in decreased expression of MAPK10 mRNA CTD PMID:21934132 Mapk10 Rat all-trans-retinoic acid decreases expression ISO RGD:11285 6480464 Tretinoin results in decreased expression of MAPK10 mRNA CTD PMID:22498432 Mapk10 Rat aristolochic acid A decreases expression ISO RGD:733441 6480464 aristolochic acid I results in decreased expression of MAPK10 mRNA CTD PMID:33212167 Mapk10 Rat arsane multiple interactions ISO RGD:733441 6480464 [arsenic trichloride results in increased abundance of Arsenic] which results in increased expression of MAPK10 more ... CTD PMID:35625704 Mapk10 Rat arsenic atom multiple interactions ISO RGD:733441 6480464 [arsenic trichloride results in increased abundance of Arsenic] which results in increased expression of MAPK10 more ... CTD PMID:35625704 Mapk10 Rat arsenic trichloride multiple interactions ISO RGD:733441 6480464 [arsenic trichloride results in increased abundance of Arsenic] which results in increased expression of MAPK10 more ... CTD PMID:35625704 Mapk10 Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of MAPK10 gene CTD PMID:28931070 Mapk10 Rat Azoxymethane multiple interactions ISO RGD:11285 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of MAPK10 more ... CTD PMID:29950665 Mapk10 Rat benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of MAPK10 mRNA CTD PMID:21839799 Mapk10 Rat benzo[a]pyrene increases methylation ISO RGD:733441 6480464 Benzo(a)pyrene results in increased methylation of MAPK10 promoter CTD PMID:27901495 Mapk10 Rat benzo[a]pyrene decreases methylation ISO RGD:11285 6480464 Benzo(a)pyrene results in decreased methylation of MAPK10 intron CTD PMID:27901495 Mapk10 Rat benzo[a]pyrene affects methylation ISO RGD:733441 6480464 Benzo(a)pyrene affects the methylation of MAPK10 5' UTR CTD PMID:27901495 Mapk10 Rat benzo[b]fluoranthene decreases expression ISO RGD:11285 6480464 benzo(b)fluoranthene results in decreased expression of MAPK10 mRNA CTD PMID:26377693 Mapk10 Rat bis(2-chloroethyl) sulfide increases expression ISO RGD:11285 6480464 Mustard Gas results in increased expression of MAPK10 mRNA CTD PMID:15674843 Mapk10 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO RGD:11285 6480464 Diethylhexyl Phthalate inhibits the reaction [[Streptozocin co-treated with Dietary Fats] results in increased expression of more ... CTD PMID:33484791 Mapk10 Rat bis(2-ethylhexyl) phthalate decreases expression ISO RGD:733441 6480464 Diethylhexyl Phthalate results in decreased expression of MAPK10 mRNA CTD PMID:31163220 Mapk10 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of MAPK10 mRNA CTD PMID:25181051 Mapk10 Rat bisphenol A increases phosphorylation ISO RGD:733441 6480464 bisphenol A results in increased phosphorylation of MAPK10 protein CTD PMID:36232920 Mapk10 Rat bisphenol A multiple interactions ISO RGD:733441 6480464 [bisphenol A co-treated with Fulvestrant] affects the methylation of MAPK10 gene CTD PMID:31601247 Mapk10 Rat bisphenol A increases methylation ISO RGD:733441 6480464 bisphenol A results in increased methylation of MAPK10 gene CTD PMID:31601247 Mapk10 Rat bisphenol A decreases expression ISO RGD:11285 6480464 bisphenol A results in decreased expression of MAPK10 mRNA CTD PMID:30951980|PMID:32156529 Mapk10 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of MAPK10 gene CTD PMID:28505145 Mapk10 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Genistein] results in increased methylation of MAPK10 gene CTD PMID:28505145 Mapk10 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of MAPK10 mRNA CTD PMID:30816183|PMID:32528016 Mapk10 Rat bisphenol F decreases expression ISO RGD:11285 6480464 bisphenol F results in decreased expression of MAPK10 mRNA CTD PMID:30951980 Mapk10 Rat bortezomib multiple interactions ISO RGD:733441 6480464 [[Bortezomib co-treated with Butyrates] results in increased abundance of Reactive Oxygen Species] which results in more ... CTD PMID:15173093 Mapk10 Rat butanal decreases expression ISO RGD:733441 6480464 butyraldehyde results in decreased expression of MAPK10 mRNA CTD PMID:26079696 Mapk10 Rat cadmium dichloride decreases methylation EXP 6480464 Cadmium Chloride results in decreased methylation of MAPK10 promoter CTD PMID:22457795 Mapk10 Rat cadmium dichloride decreases expression ISO RGD:733441 6480464 Cadmium Chloride results in decreased expression of MAPK10 mRNA CTD PMID:32512071 Mapk10 Rat cadmium dichloride increases response to substance ISO RGD:11285 6480464 MAPK10 protein results in increased susceptibility to Cadmium Chloride CTD PMID:28163110 Mapk10 Rat cadmium dichloride increases phosphorylation EXP 6480464 Cadmium Chloride results in increased phosphorylation of MAPK10 protein CTD PMID:27389774 Mapk10 Rat cadmium dichloride multiple interactions EXP 6480464 Quercetin inhibits the reaction [Cadmium Chloride results in increased phosphorylation of MAPK10 protein] CTD PMID:27389774 Mapk10 Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of MAPK10 mRNA CTD PMID:33453195 Mapk10 Rat cantharidin decreases expression ISO RGD:11285 6480464 Cantharidin results in decreased expression of MAPK10 mRNA CTD PMID:36907384 Mapk10 Rat carmustine decreases expression ISO RGD:733441 6480464 Carmustine results in decreased expression of MAPK10 mRNA CTD PMID:15980968 Mapk10 Rat CGP 52608 multiple interactions ISO RGD:733441 6480464 CGP 52608 promotes the reaction [RORA protein binds to MAPK10 gene] CTD PMID:28238834 Mapk10 Rat chlordecone increases expression ISO RGD:11285 6480464 Chlordecone results in increased expression of MAPK10 mRNA CTD PMID:29980752 Mapk10 Rat chromium(6+) multiple interactions ISO RGD:11285 6480464 [Arsenates co-treated with chromium hexavalent ion] results in increased expression of MAPK10 protein; [Arsenates co-treated more ... CTD PMID:19895865 Mapk10 Rat chromium(6+) increases phosphorylation ISO RGD:11285 6480464 chromium hexavalent ion results in increased phosphorylation of MAPK10 protein CTD PMID:19895865 Mapk10 Rat chromium(6+) increases expression ISO RGD:11285 6480464 chromium hexavalent ion results in increased expression of MAPK10 protein CTD PMID:19895865 Mapk10 Rat cisplatin decreases expression EXP 6480464 Cisplatin results in decreased expression of MAPK10 mRNA CTD PMID:23558232 Mapk10 Rat cobalt dichloride decreases expression ISO RGD:733441 6480464 cobaltous chloride results in decreased expression of MAPK10 mRNA CTD PMID:17553155 Mapk10 Rat cocaine decreases expression ISO RGD:733441 6480464 Cocaine results in decreased expression of MAPK10 mRNA CTD PMID:12629581 Mapk10 Rat curcumin multiple interactions EXP 6480464 Curcumin analog inhibits the reaction [Rotenone results in increased phosphorylation of MAPK10 protein]; Curcumin inhibits more ... CTD PMID:24952339|PMID:27535828|PMID:27966075 Mapk10 Rat cypermethrin increases expression ISO RGD:11285 6480464 cypermethrin results in increased expression of MAPK10 mRNA CTD PMID:29020013 Mapk10 Rat D-glucitol multiple interactions ISO RGD:733441 6480464 Dicumarol inhibits the reaction [Sorbitol results in increased activity of MAPK10 protein] CTD PMID:10531305 Mapk10 Rat D-glucitol increases activity ISO RGD:733441 6480464 Sorbitol results in increased activity of MAPK10 protein CTD PMID:10531305 Mapk10 Rat dextran sulfate multiple interactions ISO RGD:11285 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of MAPK10 more ... CTD PMID:29950665 Mapk10 Rat dichloroacetic acid increases expression ISO RGD:11285 6480464 Dichloroacetic Acid results in increased expression of MAPK10 mRNA CTD PMID:28962523 Mapk10 Rat dicoumarol multiple interactions ISO RGD:733441 6480464 Dicumarol inhibits the reaction [Anisomycin results in increased activity of MAPK10 protein]; Dicumarol inhibits the more ... CTD PMID:10531305 Mapk10 Rat dicoumarol decreases activity ISO RGD:733441 6480464 Dicumarol results in decreased activity of MAPK10 protein CTD PMID:10531305 Mapk10 Rat dioxygen multiple interactions ISO RGD:11285 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of MAPK10 mRNA CTD PMID:30529165 Mapk10 Rat dorsomorphin multiple interactions ISO RGD:733441 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ... CTD PMID:27188386 Mapk10 Rat doxorubicin multiple interactions EXP 6480464 Doxorubicin results in increased phosphorylation of and results in increased activity of MAPK10 protein; pifithrin more ... CTD PMID:16687611 Mapk10 Rat doxorubicin increases expression EXP 6480464 Doxorubicin results in increased expression of MAPK10 mRNA CTD PMID:32289291 Mapk10 Rat doxorubicin decreases expression ISO RGD:733441 6480464 Doxorubicin results in decreased expression of MAPK10 mRNA CTD PMID:29803840 Mapk10 Rat emodin increases expression ISO RGD:11285 6480464 Emodin results in increased expression of MAPK10 mRNA CTD PMID:15612046 Mapk10 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of MAPK10 mRNA; Endosulfan results in increased expression of MAPK10 more ... CTD PMID:31464424 Mapk10 Rat entinostat decreases expression ISO RGD:733441 6480464 entinostat results in decreased expression of MAPK10 mRNA CTD PMID:26272509 Mapk10 Rat entinostat multiple interactions ISO RGD:733441 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ... CTD PMID:27188386 Mapk10 Rat ethanol decreases expression ISO RGD:733441 6480464 Ethanol results in decreased expression of MAPK10 mRNA CTD PMID:28986285 Mapk10 Rat ethanol affects splicing ISO RGD:11285 6480464 Ethanol affects the splicing of MAPK10 mRNA CTD PMID:30319688 Mapk10 Rat flavonoids increases expression EXP 6480464 Flavonoids results in increased expression of MAPK10 mRNA CTD PMID:18035473 Mapk10 Rat flutamide increases expression ISO RGD:11285 6480464 Flutamide results in increased expression of MAPK10 mRNA CTD PMID:32662666 Mapk10 Rat fulvestrant multiple interactions ISO RGD:733441 6480464 [bisphenol A co-treated with Fulvestrant] affects the methylation of MAPK10 gene CTD PMID:31601247 Mapk10 Rat genistein increases expression ISO RGD:11285 6480464 Genistein results in increased expression of MAPK10 mRNA CTD PMID:16169203|PMID:32186404 Mapk10 Rat genistein multiple interactions EXP 6480464 [bisphenol A co-treated with Genistein] results in increased methylation of MAPK10 gene; [Genistein co-treated with more ... CTD PMID:21782745|PMID:28505145 Mapk10 Rat glycidol increases expression ISO RGD:11285 6480464 glycidol results in increased expression of MAPK10 mRNA CTD PMID:15612046 Mapk10 Rat glyphosate increases methylation EXP 6480464 Glyphosate results in increased methylation of MAPK10 gene CTD PMID:31011160 Mapk10 Rat hydrogen peroxide multiple interactions EXP 6480464 AG 1879 inhibits the reaction [Hydrogen Peroxide results in increased activity of MAPK10 protein]; Hydrogen more ... CTD PMID:15574683|PMID:19386027 Mapk10 Rat hydrogen peroxide increases response to substance ISO RGD:11285 6480464 MAPK10 results in increased susceptibility to Hydrogen Peroxide CTD PMID:20418776 Mapk10 Rat hydrogen peroxide increases activity EXP 6480464 Hydrogen Peroxide results in increased activity of MAPK10 protein CTD PMID:15574683 Mapk10 Rat hypochlorous acid multiple interactions ISO RGD:733441 6480464 Hypochlorous Acid results in increased phosphorylation of and results in increased activity of MAPK10 protein CTD PMID:18156441 Mapk10 Rat ibuprofen increases expression ISO RGD:11285 6480464 Ibuprofen results in increased expression of MAPK10 mRNA CTD PMID:37453669 Mapk10 Rat L-serine decreases expression ISO RGD:733441 6480464 Serine results in decreased expression of MAPK10 mRNA CTD PMID:29098664 Mapk10 Rat lead diacetate affects expression EXP 6480464 lead acetate affects the expression of MAPK10 CTD PMID:24293362 Mapk10 Rat lipopolysaccharide increases phosphorylation ISO RGD:11285 6480464 Lipopolysaccharides results in increased phosphorylation of MAPK10 protein CTD PMID:11543732 Mapk10 Rat lipopolysaccharide multiple interactions ISO RGD:733441 6480464 [S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of MAPK10 mRNA CTD PMID:35811015 Mapk10 Rat lipopolysaccharide increases expression ISO RGD:733441 6480464 Lipopolysaccharides results in increased expression of MAPK10 mRNA CTD PMID:35811015 Mapk10 Rat lipopolysaccharide multiple interactions ISO RGD:11285 6480464 Quercetin inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of MAPK10 protein] CTD PMID:11543732 Mapk10 Rat lithium chloride decreases expression ISO RGD:733441 6480464 Lithium Chloride results in decreased expression of MAPK10 mRNA CTD PMID:23527032 Mapk10 Rat luteolin increases phosphorylation ISO RGD:733441 6480464 Luteolin results in increased phosphorylation of MAPK10 protein CTD PMID:21601631 Mapk10 Rat LY294002 multiple interactions ISO RGD:733441 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one promotes the reaction [Pt(O,O'-acac)(gamma-acac)(DMS) results in increased phosphorylation of MAPK10 protein] CTD PMID:21420390 Mapk10 Rat mangiferin multiple interactions ISO RGD:733441 6480464 mangiferin inhibits the reaction [aluminum maltolate results in increased expression of and results in increased more ... CTD PMID:37455591 Mapk10 Rat menadione decreases activity ISO RGD:733441 6480464 Vitamin K 3 results in decreased activity of MAPK10 protein CTD PMID:10531305 Mapk10 Rat menadione multiple interactions EXP 6480464 Vitamin K 3 results in increased phosphorylation of and results in increased activity of MAPK10 more ... CTD PMID:19386027 Mapk10 Rat mercury dibromide decreases expression ISO RGD:733441 6480464 mercuric bromide results in decreased expression of MAPK10 mRNA CTD PMID:26272509 Mapk10 Rat mercury dibromide multiple interactions ISO RGD:733441 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Mapk10 Rat metformin multiple interactions ISO RGD:733441 6480464 Metformin inhibits the reaction [IL1B protein results in increased phosphorylation of MAPK10 protein] CTD PMID:16385087 Mapk10 Rat methotrexate affects expression ISO RGD:11285 6480464 Methotrexate affects the expression of MAPK10 mRNA CTD PMID:18502557 Mapk10 Rat methoxychlor multiple interactions EXP 6480464 [Genistein co-treated with Methoxychlor] results in increased expression of MAPK10 mRNA CTD PMID:21782745 Mapk10 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of MAPK10 gene CTD PMID:35440735 Mapk10 Rat methoxychlor increases expression EXP 6480464 Methoxychlor results in increased expression of MAPK10 mRNA CTD PMID:21782745 Mapk10 Rat methylmercury chloride decreases expression ISO RGD:733441 6480464 methylmercuric chloride results in decreased expression of MAPK10 mRNA CTD PMID:28001369 Mapk10 Rat N-acetyl-L-cysteine multiple interactions ISO RGD:733441 6480464 Acetylcysteine inhibits the reaction [[Bortezomib co-treated with Butyrates] results in increased phosphorylation of and results more ... CTD PMID:15173093 Mapk10 Rat N-methyl-4-phenylpyridinium increases expression ISO RGD:733441 6480464 1-Methyl-4-phenylpyridinium results in increased expression of MAPK10 mRNA CTD PMID:25234470 Mapk10 Rat naringin multiple interactions ISO RGD:11285 6480464 naringin inhibits the reaction [Dietary Fats results in increased phosphorylation of MAPK10 protein] CTD PMID:22198281 Mapk10 Rat nickel atom decreases expression ISO RGD:733441 6480464 Nickel results in decreased expression of MAPK10 mRNA CTD PMID:25583101 Mapk10 Rat okadaic acid decreases expression ISO RGD:733441 6480464 Okadaic Acid results in decreased expression of MAPK10 mRNA CTD PMID:38832940 Mapk10 Rat ozone multiple interactions ISO RGD:11285 6480464 [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of MAPK10 more ... CTD PMID:34911549 Mapk10 Rat p-menthan-3-ol decreases expression ISO RGD:733441 6480464 Menthol results in decreased expression of MAPK10 mRNA CTD PMID:26760959 Mapk10 Rat panobinostat decreases expression ISO RGD:733441 6480464 panobinostat results in decreased expression of MAPK10 mRNA CTD PMID:26272509 Mapk10 Rat panobinostat multiple interactions ISO RGD:733441 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ... CTD PMID:27188386 Mapk10 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of MAPK10 mRNA CTD PMID:33387578 Mapk10 Rat paraquat increases response to substance ISO RGD:11285 6480464 MAPK10 results in increased susceptibility to Paraquat CTD PMID:20418776 Mapk10 Rat paraquat decreases expression ISO RGD:11285 6480464 Paraquat results in decreased expression of MAPK10 mRNA CTD PMID:21371552 Mapk10 Rat pentanal decreases expression ISO RGD:733441 6480464 pentanal results in decreased expression of MAPK10 mRNA CTD PMID:26079696 Mapk10 Rat phenylephrine multiple interactions ISO RGD:11285 6480464 MAPK10 protein affects the reaction [MAPK9 protein affects the susceptibility to Phenylephrine] CTD PMID:16949803 Mapk10 Rat phenylmercury acetate decreases expression ISO RGD:733441 6480464 Phenylmercuric Acetate results in decreased expression of MAPK10 mRNA CTD PMID:26272509 Mapk10 Rat phenylmercury acetate multiple interactions ISO RGD:733441 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Mapk10 Rat pifithrin-alpha hydrobromide multiple interactions EXP 6480464 pifithrin inhibits the reaction [Doxorubicin results in increased phosphorylation of and results in increased activity more ... CTD PMID:16687611 Mapk10 Rat potassium chloride multiple interactions ISO RGD:11285 6480464 MAPK10 protein affects the reaction [MAPK9 protein affects the susceptibility to Potassium Chloride] CTD PMID:16949803 Mapk10 Rat potassium dichromate increases expression ISO RGD:11285 6480464 Potassium Dichromate results in increased expression of MAPK10 mRNA CTD PMID:23608068 Mapk10 Rat procymidone increases expression ISO RGD:11285 6480464 procymidone results in increased expression of MAPK10 mRNA CTD PMID:35913088 Mapk10 Rat quercetin multiple interactions ISO RGD:11285 6480464 Quercetin inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of MAPK10 protein] CTD PMID:11543732 Mapk10 Rat quercetin multiple interactions EXP 6480464 Quercetin inhibits the reaction [Cadmium Chloride results in increased phosphorylation of MAPK10 protein] CTD PMID:27389774 Mapk10 Rat quinolin-8-ol increases expression ISO RGD:11285 6480464 Oxyquinoline results in increased expression of MAPK10 mRNA CTD PMID:15612046 Mapk10 Rat reactive oxygen species multiple interactions ISO RGD:733441 6480464 [[Bortezomib co-treated with Butyrates] results in increased abundance of Reactive Oxygen Species] which results in more ... CTD PMID:15173093 Mapk10 Rat rotenone increases response to substance ISO RGD:11285 6480464 MAPK10 results in increased susceptibility to Rotenone CTD PMID:20418776 Mapk10 Rat rotenone multiple interactions ISO RGD:733441 6480464 [PSME4 protein affects the susceptibility to Rotenone] which results in decreased expression of MAPK10 mRNA CTD PMID:32368861 Mapk10 Rat rotenone multiple interactions ISO RGD:11285 6480464 MAPK10 mutant form inhibits the reaction [Rotenone results in increased activity of CASP3 protein] CTD PMID:25496994 Mapk10 Rat rotenone decreases response to substance ISO RGD:11285 6480464 MAPK10 gene mutant form results in decreased susceptibility to Rotenone CTD PMID:25496994 Mapk10 Rat rotenone multiple interactions EXP 6480464 Curcumin analog inhibits the reaction [Rotenone results in increased phosphorylation of MAPK10 protein] CTD PMID:27535828 Mapk10 Rat rotenone increases phosphorylation EXP 6480464 Rotenone results in increased phosphorylation of MAPK10 protein CTD PMID:27535828 Mapk10 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO RGD:733441 6480464 [S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of MAPK10 mRNA CTD PMID:35811015 Mapk10 Rat S-nitrosoglutathione increases expression ISO RGD:733441 6480464 S-Nitrosoglutathione results in increased expression of MAPK10 mRNA CTD PMID:38825487 Mapk10 Rat SB 431542 multiple interactions ISO RGD:733441 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ... CTD PMID:27188386 Mapk10 Rat silicon dioxide decreases expression ISO RGD:733441 6480464 Silicon Dioxide analog results in decreased expression of MAPK10 mRNA; Silicon Dioxide results in decreased more ... CTD PMID:25351596|PMID:25895662 Mapk10 Rat sodium arsenite decreases activity ISO RGD:733441 6480464 sodium arsenite results in decreased activity of MAPK10 protein CTD PMID:23219847 Mapk10 Rat sodium arsenite affects methylation ISO RGD:733441 6480464 sodium arsenite affects the methylation of MAPK10 gene CTD PMID:28589171 Mapk10 Rat sodium arsenite increases phosphorylation EXP 6480464 sodium arsenite results in increased phosphorylation of MAPK10 protein CTD PMID:24952339 Mapk10 Rat sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of MAPK10 protein CTD PMID:11446828|PMID:27966075 Mapk10 Rat sodium arsenite multiple interactions EXP 6480464 Curcumin inhibits the reaction [sodium arsenite results in increased expression of MAPK10 protein]; Curcumin inhibits more ... CTD PMID:24952339|PMID:27966075 Mapk10 Rat sodium arsenite increases response to substance ISO RGD:11285 6480464 MAPK10 results in increased susceptibility to sodium arsenite CTD PMID:20418776 Mapk10 Rat sodium arsenite decreases expression ISO RGD:733441 6480464 sodium arsenite results in decreased expression of MAPK10 mRNA; sodium arsenite results in decreased expression more ... CTD PMID:23219847|PMID:34032870 Mapk10 Rat sodium dichromate affects expression EXP 6480464 sodium bichromate affects the expression of MAPK10 mRNA CTD PMID:11960910 Mapk10 Rat streptozocin multiple interactions ISO RGD:11285 6480464 [Streptozocin co-treated with Dietary Fats] results in increased expression of MAPK10 mRNA; Diethylhexyl Phthalate inhibits more ... CTD PMID:33484791 Mapk10 Rat sulfates affects methylation ISO RGD:733441 6480464 Sulfates affects the methylation of MAPK10 promoter CTD PMID:25395096 Mapk10 Rat sulfates multiple interactions ISO RGD:733441 6480464 [Soot co-treated with Sulfates] affects the methylation of MAPK10 promoter CTD PMID:25395096 Mapk10 Rat sulindac sulfide increases expression ISO RGD:733441 6480464 sulindac sulfide results in increased expression of MAPK10 mRNA CTD PMID:12734198 Mapk10 Rat sunitinib decreases expression ISO RGD:733441 6480464 Sunitinib results in decreased expression of MAPK10 mRNA CTD PMID:31533062 Mapk10 Rat tamoxifen affects expression ISO RGD:11285 6480464 Tamoxifen affects the expression of MAPK10 mRNA CTD PMID:17555576 Mapk10 Rat titanium dioxide decreases expression ISO RGD:11285 6480464 titanium dioxide results in decreased expression of MAPK10 mRNA CTD PMID:23557971 Mapk10 Rat titanium dioxide multiple interactions ISO RGD:11285 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of MAPK10 more ... CTD PMID:29950665 Mapk10 Rat trichostatin A decreases expression ISO RGD:733441 6480464 trichostatin A results in decreased expression of MAPK10 mRNA CTD PMID:26272509 Mapk10 Rat trichostatin A multiple interactions ISO RGD:733441 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Mapk10 Rat valproic acid affects expression ISO RGD:733441 6480464 Valproic Acid affects the expression of MAPK10 mRNA CTD PMID:25979313 Mapk10 Rat valproic acid increases methylation ISO RGD:733441 6480464 Valproic Acid results in increased methylation of MAPK10 gene CTD PMID:29501571 Mapk10 Rat valproic acid decreases expression ISO RGD:733441 6480464 Valproic Acid results in decreased expression of MAPK10 mRNA CTD PMID:23179753|PMID:27188386|PMID:28001369 Mapk10 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of MAPK10 mRNA CTD PMID:19015723 Mapk10 Rat vinclozolin increases expression ISO RGD:11285 6480464 vinclozolin results in increased expression of MAPK10 mRNA CTD PMID:36642194 Mapk10 Rat vinclozolin affects expression ISO RGD:11285 6480464 vinclozolin affects the expression of MAPK10 mRNA CTD PMID:34182078 Mapk10 Rat vorinostat multiple interactions ISO RGD:733441 6480464 [[Bortezomib co-treated with vorinostat] results in increased abundance of Reactive Oxygen Species] which results in more ... CTD PMID:15173093 Mapk10 Rat zoledronic acid decreases expression ISO RGD:733441 6480464 zoledronic acid results in decreased expression of MAPK10 mRNA CTD PMID:24714768
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
Mapk10 Rat ATP binding enables IEA UniRule:UR001528758 1600115 GO_REF:0000104 UniProt GO_REF:0000104 Mapk10 Rat ATP binding IDA 2298561 RGD Mapk10 Rat ATP binding enables IEA InterPro:IPR000719|InterPro:IPR003527|InterPro:IPR008351 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Mapk10 Rat ATP binding enables IEA UniProtKB-KW:KW-0067 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Mapk10 Rat JUN kinase activity enables ISS UniProtKB:Q61831 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Mapk10 Rat JUN kinase activity IDA 2298561 RGD Mapk10 Rat JUN kinase activity enables IBA FB:FBgn0000229|MGI:1346861|MGI:1346862|MGI:1346863|PANTHER:PTN001171982|RGD:3663|RGD:621506|RGD:628847|UniProtKB:P45983|UniProtKB:P45984|WB:WBGene00002178|WB:WBGene00002187 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Mapk10 Rat JUN kinase activity enables ISO RGD:11285 1624291 PMID:9349820 RGD PMID:9349820 Mapk10 Rat JUN kinase activity enables IEA ARBA:ARBA00035560 1600115 GO_REF:0000117 UniProt GO_REF:0000117 Mapk10 Rat kinase activity enables IEA UniProtKB-KW:KW-0418 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Mapk10 Rat MAP kinase activity enables IEA InterPro:IPR003527|InterPro:IPR008351 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Mapk10 Rat MAP kinase activity enables IEA UniRule:UR001528758 1600115 GO_REF:0000104 UniProt GO_REF:0000104 Mapk10 Rat MAP kinase activity enables IEA EC:2.7.11.24 1600115 GO_REF:0000003 UniProt GO_REF:0000003 Mapk10 Rat nucleotide binding enables IEA UniProtKB-KW:KW-0547 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Mapk10 Rat protein binding enables ISO RGD:733441 1624291 UniProtKB:P00338-3|UniProtKB:P05412|UniProtKB:P17535|UniProtKB:P30793|UniProtKB:P49407|UniProtKB:Q04206|UniProtKB:Q92526 PMID:19294699, PMID:19527717, PMID:19782076, PMID:19879840, PMID:21988832, PMID:22327296, PMID:25416956, PMID:32296183, PMID:33961781 RGD PMID:19294699|PMID:19527717|PMID:19782076|PMID:19879840|PMID:21988832|PMID:22327296|PMID:25416956|PMID:32296183|PMID:33961781 Mapk10 Rat protein binding enables ISO RGD:11285 1624291 PR:Q58A65|PR:Q6NS57|PR:Q6PDS3|PR:Q9ESN9|UniProtKB:Q6PDS3|UniProtKB:Q9ESN9|UniProtKB:Q9ESN9-2 PMID:10471813, PMID:10523642, PMID:15767678, PMID:17724133 RGD PMID:10471813|PMID:10523642|PMID:15767678|PMID:17724133 Mapk10 Rat protein binding enables IPI UniProtKB:E9PSK7|UniProtKB:Q9R237 13673827 PMID:21076496 UniProt Mapk10 Rat protein binding enables IPI UniProtKB:P50232 8554794 PMID:18046461 IntAct Mapk10 Rat protein kinase activity enables IEA InterPro:IPR000719|InterPro:IPR008271 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Mapk10 Rat protein serine kinase activity enables IEA RHEA:17989 1600115 GO_REF:0000116 RHEA GO_REF:0000116 Mapk10 Rat protein serine kinase activity enables IEA UniRule:UR001528758 1600115 GO_REF:0000104 UniProt GO_REF:0000104 Mapk10 Rat protein serine/threonine kinase activity enables IEA UniProtKB-KW:KW-0723 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Mapk10 Rat protein serine/threonine kinase activity enables IEA UniRule:UR001528758 1600115 GO_REF:0000104 UniProt GO_REF:0000104 Mapk10 Rat transferase activity enables IEA UniProtKB-KW:KW-0808 1600115 GO_REF:0000043 UniProt GO_REF:0000043
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(-)-anisomycin (ISO) (R)-noradrenaline (ISO) 1,2-dibromoethane (ISO) 1,2-dichloroethane (ISO) 17alpha-ethynylestradiol (ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2-ethoxyethanol (EXP) 2-methoxyethanol (EXP) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-sulfonyldiphenol (ISO) 8-Br-cAMP (ISO) acetohydrazide (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenic trichloride (ISO) atrazine (EXP) Azoxymethane (ISO) benzo[a]pyrene (EXP,ISO) benzo[b]fluoranthene (ISO) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) bortezomib (ISO) butanal (ISO) cadmium dichloride (EXP,ISO) cantharidin (ISO) carmustine (ISO) CGP 52608 (ISO) chlordecone (ISO) chromium(6+) (ISO) cisplatin (EXP) cobalt dichloride (ISO) cocaine (ISO) curcumin (EXP) cypermethrin (ISO) D-glucitol (ISO) dextran sulfate (ISO) dichloroacetic acid (ISO) dicoumarol (ISO) dioxygen (ISO) dorsomorphin (ISO) doxorubicin (EXP,ISO) emodin (ISO) endosulfan (EXP) entinostat (ISO) ethanol (ISO) flavonoids (EXP) flutamide (ISO) fulvestrant (ISO) genistein (EXP,ISO) glycidol (ISO) glyphosate (EXP) hydrogen peroxide (EXP,ISO) hypochlorous acid (ISO) ibuprofen (ISO) L-serine (ISO) lead diacetate (EXP) lipopolysaccharide (ISO) lithium chloride (ISO) luteolin (ISO) LY294002 (ISO) mangiferin (ISO) menadione (EXP,ISO) mercury dibromide (ISO) metformin (ISO) methotrexate (ISO) methoxychlor (EXP) methylmercury chloride (ISO) N-acetyl-L-cysteine (ISO) N-methyl-4-phenylpyridinium (ISO) naringin (ISO) nickel atom (ISO) okadaic acid (ISO) ozone (ISO) p-menthan-3-ol (ISO) panobinostat (ISO) paracetamol (EXP) paraquat (ISO) pentanal (ISO) phenylephrine (ISO) phenylmercury acetate (ISO) pifithrin-alpha hydrobromide (EXP) potassium chloride (ISO) potassium dichromate (ISO) procymidone (ISO) quercetin (EXP,ISO) quinolin-8-ol (ISO) reactive oxygen species (ISO) rotenone (EXP,ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) S-nitrosoglutathione (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (EXP,ISO) sodium dichromate (EXP) streptozocin (ISO) sulfates (ISO) sulindac sulfide (ISO) sunitinib (ISO) tamoxifen (ISO) titanium dioxide (ISO) trichostatin A (ISO) valproic acid (ISO) vinclozolin (EXP,ISO) vorinostat (ISO) zoledronic acid (ISO)
Biological Process
cellular hyperosmotic response (IEP) JNK cascade (IBA,IDA,IEA,ISO,ISS) JUN phosphorylation (IDA) locomotor rhythm (ISO,ISS) MAPK cascade (IEA) negative regulation of transcription by RNA polymerase II (IDA) neurotransmitter receptor transport to postsynaptic membrane (EXP,IDA,IMP) protein phosphorylation (IDA,ISO) regulation of circadian rhythm (ISO,ISS) response to light stimulus (ISO,ISS) rhythmic process (IEA) vesicle-mediated transport in synapse (EXP,IDA,IMP)
Cellular Component
cytoplasm (IBA,IEA,ISO,ISS) glutamatergic synapse (EXP,IDA,IEP,IMP) membrane (IEA) mitochondrion (IEA,ISO,ISS) nucleoplasm (ISO) nucleus (IBA,IEA) perikaryon (IDA) plasma membrane (ISO,ISS) postsynaptic density (ISO) postsynaptic Golgi apparatus (IDA,IEP,IMP)
1.
Parkin is transcriptionally regulated by ATF4: evidence for an interconnection between mitochondrial stress and ER stress.
Bouman L, etal., Cell Death Differ. 2011 May;18(5):769-82. doi: 10.1038/cdd.2010.142. Epub 2010 Nov 26.
2.
Stress- and cell type-dependent regulation of transfected c-Jun N-terminal kinase and mitogen-activated protein kinase kinase isoforms.
Butterfield L, etal., Biochem J. 1999 Mar 15;338 ( Pt 3):681-6.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
5.
Relationship between SP1 polymorphism and osteoporosis in beta-thalassemia major patients.
Guzeloglu-Kayisli O, etal., Pediatr Int. 2008 Aug;50(4):474-6. doi: 10.1111/j.1442-200X.2008.02609.x.
6.
The c-jun kinase/stress-activated pathway: regulation, function and role in human disease.
Johnson GL and Nakamura K, Biochim Biophys Acta. 2007 Aug;1773(8):1341-8. Epub 2007 Jan 4.
7.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
8.
Concentration-dependent positive and negative regulation of a MAP kinase by a MAP kinase kinase.
Kieran MW, etal., Oncogene. 1999 Nov 18;18(48):6647-57.
9.
The stress-activated protein kinase subfamily of c-Jun kinases.
Kyriakis JM, etal., Nature 1994 May 12;369(6476):156-60.
10.
Beta-arrestin 2: a receptor-regulated MAPK scaffold for the activation of JNK3.
McDonald PH, etal., Science. 2000 Nov 24;290(5496):1574-7.
11.
Osmotic and glutamate receptor regulation of c-Jun NH(2)-terminal protein kinase in neuroendocrine cells.
Meeker R and Fernandes A, Am J Physiol Endocrinol Metab. 2000 Sep;279(3):E475-86.
12.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
13.
JNK phosphorylates synaptotagmin-4 and enhances Ca2+-evoked release.
Mori Y, etal., EMBO J. 2008 Jan 9;27(1):76-87. Epub 2007 Nov 29.
14.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
15.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
16.
The neuroprotective effects of K252a through inhibiting MLK3/MKK7/JNK3 signaling pathway on ischemic brain injury in rat hippocampal CA1 region.
Pan J, etal., Neuroscience. 2005;131(1):147-59.
17.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
18.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
19.
GOA pipeline
RGD automated data pipeline
20.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
21.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
22.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
23.
Regulation of stress-associated scaffold proteins JIP1 and JIP3 on the c-Jun NH2-terminal kinase in ischemia-reperfusion.
Xu B, etal., Can J Physiol Pharmacol. 2010 Nov;88(11):1084-92. doi: 10.1139/y10-088.
24.
JNK3 couples the neuronal stress response to inhibition of secretory trafficking.
Yang G, etal., Sci Signal. 2013 Jul 9;6(283):ra57. doi: 10.1126/scisignal.2003727.
25.
Activation and redistribution of c-jun N-terminal kinase/stress activated protein kinase in degenerating neurons in Alzheimer's disease.
Zhu X, etal., J Neurochem. 2001 Jan;76(2):435-41.
Mapk10 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 6,802,247 - 7,094,103 (+) NCBI GRCr8 mRatBN7.2 14 6,497,662 - 6,790,109 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 6,497,707 - 6,786,201 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 6,475,683 - 6,751,915 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 7,775,937 - 8,052,130 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 6,467,375 - 6,743,050 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 8,079,955 - 8,371,508 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 8,080,275 - 8,368,254 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 8,053,697 - 8,344,225 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 7,719,595 - 8,010,694 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 7,719,594 - 8,010,694 (+) NCBI Celera 14 6,636,411 - 6,919,118 (+) NCBI Celera Cytogenetic Map 14 p22 NCBI
MAPK10 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 86,010,405 - 86,594,074 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 85,990,007 - 86,594,625 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 86,931,558 - 87,374,348 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 87,156,656 - 87,593,307 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 4 87,294,810 - 87,632,922 NCBI Celera 4 84,225,414 - 84,570,629 (-) NCBI Celera Cytogenetic Map 4 q21.3 NCBI HuRef 4 82,680,152 - 83,118,708 (-) NCBI HuRef CHM1_1 4 86,912,970 - 87,350,773 (-) NCBI CHM1_1 T2T-CHM13v2.0 4 89,339,877 - 89,923,587 (-) NCBI T2T-CHM13v2.0
Mapk10 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 103,056,413 - 103,359,200 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 103,055,814 - 103,359,200 (-) Ensembl GRCm39 Ensembl GRCm38 5 102,908,547 - 103,212,604 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 102,907,948 - 103,211,334 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 103,336,967 - 103,640,353 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 103,152,671 - 103,451,379 (-) NCBI MGSCv36 mm8 Celera 5 100,221,882 - 100,523,871 (-) NCBI Celera Cytogenetic Map 5 E5 NCBI cM Map 5 49.61 NCBI
Mapk10 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955474 3,624,679 - 3,772,458 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955474 3,451,656 - 3,772,405 (+) NCBI ChiLan1.0 ChiLan1.0
MAPK10 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 84,040,153 - 84,470,878 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 84,304,836 - 84,732,991 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 78,326,129 - 78,756,794 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 89,056,754 - 89,392,980 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 89,059,579 - 89,392,196 (-) Ensembl panpan1.1 panPan2
MAPK10 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 32 9,584,437 - 9,889,118 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 32 9,575,492 - 9,884,325 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 32 32,059,481 - 32,299,296 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 32 9,607,730 - 9,912,898 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 32 9,597,455 - 9,907,345 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 32 9,698,411 - 10,025,887 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 32 9,545,360 - 9,851,058 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 32 30,098,318 - 30,403,778 (+) NCBI UU_Cfam_GSD_1.0
Mapk10
MAPK10 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 8 132,298,299 - 132,776,820 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 8 132,445,818 - 132,751,575 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 8 141,972,691 - 142,138,440 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MAPK10 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 7 34,394,600 - 34,725,658 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 7 34,399,544 - 34,564,212 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 13,051,033 - 13,392,105 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Mapk10
.
Predicted Target Of
Count of predictions: 93 Count of miRNA genes: 71 Interacting mature miRNAs: 85 Transcripts: ENSRNOT00000065965 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1300114 Srn2 Serum renin concentration QTL 2 3.27 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 14 3813074 21217635 Rat 70195 Mcs8 Mammary carcinoma susceptibility QTL 8 4.28 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 14 3813074 24531477 Rat 2293089 Iddm31 Insulin dependent diabetes mellitus QTL 31 4.7 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 14 3813074 18274691 Rat 2300183 Bmd60 Bone mineral density QTL 60 5.7 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 14 1 26541967 Rat 724541 Niddm53 Non-insulin dependent diabetes mellitus QTL 53 0.001 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 14 3813074 9088978 Rat 1331740 Bw26 Body weight QTL 26 3.028 body mass (VT:0001259) body weight (CMO:0000012) 14 3813074 30767156 Rat 634352 Apr6 Acute phase response QTL 6 3.7 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 14 1 41131407 Rat 619619 Rf4 Renal disease susceptibility QTL 4 4.1 0.002 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 14 1 32754612 Rat 71115 Niddm15 Non-insulin dependent diabetes mellitus QTL 15 4.8 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 14 1217606 11030812 Rat 2300159 Bmd61 Bone mineral density QTL 61 5.3 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 14 1 26541967 Rat 70204 Niddm20 Non-insulin dependent diabetes mellitus QTL 20 5.1 0.000008 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 14 1217606 16960180 Rat
BE120200
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 6,538,806 - 6,538,980 (+) MAPPER mRatBN7.2 Rnor_6.0 14 8,121,221 - 8,121,394 NCBI Rnor6.0 Rnor_6.0 14 7,465,940 - 7,466,113 NCBI Rnor6.0 Rnor_5.0 14 8,094,676 - 8,094,849 UniSTS Rnor5.0 Rnor_5.0 14 7,450,356 - 7,450,529 UniSTS Rnor5.0 RGSC_v3.4 14 7,760,400 - 7,760,573 UniSTS RGSC3.4 Celera 14 6,677,520 - 6,677,693 UniSTS RH 3.4 Map 14 133.28 UniSTS Cytogenetic Map 14 p22 UniSTS
RH131900
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 6,785,470 - 6,785,655 (+) MAPPER mRatBN7.2 Rnor_6.0 14 8,368,052 - 8,368,236 NCBI Rnor6.0 Rnor_5.0 14 8,340,189 - 8,340,373 UniSTS Rnor5.0 RGSC_v3.4 14 8,010,975 - 8,011,159 UniSTS RGSC3.4 Celera 14 6,918,916 - 6,919,100 UniSTS RH 3.4 Map 14 130.59 UniSTS Cytogenetic Map 14 p22 UniSTS
BF393702
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 6,710,741 - 6,710,832 (+) MAPPER mRatBN7.2 Rnor_6.0 14 8,293,323 - 8,293,413 NCBI Rnor6.0 Rnor_5.0 14 8,265,195 - 8,265,285 UniSTS Rnor5.0 RGSC_v3.4 14 7,936,231 - 7,936,321 UniSTS RGSC3.4 Celera 14 6,846,313 - 6,846,403 UniSTS RH 3.4 Map 14 132.6 UniSTS Cytogenetic Map 14 p22 UniSTS
RH137759
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 6,768,920 - 6,769,119 (+) MAPPER mRatBN7.2 Rnor_6.0 14 8,351,502 - 8,351,700 NCBI Rnor6.0 Rnor_5.0 14 8,323,639 - 8,323,837 UniSTS Rnor5.0 RGSC_v3.4 14 7,994,425 - 7,994,623 UniSTS RGSC3.4 Celera 14 6,902,367 - 6,902,565 UniSTS RH 3.4 Map 14 152.09 UniSTS Cytogenetic Map 14 p22 UniSTS
RH139507
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 6,778,328 - 6,778,547 (+) MAPPER mRatBN7.2 Rnor_6.0 14 8,360,910 - 8,361,128 NCBI Rnor6.0 Rnor_5.0 14 8,333,047 - 8,333,265 UniSTS Rnor5.0 RGSC_v3.4 14 8,003,833 - 8,004,051 UniSTS RGSC3.4 Celera 14 6,911,774 - 6,911,992 UniSTS RH 3.4 Map 14 129.79 UniSTS Cytogenetic Map 14 p22 UniSTS
RH140337
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 6,778,318 - 6,778,555 (+) MAPPER mRatBN7.2 Rnor_6.0 14 8,360,900 - 8,361,136 NCBI Rnor6.0 Rnor_5.0 14 8,333,037 - 8,333,273 UniSTS Rnor5.0 RGSC_v3.4 14 8,003,823 - 8,004,059 UniSTS RGSC3.4 Celera 14 6,911,764 - 6,912,000 UniSTS Cytogenetic Map 14 p22 UniSTS
UniSTS:532281
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 6,784,818 - 6,785,639 (+) MAPPER mRatBN7.2 Rnor_6.0 14 8,367,400 - 8,368,220 NCBI Rnor6.0 Rnor_5.0 14 8,339,537 - 8,340,357 UniSTS Rnor5.0 Celera 14 6,918,264 - 6,919,084 UniSTS Cytogenetic Map 14 p22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
48
113
91
90
59
25
59
6
217
96
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000065965 ⟹ ENSRNOP00000060904
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 6,497,707 - 6,785,672 (+) Ensembl Rnor_6.0 Ensembl 14 8,080,275 - 8,368,254 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000092395 ⟹ ENSRNOP00000075846
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 6,497,707 - 6,785,672 (+) Ensembl Rnor_6.0 Ensembl 14 8,080,565 - 8,367,771 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000092466 ⟹ ENSRNOP00000075814
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 6,640,799 - 6,711,653 (+) Ensembl Rnor_6.0 Ensembl 14 8,223,474 - 8,294,234 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000092542 ⟹ ENSRNOP00000075797
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 6,497,707 - 6,777,244 (+) Ensembl Rnor_6.0 Ensembl 14 8,080,277 - 8,359,963 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000092719 ⟹ ENSRNOP00000075755
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 6,497,707 - 6,786,201 (+) Ensembl Rnor_6.0 Ensembl 14 8,182,383 - 8,367,519 (+) Ensembl
RefSeq Acc Id:
NM_001270556 ⟹ NP_001257485
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 6,802,294 - 7,090,249 (+) NCBI mRatBN7.2 14 6,497,707 - 6,785,673 (+) NCBI Rnor_6.0 14 8,080,274 - 8,368,254 (+) NCBI Rnor_5.0 14 8,053,697 - 8,344,225 (+) NCBI Celera 14 6,636,411 - 6,919,118 (+) NCBI
Sequence:
CACAATGGTACAGGCAGCCTCCCGCTGCACAATGGTTTCCAGGCAGTGAGAGGGTGATTCAGCAAGCCGCTCTCTCTTCTCTTAAGCCTCCTCGTCTCCGTTTATTTTTATGGGGGTGGGTGGTGCTT
hide sequence
RefSeq Acc Id:
NM_001318190 ⟹ NP_001305119
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 6,802,294 - 7,090,249 (+) NCBI mRatBN7.2 14 6,497,707 - 6,785,673 (+) NCBI Rnor_6.0 14 8,080,274 - 8,368,254 (+) NCBI Celera 14 6,636,411 - 6,919,118 (+) NCBI
Sequence:
CACAATGGTACAGGCAGCCTCCCGCTGCACAATGGTTTCCAGGCAGTGAGAGGGTGATTCAGCAAGCCGCTCTCTCTTCTCTTAAGCCTCCTCGTCTCCGTTTATTTTTATGGGGGTGGGTGGTGCTT
hide sequence
RefSeq Acc Id:
NM_012806 ⟹ NP_036938
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 6,802,294 - 7,090,249 (+) NCBI mRatBN7.2 14 6,497,707 - 6,785,673 (+) NCBI Rnor_6.0 14 8,080,274 - 8,368,254 (+) NCBI Rnor_5.0 14 8,053,697 - 8,344,225 (+) NCBI RGSC_v3.4 14 7,719,595 - 8,010,694 (+) RGD Celera 14 6,636,411 - 6,919,118 (+) NCBI
Sequence:
CACAATGGTACAGGCAGCCTCCCGCTGCACAATGGTTTCCAGGCAGTGAGAGGGTGATTCAGCAAGCCGCTCTCTCTTCTCTTAAGCCTCCTCGTCTCCGTTTATTTTTATGGGGGTGGGTGGTGCTT
hide sequence
RefSeq Acc Id:
XM_017599083 ⟹ XP_017454572
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 6,802,250 - 7,094,103 (+) NCBI mRatBN7.2 14 6,497,664 - 6,790,109 (+) NCBI Rnor_6.0 14 8,080,148 - 8,371,508 (+) NCBI
Sequence:
CCTTTTTCTCTTTCCTCCTCCTACCCCTCCCTAGACCTCTCTGGGCTTTGACGTCATGTGTGCTCCTTTCAGTTGCCATAGCAACCCCATTCCCCAAGCCCTCTGTCCGTCTCCTCTGGTAGGCTCCA
hide sequence
RefSeq Acc Id:
XM_017599084 ⟹ XP_017454573
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 6,802,250 - 7,094,103 (+) NCBI mRatBN7.2 14 6,497,662 - 6,790,109 (+) NCBI Rnor_6.0 14 8,080,147 - 8,371,508 (+) NCBI
Sequence:
TCCTTTTTCTCTTTCCTCCTCCTACCCCTCCCTAGACCTCTCTGGGCTTTGACGTCATGTGTGC
hide sequence
RefSeq Acc Id:
XM_063272866 ⟹ XP_063128936
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 6,807,246 - 7,094,103 (+) NCBI
RefSeq Acc Id:
XM_063272867 ⟹ XP_063128937
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 6,802,247 - 7,094,103 (+) NCBI
RefSeq Acc Id:
NP_036938 ⟸ NM_012806
- Peptide Label:
isoform 2
- UniProtKB:
A0A8L2RB61 (UniProtKB/TrEMBL)
- Sequence:
MSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERM
hide sequence
RefSeq Acc Id:
NP_001257485 ⟸ NM_001270556
- Peptide Label:
isoform 1
- UniProtKB:
P49187 (UniProtKB/Swiss-Prot), D3ZQ33 (UniProtKB/Swiss-Prot), B0VXR6 (UniProtKB/Swiss-Prot), A6K5V7 (UniProtKB/TrEMBL)
- Sequence:
MSLHFLYYCSEPTLDVKIAFCQGFDKHVDVSSVAKHYNMSKSKVDNQFYSVEVGDSTFTVLKRY
hide sequence
RefSeq Acc Id:
NP_001305119 ⟸ NM_001318190
- Peptide Label:
isoform 1x
- UniProtKB:
P49187 (UniProtKB/Swiss-Prot), D3ZQ33 (UniProtKB/Swiss-Prot), B0VXR6 (UniProtKB/Swiss-Prot)
- Sequence:
MSLHFLYYCSEPTLDVKIAFCQGFDKHVDVSSVAKHYNMSKSKVDNQFYSVEVGDSTFTVLKRY
hide sequence
RefSeq Acc Id:
XP_017454573 ⟸ XM_017599084
- Peptide Label:
isoform X2
- UniProtKB:
A0A0U1RRS7 (UniProtKB/TrEMBL)
- Sequence:
MSLHFLYYCSEPTLDVKIAFCQGFDKHVDVSSVAKHYNMSKSKVDNQFYSVEVGDSTFTVLKRY
hide sequence
RefSeq Acc Id:
XP_017454572 ⟸ XM_017599083
- Peptide Label:
isoform X1
- UniProtKB:
A0A8L2RB61 (UniProtKB/TrEMBL)
- Sequence:
MSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERM
hide sequence
Ensembl Acc Id:
ENSRNOP00000075846 ⟸ ENSRNOT00000092395
Ensembl Acc Id:
ENSRNOP00000075755 ⟸ ENSRNOT00000092719
Ensembl Acc Id:
ENSRNOP00000075797 ⟸ ENSRNOT00000092542
Ensembl Acc Id:
ENSRNOP00000075814 ⟸ ENSRNOT00000092466
Ensembl Acc Id:
ENSRNOP00000060904 ⟸ ENSRNOT00000065965
RefSeq Acc Id:
XP_063128937 ⟸ XM_063272867
- Peptide Label:
isoform X3
- UniProtKB:
P49187 (UniProtKB/Swiss-Prot), D3ZQ33 (UniProtKB/Swiss-Prot), B0VXR6 (UniProtKB/Swiss-Prot), A0A0U1RVI2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063128936 ⟸ XM_063272866
- Peptide Label:
isoform X2
- UniProtKB:
A0A0U1RRS7 (UniProtKB/TrEMBL)
RGD ID: 13699182 Promoter ID: EPDNEW_R9707 Type: multiple initiation site Name: Mapk10_2 Description: mitogen activated protein kinase 10 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R9708 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 14 8,080,275 - 8,080,335 EPDNEW
RGD ID: 13699187 Promoter ID: EPDNEW_R9708 Type: single initiation site Name: Mapk10_1 Description: mitogen activated protein kinase 10 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R9707 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 14 8,182,316 - 8,182,376 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2003-04-09
Mapk10
mitogen activated protein kinase 10
Serk2
Stress activated protein kinase beta
Symbol and Name updated
629477 APPROVED
2002-06-10
Serk2
Stress activated protein kinase beta
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_regulation
activated by cellular stress, sphingomyelinase and tumour necrosis factor (TNF)-alpha
729029
