Symbol:
Raf1
Name:
Raf-1 proto-oncogene, serine/threonine kinase
RGD ID:
3531
Description:
Enables several functions, including ATP binding activity; adenylate cyclase activator activity; and enzyme binding activity. Involved in several processes, including MAPK cascade; protein phosphorylation; and response to hypoxia. Located in cytoplasm and plasma membrane. Biomarker of pancreatic carcinoma. Human ortholog(s) of this gene implicated in Noonan syndrome (multiple); Noonan syndrome with multiple lentigines 2; adenocarcinoma (multiple); and dilated cardiomyopathy 1NN. Orthologous to human RAF1 (Raf-1 proto-oncogene, serine/threonine kinase); PARTICIPATES IN the extracellular signal-regulated Raf/Mek/Erk signaling pathway; altered extracellular signal-regulated Raf/Mek/Erk signaling pathway; ceramide signaling pathway; INTERACTS WITH 1,2-dimethylhydrazine; 1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile; 17beta-estradiol 3-benzoate.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
C-RAF; cRaf; Murine leukemia viral (v-raf-1) oncogene homolog 1 (3611-MSV); proto-oncogene c-RAF; RAF proto-oncogene serine/threonine-protein kinase; raf-1; v-raf-1 murine leukemia viral oncogene homolog 1; v-raf-leukemia viral oncogene 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
RAF1 (Raf-1 proto-oncogene, serine/threonine kinase) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther
Mus musculus (house mouse):
Raf1 (v-raf-leukemia viral oncogene 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Raf1 (Raf-1 proto-oncogene, serine/threonine kinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
RAF1 (Raf-1 proto-oncogene, serine/threonine kinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
RAF1 (Raf-1 proto-oncogene, serine/threonine kinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Raf1 (Raf-1 proto-oncogene, serine/threonine kinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
RAF1 (Raf-1 proto-oncogene, serine/threonine kinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
RAF1 (Raf-1 proto-oncogene, serine/threonine kinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Raf1 (Raf-1 proto-oncogene, serine/threonine kinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Raf1 (v-raf-leukemia viral oncogene 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
RAF1 (Raf-1 proto-oncogene, serine/threonine kinase)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
raf1b (Raf-1 proto-oncogene, serine/threonine kinase b)
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
raf1a (Raf-1 proto-oncogene, serine/threonine kinase a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|OrthoFinder|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
Raf
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
lin-45
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
raf1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 150,352,158 - 150,412,813 (-) NCBI GRCr8 mRatBN7.2 4 148,679,534 - 148,740,265 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 148,679,530 - 148,740,317 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 154,903,973 - 154,964,738 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 150,687,056 - 150,747,821 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 149,310,879 - 149,371,650 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 147,532,040 - 147,592,769 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 147,532,042 - 147,592,699 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 210,819,148 - 210,878,226 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 151,752,583 - 151,775,609 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 151,997,425 - 152,020,450 (-) NCBI Celera 4 137,570,499 - 137,631,125 (-) NCBI Celera Cytogenetic Map 4 q42 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Raf1 Rat (1->4)-beta-D-glucan multiple interactions ISO Raf1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of RAF1 mRNA CTD PMID:36331819 Raf1 Rat (20R)-protopanaxadiol increases phosphorylation ISO RAF1 (Homo sapiens) 6480464 protopanaxadiol results in increased phosphorylation of RAF1 protein CTD PMID:31805304 Raf1 Rat (S)-(-)-perillyl alcohol multiple interactions ISO Raf1 (Mus musculus) 6480464 perillyl alcohol inhibits the reaction [Tetradecanoylphorbol Acetate results in increased expression of RAF1 protein] CTD PMID:19161993 Raf1 Rat (S)-nicotine increases activity ISO RAF1 (Homo sapiens) 6480464 Nicotine results in increased activity of RAF1 protein CTD PMID:17459420 Raf1 Rat (S)-nicotine affects localization ISO Raf1 (Mus musculus) 6480464 Nicotine affects the localization of RAF1 protein CTD PMID:15574422 Raf1 Rat (S)-nicotine multiple interactions ISO RAF1 (Homo sapiens) 6480464 Aconitine analog inhibits the reaction [Nicotine promotes the reaction [RB1 protein binds to RAF1 protein]] more ... CTD PMID:16862215 Raf1 Rat 1,2-dimethylhydrazine decreases expression EXP 6480464 1 and 2-Dimethylhydrazine results in decreased expression of RAF1 mRNA CTD PMID:32387197 Raf1 Rat 1,2-dimethylhydrazine multiple interactions ISO Raf1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of RAF1 mRNA CTD PMID:22206623 Raf1 Rat 1,2-dimethylhydrazine affects expression ISO Raf1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine affects the expression of RAF1 mRNA CTD PMID:22206623 Raf1 Rat 1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile increases expression EXP 6480464 Citalopram results in increased expression of RAF1 mRNA CTD PMID:28467792 Raf1 Rat 15-deoxy-Delta(12,14)-prostaglandin J2 multiple interactions ISO Raf1 (Mus musculus) 6480464 15-deoxy-delta(12 and 14)-prostaglandin J2 results in increased activity of and results in decreased phosphorylation of RAF1 protein CTD PMID:12083801 Raf1 Rat 17beta-estradiol increases activity ISO RAF1 (Homo sapiens) 6480464 Estradiol results in increased activity of RAF1 protein CTD PMID:12432273 Raf1 Rat 17beta-estradiol increases expression ISO Raf1 (Mus musculus) 6480464 Estradiol results in increased expression of RAF1 mRNA CTD PMID:39298647 Raf1 Rat 17beta-estradiol increases phosphorylation ISO RAF1 (Homo sapiens) 6480464 Estradiol results in increased phosphorylation of RAF1 protein CTD PMID:15930183 and PMID:27026707 Raf1 Rat 17beta-estradiol decreases expression ISO RAF1 (Homo sapiens) 6480464 Estradiol results in decreased expression of RAF1 mRNA CTD PMID:16029874 Raf1 Rat 17beta-estradiol 3-benzoate decreases phosphorylation EXP 6480464 estradiol 3-benzoate results in decreased phosphorylation of RAF1 protein CTD PMID:15778002 Raf1 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO RAF1 (Homo sapiens) 6480464 2 more ... CTD PMID:20840854 Raf1 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO RAF1 (Homo sapiens) 6480464 2 more ... CTD PMID:26988655 Raf1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects localization ISO Raf1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the localization of RAF1 protein CTD PMID:19555203 Raf1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of RAF1 mRNA CTD PMID:18708364 and PMID:34747641 Raf1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 AHR protein promotes the reaction [Tetrachlorodibenzodioxin results in increased expression of RAF1 mRNA] CTD PMID:18708364 Raf1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Raf1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of RAF1 mRNA CTD PMID:19465110 Raf1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Raf1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin promotes the reaction [Dimethylnitrosamine results in increased expression of RAF1 protein] CTD PMID:11884234 and PMID:19555203 Raf1 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of RAF1 mRNA CTD PMID:21346803 Raf1 Rat 2-deoxy-D-glucose multiple interactions EXP 6480464 RAF1 protein affects the reaction [AICA ribonucleotide results in increased uptake of Deoxyglucose] CTD PMID:11978788 Raf1 Rat 3,3',4,4',5-pentachlorobiphenyl multiple interactions ISO RAF1 (Homo sapiens) 6480464 3 more ... CTD PMID:20840854 Raf1 Rat 3,3',4,4'-tetrachlorobiphenyl multiple interactions ISO RAF1 (Homo sapiens) 6480464 3 more ... CTD PMID:18708364 Raf1 Rat 3,3',4,4'-tetrachlorobiphenyl multiple interactions EXP 6480464 3 more ... CTD PMID:18708364 Raf1 Rat 3,3',4,4'-tetrachlorobiphenyl increases expression EXP 6480464 3 more ... CTD PMID:18708364 Raf1 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Raf1 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of RAF1 mRNA CTD PMID:20188158 Raf1 Rat 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione multiple interactions ISO Raf1 (Mus musculus) 6480464 bisindolylmaleimide I inhibits the reaction [cypermethrin results in increased phosphorylation of RAF1 protein] and bisindolylmaleimide I inhibits the reaction [Tetradecanoylphorbol Acetate results in increased activity of RAF1 protein] CTD PMID:14623285 and PMID:29149324 Raf1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions EXP 6480464 [FSHB protein co-treated with 1-Methyl-3-isobutylxanthine] inhibits the reaction [Testosterone promotes the reaction [RAF1 results in increased phosphorylation of MAP2K1 protein]] and [FSHB protein co-treated with 1-Methyl-3-isobutylxanthine] inhibits the reaction [Testosterone results in increased phosphorylation of and results in increased activity of RAF1 protein] CTD PMID:21177760 Raf1 Rat 4,4'-diaminodiphenylmethane affects expression ISO Raf1 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane affects the expression of RAF1 mRNA CTD PMID:18648102 Raf1 Rat 4,4'-sulfonyldiphenol increases expression ISO Raf1 (Mus musculus) 6480464 bisphenol S results in increased expression of RAF1 mRNA CTD PMID:38908815 Raf1 Rat 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one increases activity ISO RAF1 (Homo sapiens) 6480464 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone results in increased activity of RAF1 protein CTD PMID:17459420 Raf1 Rat 4-amino-2,6-dinitrotoluene affects expression EXP 6480464 4-amino-2 and 6-dinitrotoluene affects the expression of RAF1 mRNA CTD PMID:21346803 Raf1 Rat 4-hydroxynon-2-enal increases expression ISO Raf1 (Mus musculus) 6480464 4-hydroxy-2-nonenal results in increased expression of RAF1 mRNA CTD PMID:19191707 Raf1 Rat 5-fluorouracil increases expression ISO RAF1 (Homo sapiens) 6480464 Fluorouracil results in increased expression of RAF1 mRNA CTD PMID:15152939 Raf1 Rat 5-fluorouracil decreases expression ISO Raf1 (Mus musculus) 6480464 Fluorouracil results in decreased expression of RAF1 protein CTD PMID:21296659 Raf1 Rat 7,12-dimethyltetraphene multiple interactions ISO Raf1 (Mus musculus) 6480464 [Tetradecanoylphorbol Acetate co-treated with 9 more ... CTD PMID:22760862 Raf1 Rat acetylsalicylic acid decreases expression ISO RAF1 (Homo sapiens) 6480464 Aspirin results in decreased expression of RAF1 mRNA CTD PMID:20457246 Raf1 Rat aconitine multiple interactions ISO RAF1 (Homo sapiens) 6480464 Aconitine analog inhibits the reaction [Nicotine promotes the reaction [RB1 protein binds to RAF1 protein]] CTD PMID:16862215 Raf1 Rat acrylamide increases expression ISO Raf1 (Mus musculus) 6480464 Acrylamide results in increased expression of RAF1 mRNA CTD PMID:30807115 Raf1 Rat actinomycin D decreases expression EXP 6480464 Dactinomycin results in decreased expression of RAF1 protein CTD PMID:15959627 Raf1 Rat afimoxifene decreases response to substance ISO RAF1 (Homo sapiens) 6480464 RAF1 results in decreased susceptibility to afimoxifene CTD PMID:21233418 Raf1 Rat AICA ribonucleotide multiple interactions EXP 6480464 RAF1 protein affects the reaction [AICA ribonucleotide results in increased uptake of Deoxyglucose] CTD PMID:11978788 Raf1 Rat aldehydo-D-glucose multiple interactions ISO RAF1 (Homo sapiens) 6480464 MIR1231 inhibits the reaction [Glucose results in increased phosphorylation of RAF1 protein] and Resveratrol inhibits the reaction [Glucose results in increased phosphorylation of RAF1 protein] CTD PMID:38156429 Raf1 Rat aldehydo-D-glucose increases phosphorylation ISO RAF1 (Homo sapiens) 6480464 Glucose results in increased phosphorylation of RAF1 protein CTD PMID:38156429 Raf1 Rat all-trans-retinoic acid increases phosphorylation ISO RAF1 (Homo sapiens) 6480464 Tretinoin results in increased phosphorylation of RAF1 protein CTD PMID:19038232 Raf1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of RAF1 mRNA CTD PMID:16483693 Raf1 Rat ammonium chloride increases expression EXP 6480464 Ammonium Chloride results in increased expression of RAF1 protein CTD PMID:16483693 Raf1 Rat andrographolide multiple interactions ISO RAF1 (Homo sapiens) 6480464 andrographolide inhibits the reaction [VEGFA protein results in increased phosphorylation of RAF1 protein] CTD PMID:24814888 Raf1 Rat Aroclor 1254 increases expression ISO RAF1 (Homo sapiens) 6480464 Chlorodiphenyl (54% Chlorine) results in increased expression of RAF1 mRNA and Chlorodiphenyl (54% Chlorine) results in increased expression of RAF1 protein CTD PMID:18708364 Raf1 Rat Aroclor 1254 multiple interactions EXP 6480464 Chlorodiphenyl (54% Chlorine) promotes the reaction [[AHR protein binds to ARNT protein] which binds to RAF1 promoter] CTD PMID:18708364 Raf1 Rat Aroclor 1254 increases expression EXP 6480464 Chlorodiphenyl (54% Chlorine) results in increased expression of RAF1 mRNA and Chlorodiphenyl (54% Chlorine) results in increased expression of RAF1 protein CTD PMID:18708364 and PMID:8471063 Raf1 Rat arsane multiple interactions ISO Raf1 (Mus musculus) 6480464 Arsenic inhibits the reaction [[NR3C1 protein binds to RAF1 promoter] which results in increased expression of RAF1 mRNA] more ... CTD PMID:21784148 Raf1 Rat arsenic atom multiple interactions ISO Raf1 (Mus musculus) 6480464 Arsenic inhibits the reaction [[NR3C1 protein binds to RAF1 promoter] which results in increased expression of RAF1 mRNA] more ... CTD PMID:21784148 Raf1 Rat arsenous acid increases expression ISO RAF1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of RAF1 mRNA CTD PMID:20458559 Raf1 Rat arsenous acid multiple interactions EXP 6480464 Phloretin inhibits the reaction [Arsenic Trioxide results in decreased expression of RAF1 mRNA] CTD PMID:34037972 Raf1 Rat arsenous acid decreases expression EXP 6480464 Arsenic Trioxide results in decreased expression of RAF1 mRNA CTD PMID:34037972 Raf1 Rat arsenous acid multiple interactions ISO RAF1 (Homo sapiens) 6480464 [Arsenic Trioxide co-treated with PD 173074] results in decreased expression of RAF1 protein more ... CTD PMID:27794399 Raf1 Rat atrazine decreases expression ISO RAF1 (Homo sapiens) 6480464 Atrazine results in decreased expression of RAF1 mRNA CTD PMID:22378314 Raf1 Rat benzo[a]pyrene multiple interactions ISO RAF1 (Homo sapiens) 6480464 2 more ... CTD PMID:20840854 Raf1 Rat benzo[a]pyrene affects methylation ISO RAF1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of RAF1 promoter CTD PMID:27901495 Raf1 Rat benzo[a]pyrene diol epoxide I decreases expression ISO RAF1 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Raf1 Rat benzo[e]pyrene decreases methylation ISO RAF1 (Homo sapiens) 6480464 benzo(e)pyrene results in decreased methylation of RAF1 intron CTD PMID:30157460 Raf1 Rat bis(2-chloroethyl) sulfide multiple interactions ISO Raf1 (Mus musculus) 6480464 Mustard Gas results in increased phosphorylation of and results in increased activity of RAF1 protein CTD PMID:18200059 Raf1 Rat bisdemethoxycurcumin decreases expression ISO RAF1 (Homo sapiens) 6480464 bisdemethoxycurcumin results in decreased expression of RAF1 protein modified form CTD PMID:35735092 Raf1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of RAF1 mRNA and bisphenol A results in increased expression of RAF1 protein CTD PMID:20219716 more ... Raf1 Rat bisphenol A increases expression ISO Raf1 (Mus musculus) 6480464 bisphenol A results in increased expression of RAF1 mRNA CTD PMID:33221593 Raf1 Rat bortezomib multiple interactions ISO RAF1 (Homo sapiens) 6480464 [Bortezomib co-treated with Butyrates] results in decreased expression of RAF1 protein more ... CTD PMID:12893773 and PMID:18445700 Raf1 Rat bortezomib decreases expression ISO RAF1 (Homo sapiens) 6480464 Bortezomib results in decreased expression of RAF1 protein CTD PMID:18445700 Raf1 Rat cadmium atom increases expression ISO RAF1 (Homo sapiens) 6480464 Cadmium results in increased expression of RAF1 protein CTD PMID:14499349 Raf1 Rat cadmium atom multiple interactions ISO RAF1 (Homo sapiens) 6480464 GPER1 mutant form inhibits the reaction [Cadmium results in increased activity of RAF1 protein] CTD PMID:20153348 Raf1 Rat cadmium atom increases activity ISO RAF1 (Homo sapiens) 6480464 Cadmium results in increased activity of RAF1 protein CTD PMID:20153348 Raf1 Rat cadmium dichloride decreases phosphorylation ISO Raf1 (Mus musculus) 6480464 Cadmium Chloride results in decreased phosphorylation of RAF1 protein CTD PMID:25744307 Raf1 Rat cadmium dichloride increases expression ISO RAF1 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of RAF1 mRNA and Cadmium Chloride results in increased expression of RAF1 protein modified form CTD PMID:32512071 and PMID:33129824 Raf1 Rat cadmium dichloride decreases phosphorylation ISO RAF1 (Homo sapiens) 6480464 Cadmium Chloride results in decreased phosphorylation of RAF1 protein CTD PMID:25744307 Raf1 Rat caffeine affects phosphorylation ISO RAF1 (Homo sapiens) 6480464 Caffeine affects the phosphorylation of RAF1 protein CTD PMID:35688186 Raf1 Rat calciol multiple interactions ISO RAF1 (Homo sapiens) 6480464 RAF1 mutant form inhibits the reaction [Cholecalciferol results in increased expression of CD14 protein] and RAF1 mutant form inhibits the reaction [Cholecalciferol results in increased expression of RB1 protein] CTD PMID:18628207 Raf1 Rat calciol increases response to substance ISO RAF1 (Homo sapiens) 6480464 RAF1 results in increased susceptibility to Cholecalciferol CTD PMID:18628207 Raf1 Rat cannabidiol decreases expression ISO RAF1 (Homo sapiens) 6480464 Cannabidiol results in decreased expression of RAF1 mRNA CTD PMID:32992648 Raf1 Rat cannabidiol multiple interactions ISO RAF1 (Homo sapiens) 6480464 [Oxygen co-treated with Ozone co-treated with Cannabidiol] results in decreased expression of RAF1 mRNA CTD PMID:32992648 Raf1 Rat carbon nanotube increases expression ISO Raf1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25620056 Raf1 Rat chaetoglobosin A decreases phosphorylation EXP 6480464 chaetoglobosins results in decreased phosphorylation of RAF1 protein CTD PMID:18040759 Raf1 Rat choline increases expression ISO Raf1 (Mus musculus) 6480464 Choline results in increased expression of RAF1 mRNA CTD PMID:27664006 Raf1 Rat ciglitazone increases activity ISO Raf1 (Mus musculus) 6480464 ciglitazone results in increased activity of RAF1 protein CTD PMID:12083801 Raf1 Rat cis-caffeic acid multiple interactions ISO Raf1 (Mus musculus) 6480464 caffeic acid inhibits the reaction [Acetaminophen results in increased phosphorylation of RAF1 protein] CTD PMID:27720869 Raf1 Rat cis-caffeic acid multiple interactions ISO RAF1 (Homo sapiens) 6480464 caffeic acid inhibits the reaction [Acetaminophen results in increased phosphorylation of RAF1 protein] CTD PMID:27720869 Raf1 Rat cisplatin decreases response to substance ISO RAF1 (Homo sapiens) 6480464 RAF1 results in decreased susceptibility to Cisplatin CTD PMID:21849418 Raf1 Rat cisplatin decreases expression ISO Raf1 (Mus musculus) 6480464 Cisplatin results in decreased expression of RAF1 mRNA CTD PMID:26546572 Raf1 Rat citalopram increases expression EXP 6480464 Citalopram results in increased expression of RAF1 mRNA CTD PMID:28467792 Raf1 Rat clofibrate decreases expression ISO Raf1 (Mus musculus) 6480464 Clofibrate results in decreased expression of RAF1 mRNA CTD PMID:23811191 Raf1 Rat cocaine multiple interactions EXP 6480464 [[Cocaine results in increased expression of MIR212 mRNA] which results in increased activity of RAF1 protein] which results in increased expression of CRTC1 protein and [Cocaine results in increased expression of MIR212 mRNA] which results in increased activity of RAF1 protein CTD PMID:20613834 Raf1 Rat copper atom multiple interactions ISO RAF1 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of RAF1 mRNA and [Thiosemicarbazones binds to Copper] which results in increased expression of RAF1 protein CTD PMID:20931265 and PMID:30911355 Raf1 Rat copper(0) multiple interactions ISO RAF1 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of RAF1 mRNA and [Thiosemicarbazones binds to Copper] which results in increased expression of RAF1 protein CTD PMID:20931265 and PMID:30911355 Raf1 Rat coumarin affects phosphorylation ISO RAF1 (Homo sapiens) 6480464 coumarin affects the phosphorylation of RAF1 protein CTD PMID:35688186 Raf1 Rat crocidolite asbestos decreases phosphorylation ISO RAF1 (Homo sapiens) 6480464 Asbestos and Crocidolite results in decreased phosphorylation of RAF1 protein CTD PMID:17191120 Raf1 Rat Cruentaren A decreases expression ISO RAF1 (Homo sapiens) 6480464 cruentaren A results in decreased expression of RAF1 protein CTD PMID:24450340 Raf1 Rat curcumin increases activity ISO Raf1 (Mus musculus) 6480464 Curcumin results in increased activity of RAF1 protein CTD PMID:19501152 Raf1 Rat curcumin multiple interactions ISO Raf1 (Mus musculus) 6480464 piperlongumine inhibits the reaction [Curcumin results in increased activity of RAF1 protein] CTD PMID:19501152 Raf1 Rat cypermethrin multiple interactions ISO Raf1 (Mus musculus) 6480464 1 more ... CTD PMID:14623285 and PMID:29149324 Raf1 Rat D-glucose increases phosphorylation ISO RAF1 (Homo sapiens) 6480464 Glucose results in increased phosphorylation of RAF1 protein CTD PMID:38156429 Raf1 Rat D-glucose multiple interactions ISO RAF1 (Homo sapiens) 6480464 MIR1231 inhibits the reaction [Glucose results in increased phosphorylation of RAF1 protein] and Resveratrol inhibits the reaction [Glucose results in increased phosphorylation of RAF1 protein] CTD PMID:38156429 Raf1 Rat dabrafenib multiple interactions ISO RAF1 (Homo sapiens) 6480464 dabrafenib inhibits the reaction [decabromobiphenyl ether results in increased phosphorylation of RAF1 protein] CTD PMID:38641160 Raf1 Rat decabromodiphenyl ether multiple interactions ISO RAF1 (Homo sapiens) 6480464 dabrafenib inhibits the reaction [decabromobiphenyl ether results in increased phosphorylation of RAF1 protein] CTD PMID:38641160 Raf1 Rat decabromodiphenyl ether increases phosphorylation ISO RAF1 (Homo sapiens) 6480464 decabromobiphenyl ether results in increased phosphorylation of RAF1 protein CTD PMID:38641160 Raf1 Rat demethoxycurcumin decreases expression ISO RAF1 (Homo sapiens) 6480464 demethoxycurcumin results in decreased expression of RAF1 protein CTD PMID:34291863 Raf1 Rat deoxycholic acid multiple interactions ISO RAF1 (Homo sapiens) 6480464 Deoxycholic Acid results in increased phosphorylation of and results in increased activity of RAF1 protein and Ursodeoxycholic Acid inhibits the reaction [Deoxycholic Acid results in increased phosphorylation of and results in increased activity of RAF1 protein] CTD PMID:14747693 Raf1 Rat Dephostatin multiple interactions ISO Raf1 (Mus musculus) 6480464 dephostatin promotes the reaction [[Hydrogen Peroxide co-treated with Tetradecanoylphorbol Acetate] results in increased activity of RAF1 protein] CTD PMID:14623285 Raf1 Rat diarsenic trioxide increases expression ISO RAF1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of RAF1 mRNA CTD PMID:20458559 Raf1 Rat diarsenic trioxide multiple interactions EXP 6480464 Phloretin inhibits the reaction [Arsenic Trioxide results in decreased expression of RAF1 mRNA] CTD PMID:34037972 Raf1 Rat diarsenic trioxide decreases expression EXP 6480464 Arsenic Trioxide results in decreased expression of RAF1 mRNA CTD PMID:34037972 Raf1 Rat diarsenic trioxide multiple interactions ISO RAF1 (Homo sapiens) 6480464 [Arsenic Trioxide co-treated with PD 173074] results in decreased expression of RAF1 protein more ... CTD PMID:27794399 Raf1 Rat Dibutyl phosphate affects expression ISO RAF1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of RAF1 mRNA CTD PMID:37042841 Raf1 Rat dibutyl phthalate decreases expression ISO Raf1 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of RAF1 mRNA CTD PMID:21266533 Raf1 Rat dibutylstannane multiple interactions ISO RAF1 (Homo sapiens) 6480464 di-n-butyltin results in decreased expression of and results in decreased phosphorylation of RAF1 protein CTD PMID:24038145 Raf1 Rat Dictamnine decreases phosphorylation ISO RAF1 (Homo sapiens) 6480464 dictamnine results in decreased phosphorylation of RAF1 protein CTD PMID:34861243 Raf1 Rat dieldrin multiple interactions ISO RAF1 (Homo sapiens) 6480464 Dieldrin results in increased phosphorylation of and results in increased activity of RAF1 protein CTD PMID:15888667 Raf1 Rat dimethyl sulfoxide multiple interactions ISO RAF1 (Homo sapiens) 6480464 [cucurbitacin IIa co-treated with Dimethyl Sulfoxide] results in increased expression of RAF1 mRNA CTD PMID:31265865 Raf1 Rat dimethylarsinic acid multiple interactions ISO RAF1 (Homo sapiens) 6480464 [sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] affects the expression of RAF1 mRNA CTD PMID:23192986 Raf1 Rat dimethylarsinic acid increases expression EXP 6480464 Cacodylic Acid results in increased expression of RAF1 protein CTD PMID:32890875 Raf1 Rat dioxygen multiple interactions ISO RAF1 (Homo sapiens) 6480464 [Oxygen co-treated with Ozone co-treated with Cannabidiol] results in decreased expression of RAF1 mRNA and [Oxygen co-treated with Ozone] results in decreased expression of RAF1 mRNA CTD PMID:32992648 Raf1 Rat doxorubicin increases expression ISO RAF1 (Homo sapiens) 6480464 Doxorubicin results in increased expression of RAF1 mRNA CTD PMID:29803840 Raf1 Rat eckol decreases activity ISO RAF1 (Homo sapiens) 6480464 eckol results in decreased activity of RAF1 protein CTD PMID:21514314 Raf1 Rat emodin decreases expression ISO RAF1 (Homo sapiens) 6480464 Emodin results in decreased expression of RAF1 mRNA CTD PMID:16045814 Raf1 Rat emodin multiple interactions EXP 6480464 Emodin inhibits the reaction [PDGFB protein results in increased phosphorylation of RAF1 protein] CTD PMID:15288473 Raf1 Rat endosulfan multiple interactions ISO RAF1 (Homo sapiens) 6480464 Endosulfan results in increased phosphorylation of and results in increased activity of RAF1 protein CTD PMID:15888667 Raf1 Rat erlotinib hydrochloride decreases phosphorylation ISO Raf1 (Mus musculus) 6480464 Erlotinib Hydrochloride results in decreased phosphorylation of RAF1 protein CTD PMID:21195724 Raf1 Rat erlotinib hydrochloride multiple interactions ISO RAF1 (Homo sapiens) 6480464 Erlotinib Hydrochloride inhibits the reaction [[Air Pollutants results in increased abundance of Particulate Matter] which results in increased phosphorylation of RAF1 protein] CTD PMID:36442402 Raf1 Rat escitalopram increases expression EXP 6480464 Escitalopram results in increased expression of RAF1 mRNA CTD PMID:28467792 Raf1 Rat ethanol affects splicing ISO Raf1 (Mus musculus) 6480464 Ethanol affects the splicing of RAF1 mRNA CTD PMID:30319688 Raf1 Rat ethylene glycol bis(2-aminoethyl)tetraacetic acid multiple interactions ISO Raf1 (Mus musculus) 6480464 Egtazic Acid inhibits the reaction [cypermethrin results in increased phosphorylation of and results in increased activity of RAF1 protein] CTD PMID:29149324 Raf1 Rat ferrostatin-1 multiple interactions ISO RAF1 (Homo sapiens) 6480464 ferrostatin-1 inhibits the reaction [arsenic disulfide results in decreased phosphorylation of RAF1 protein] CTD PMID:36321791 Raf1 Rat flavonoids increases expression EXP 6480464 Flavonoids results in increased expression of RAF1 mRNA CTD PMID:18035473 Raf1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of RAF1 mRNA CTD PMID:24136188 Raf1 Rat folic acid affects expression ISO RAF1 (Homo sapiens) 6480464 Folic Acid affects the expression of RAF1 mRNA CTD PMID:16361273 Raf1 Rat folic acid multiple interactions ISO Raf1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of RAF1 mRNA CTD PMID:22206623 Raf1 Rat FR900359 increases phosphorylation ISO RAF1 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of RAF1 protein CTD PMID:37730182 Raf1 Rat gamma-hexachlorocyclohexane multiple interactions ISO RAF1 (Homo sapiens) 6480464 Hexachlorocyclohexane results in increased phosphorylation of and results in increased activity of RAF1 protein CTD PMID:15888667 Raf1 Rat geldanamycin increases expression ISO Raf1 (Mus musculus) 6480464 geldanamycin results in increased expression of RAF1 protein CTD PMID:8816498 Raf1 Rat geldanamycin decreases expression ISO RAF1 (Homo sapiens) 6480464 geldanamycin results in decreased expression of RAF1 protein CTD PMID:24450340 Raf1 Rat geldanamycin multiple interactions ISO RAF1 (Homo sapiens) 6480464 geldanamycin results in decreased expression of and results in decreased phosphorylation of RAF1 protein CTD PMID:19167484 Raf1 Rat genistein decreases phosphorylation EXP 6480464 Genistein results in decreased phosphorylation of RAF1 protein CTD PMID:15781664 Raf1 Rat genistein increases phosphorylation ISO RAF1 (Homo sapiens) 6480464 Genistein results in increased phosphorylation of RAF1 protein CTD PMID:19038232 Raf1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of RAF1 mRNA CTD PMID:22061828 Raf1 Rat geraniol multiple interactions ISO Raf1 (Mus musculus) 6480464 geraniol inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with 9 more ... CTD PMID:22760862 Raf1 Rat glucose multiple interactions ISO RAF1 (Homo sapiens) 6480464 MIR1231 inhibits the reaction [Glucose results in increased phosphorylation of RAF1 protein] and Resveratrol inhibits the reaction [Glucose results in increased phosphorylation of RAF1 protein] CTD PMID:38156429 Raf1 Rat glucose increases phosphorylation ISO RAF1 (Homo sapiens) 6480464 Glucose results in increased phosphorylation of RAF1 protein CTD PMID:38156429 Raf1 Rat Goe 6976 multiple interactions EXP 6480464 Go 6976 inhibits the reaction [zinc chloride results in increased phosphorylation of RAF1 protein] CTD PMID:21575692 Raf1 Rat GW 1929 increases activity ISO Raf1 (Mus musculus) 6480464 GW 1929 results in increased activity of RAF1 protein CTD PMID:12083801 Raf1 Rat heptachlor multiple interactions ISO RAF1 (Homo sapiens) 6480464 Heptachlor results in increased phosphorylation of and results in increased activity of RAF1 protein CTD PMID:15888667 Raf1 Rat hydrogen peroxide multiple interactions ISO Raf1 (Mus musculus) 6480464 [Hydrogen Peroxide co-treated with Tetradecanoylphorbol Acetate] results in increased activity of RAF1 protein more ... CTD PMID:14623285 and PMID:14975446 Raf1 Rat hydrogen peroxide increases activity ISO Raf1 (Mus musculus) 6480464 Hydrogen Peroxide results in increased activity of RAF1 protein CTD PMID:14623285 Raf1 Rat hydroquinone increases expression ISO RAF1 (Homo sapiens) 6480464 hydroquinone results in increased expression of RAF1 mRNA CTD PMID:22245671 Raf1 Rat hydroxyflutamide multiple interactions ISO RAF1 (Homo sapiens) 6480464 wortmannin promotes the reaction [hydroxyflutamide results in increased phosphorylation of RAF1 protein] CTD PMID:28163245 Raf1 Rat hydroxyflutamide increases phosphorylation ISO RAF1 (Homo sapiens) 6480464 hydroxyflutamide results in increased phosphorylation of RAF1 protein CTD PMID:28163245 Raf1 Rat indole-3-methanol multiple interactions EXP 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in increased expression of RAF1 mRNA and [indole-3-carbinol co-treated with Diethylnitrosamine] results in increased expression of RAF1 mRNA CTD PMID:22129741 Raf1 Rat lapatinib multiple interactions ISO RAF1 (Homo sapiens) 6480464 Lapatinib inhibits the reaction [sodium arsenite results in increased phosphorylation of RAF1 protein] CTD PMID:32890875 Raf1 Rat lead diacetate increases phosphorylation ISO RAF1 (Homo sapiens) 6480464 lead acetate results in increased phosphorylation of RAF1 protein CTD PMID:19133285 Raf1 Rat lead diacetate multiple interactions ISO RAF1 (Homo sapiens) 6480464 4-((3-bromophenyl)amino)-6 more ... CTD PMID:19133285 Raf1 Rat letrozole increases expression ISO Raf1 (Mus musculus) 6480464 letrozole results in increased expression of RAF1 protein CTD PMID:15967659 Raf1 Rat lipopolysaccharide increases activity EXP 6480464 Lipopolysaccharides results in increased activity of RAF1 protein CTD PMID:19039081 Raf1 Rat lipopolysaccharide multiple interactions EXP 6480464 [Lipopolysaccharides results in increased activity of RAF1 protein] which results in decreased secretion of Nitric Oxide and Methylmercury Compounds inhibits the reaction [Lipopolysaccharides results in increased activity of RAF1 protein] CTD PMID:19039081 Raf1 Rat lipoteichoic acid increases phosphorylation ISO Raf1 (Mus musculus) 6480464 lipoteichoic acid results in increased phosphorylation of RAF1 protein CTD PMID:19573522 Raf1 Rat lipoteichoic acid multiple interactions ISO Raf1 (Mus musculus) 6480464 Propofol inhibits the reaction [lipoteichoic acid results in increased phosphorylation of RAF1 protein] and TLR2 protein affects the reaction [lipoteichoic acid results in increased phosphorylation of RAF1 protein] CTD PMID:19573522 Raf1 Rat lovastatin multiple interactions ISO RAF1 (Homo sapiens) 6480464 Lovastatin inhibits the reaction [EGF protein results in increased phosphorylation of RAF1 protein] CTD PMID:19760159 Raf1 Rat lovastatin decreases activity ISO RAF1 (Homo sapiens) 6480464 Lovastatin results in decreased activity of RAF1 protein CTD PMID:19360310 Raf1 Rat LY294002 multiple interactions ISO RAF1 (Homo sapiens) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [Dronabinol results in increased localization of RAF1 protein] more ... CTD PMID:12834810 more ... Raf1 Rat maneb multiple interactions ISO Raf1 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of RAF1 mRNA more ... CTD PMID:23963992 Raf1 Rat mangiferin decreases expression ISO Raf1 (Mus musculus) 6480464 mangiferin results in decreased expression of RAF1 mRNA CTD PMID:15135318 Raf1 Rat manumycin A multiple interactions EXP 6480464 manumycin inhibits the reaction [Streptozocin results in increased expression of RAF1 protein] and manumycin inhibits the reaction [zinc chloride results in increased phosphorylation of RAF1 protein] CTD PMID:18569938 and PMID:21575692 Raf1 Rat melatonin multiple interactions ISO Raf1 (Mus musculus) 6480464 Melatonin inhibits the reaction [[Maneb co-treated with Paraquat] results in decreased expression of RAF1 mRNA] CTD PMID:23963992 Raf1 Rat metformin decreases phosphorylation ISO RAF1 (Homo sapiens) 6480464 Metformin results in decreased phosphorylation of RAF1 protein CTD PMID:23707609 Raf1 Rat Methanandamide multiple interactions ISO RAF1 (Homo sapiens) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [methanandamide results in increased localization of RAF1 protein] more ... CTD PMID:12834810 Raf1 Rat Methanandamide increases localization ISO RAF1 (Homo sapiens) 6480464 methanandamide results in increased localization of RAF1 protein CTD PMID:12834810 Raf1 Rat methapyrilene decreases methylation ISO RAF1 (Homo sapiens) 6480464 Methapyrilene results in decreased methylation of RAF1 intron CTD PMID:30157460 Raf1 Rat methidathion decreases expression ISO Raf1 (Mus musculus) 6480464 methidathion results in decreased expression of RAF1 mRNA CTD PMID:34813904 Raf1 Rat methylarsonic acid multiple interactions ISO RAF1 (Homo sapiens) 6480464 [sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] affects the expression of RAF1 mRNA CTD PMID:23192986 Raf1 Rat methylmercury chloride increases phosphorylation EXP 6480464 methylmercuric chloride results in increased phosphorylation of RAF1 protein CTD PMID:29258870 Raf1 Rat morphine multiple interactions ISO Raf1 (Mus musculus) 6480464 HINT1 affects the reaction [Morphine promotes the reaction [OPRM1 protein binds to RAF1 protein]] and Morphine promotes the reaction [OPRM1 protein binds to RAF1 protein] CTD PMID:21235400 Raf1 Rat morphine affects response to substance EXP 6480464 RAF1 protein affects the susceptibility to Morphine CTD PMID:18976650 Raf1 Rat N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine multiple interactions ISO Raf1 (Mus musculus) 6480464 N more ... CTD PMID:21235400 Raf1 Rat N-acetyl-L-cysteine multiple interactions ISO Raf1 (Mus musculus) 6480464 Acetylcysteine inhibits the reaction [NSC 680410 results in decreased expression of RAF1 protein] CTD PMID:16481037 Raf1 Rat N-acetyl-L-cysteine multiple interactions ISO RAF1 (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [tubocapsenolide A results in increased degradation of RAF1 protein] CTD PMID:18442981 Raf1 Rat N-acetyl-L-cysteine multiple interactions EXP 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in increased expression of RAF1 mRNA CTD PMID:22129741 Raf1 Rat N-acetylsphingosine increases activity EXP 6480464 N-acetylsphingosine results in increased activity of RAF1 protein CTD PMID:10700234 Raf1 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions ISO RAF1 (Homo sapiens) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [[arsenic trioxide co-treated with PD 173074] results in decreased expression of RAF1 protein modified form] and benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [[arsenic trioxide co-treated with PD 173074] results in decreased expression of RAF1 protein] CTD PMID:27794399 Raf1 Rat N-methyl-4-phenylpyridinium multiple interactions ISO RAF1 (Homo sapiens) 6480464 U 0126 affects the reaction [1-Methyl-4-phenylpyridinium affects the expression of RAF1 mRNA] CTD PMID:12710931 Raf1 Rat N-methyl-4-phenylpyridinium increases cleavage ISO RAF1 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in increased cleavage of RAF1 protein CTD PMID:10737593 Raf1 Rat N-nitrosodiethylamine multiple interactions ISO Raf1 (Mus musculus) 6480464 [troglitazone co-treated with Diethylnitrosamine] results in decreased expression of RAF1 mRNA CTD PMID:18597072 Raf1 Rat N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of RAF1 mRNA CTD PMID:2559087 Raf1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Phenobarbital] results in increased expression of RAF1 protein more ... CTD PMID:22129741 and PMID:7526561 Raf1 Rat N-nitrosodimethylamine increases expression ISO Raf1 (Mus musculus) 6480464 Dimethylnitrosamine results in increased expression of RAF1 protein CTD PMID:11884234 and PMID:19555203 Raf1 Rat N-nitrosodimethylamine multiple interactions ISO Raf1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin promotes the reaction [Dimethylnitrosamine results in increased expression of RAF1 protein] CTD PMID:11884234 and PMID:19555203 Raf1 Rat naphthalene increases expression ISO RAF1 (Homo sapiens) 6480464 naphthalene results in increased expression of RAF1 protein CTD PMID:14595851 Raf1 Rat naringin increases activity EXP 6480464 naringin results in increased activity of RAF1 protein CTD PMID:18951945 Raf1 Rat naringin multiple interactions EXP 6480464 RAF1 protein affects the reaction [naringin results in decreased expression of CDK2 protein] more ... CTD PMID:18951945 Raf1 Rat naringin increases phosphorylation ISO RAF1 (Homo sapiens) 6480464 naringin results in increased phosphorylation of RAF1 protein CTD PMID:18296682 Raf1 Rat naringin multiple interactions ISO RAF1 (Homo sapiens) 6480464 RAF1 protein affects the reaction [naringin results in increased expression of CDKN1A protein] more ... CTD PMID:18296682 Raf1 Rat niclosamide decreases phosphorylation ISO RAF1 (Homo sapiens) 6480464 Niclosamide analog results in decreased phosphorylation of RAF1 protein CTD PMID:28284560 Raf1 Rat niclosamide decreases expression ISO RAF1 (Homo sapiens) 6480464 Niclosamide analog results in decreased expression of RAF1 protein and Niclosamide results in decreased expression of RAF1 protein CTD PMID:28284560 Raf1 Rat nicotine multiple interactions ISO RAF1 (Homo sapiens) 6480464 Aconitine analog inhibits the reaction [Nicotine promotes the reaction [RB1 protein binds to RAF1 protein]] more ... CTD PMID:16862215 Raf1 Rat nicotine affects localization ISO Raf1 (Mus musculus) 6480464 Nicotine affects the localization of RAF1 protein CTD PMID:15574422 Raf1 Rat nicotine increases activity ISO RAF1 (Homo sapiens) 6480464 Nicotine results in increased activity of RAF1 protein CTD PMID:17459420 Raf1 Rat nimodipine multiple interactions ISO Raf1 (Mus musculus) 6480464 Nimodipine inhibits the reaction [cypermethrin results in increased phosphorylation of and results in increased activity of RAF1 protein] CTD PMID:29149324 Raf1 Rat nitric oxide multiple interactions EXP 6480464 [Lipopolysaccharides results in increased activity of RAF1 protein] which results in decreased secretion of Nitric Oxide CTD PMID:19039081 Raf1 Rat okadaic acid multiple interactions ISO Raf1 (Mus musculus) 6480464 Okadaic Acid inhibits the reaction [[Hydrogen Peroxide co-treated with Tetradecanoylphorbol Acetate] results in increased activity of RAF1 protein] CTD PMID:14623285 Raf1 Rat ouabain decreases expression ISO RAF1 (Homo sapiens) 6480464 Ouabain results in decreased expression of RAF1 mRNA CTD PMID:28795476 Raf1 Rat oxaliplatin multiple interactions EXP 6480464 RAF1 protein affects the reaction [Oxaliplatin results in increased expression of and results in increased phosphorylation of CREB1 protein] more ... CTD PMID:37453670 Raf1 Rat ozone multiple interactions ISO RAF1 (Homo sapiens) 6480464 [Oxygen co-treated with Ozone co-treated with Cannabidiol] results in decreased expression of RAF1 mRNA and [Oxygen co-treated with Ozone] results in decreased expression of RAF1 mRNA CTD PMID:32992648 Raf1 Rat p-menthan-3-ol decreases expression ISO RAF1 (Homo sapiens) 6480464 Menthol results in decreased expression of RAF1 mRNA CTD PMID:26760959 Raf1 Rat paclitaxel increases phosphorylation ISO RAF1 (Homo sapiens) 6480464 Paclitaxel results in increased phosphorylation of RAF1 protein CTD PMID:12510025 Raf1 Rat paclitaxel multiple interactions ISO RAF1 (Homo sapiens) 6480464 [pifithrin co-treated with Paclitaxel] results in increased phosphorylation of RAF1 protein and resveratrol inhibits the reaction [Paclitaxel results in increased phosphorylation of RAF1 protein] CTD PMID:12510025 and PMID:18516295 Raf1 Rat panobinostat multiple interactions ISO RAF1 (Homo sapiens) 6480464 [Bortezomib co-treated with panobinostat] results in decreased expression of RAF1 protein CTD PMID:18445700 Raf1 Rat paracetamol affects expression ISO Raf1 (Mus musculus) 6480464 Acetaminophen affects the expression of RAF1 mRNA CTD PMID:17562736 Raf1 Rat paracetamol multiple interactions ISO Raf1 (Mus musculus) 6480464 caffeic acid inhibits the reaction [Acetaminophen results in increased phosphorylation of RAF1 protein] CTD PMID:27720869 Raf1 Rat paracetamol increases phosphorylation ISO Raf1 (Mus musculus) 6480464 Acetaminophen results in increased phosphorylation of RAF1 protein CTD PMID:27720869 Raf1 Rat paracetamol multiple interactions ISO RAF1 (Homo sapiens) 6480464 caffeic acid inhibits the reaction [Acetaminophen results in increased phosphorylation of RAF1 protein] CTD PMID:27720869 Raf1 Rat paracetamol increases phosphorylation ISO RAF1 (Homo sapiens) 6480464 Acetaminophen results in increased phosphorylation of RAF1 protein CTD PMID:27720869 Raf1 Rat paracetamol decreases expression ISO RAF1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of RAF1 mRNA CTD PMID:25704631 Raf1 Rat paraquat multiple interactions ISO Raf1 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of RAF1 mRNA more ... CTD PMID:23963992 Raf1 Rat Parthenin decreases phosphorylation ISO RAF1 (Homo sapiens) 6480464 parthenin analog results in decreased phosphorylation of RAF1 protein CTD PMID:25196075 Raf1 Rat PD173074 decreases expression ISO RAF1 (Homo sapiens) 6480464 PD 173074 results in decreased expression of RAF1 protein and PD 173074 results in decreased expression of RAF1 protein modified form CTD PMID:27794399 Raf1 Rat PD173074 multiple interactions ISO RAF1 (Homo sapiens) 6480464 [arsenic trioxide co-treated with PD 173074] results in decreased expression of RAF1 protein more ... CTD PMID:27794399 Raf1 Rat perfluorohexanesulfonic acid decreases expression ISO Raf1 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in decreased expression of RAF1 mRNA CTD PMID:37995155 Raf1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Raf1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of RAF1 mRNA CTD PMID:36331819 Raf1 Rat perillyl alcohol multiple interactions ISO Raf1 (Mus musculus) 6480464 perillyl alcohol inhibits the reaction [Tetradecanoylphorbol Acetate results in increased expression of RAF1 protein] CTD PMID:19161993 Raf1 Rat phenethyl isothiocyanate decreases expression ISO RAF1 (Homo sapiens) 6480464 phenethyl isothiocyanate results in decreased expression of RAF1 protein CTD PMID:26456889 Raf1 Rat phenobarbital multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Phenobarbital] results in increased expression of RAF1 protein CTD PMID:7526561 Raf1 Rat phenobarbital decreases expression EXP 6480464 Phenobarbital results in decreased expression of RAF1 mRNA CTD PMID:17381134 Raf1 Rat phenylephrine multiple interactions EXP 6480464 Docosahexaenoic Acids inhibits the reaction [Phenylephrine results in increased phosphorylation of RAF1 protein] CTD PMID:15258898 Raf1 Rat phenylephrine increases phosphorylation EXP 6480464 Phenylephrine results in increased phosphorylation of RAF1 protein CTD PMID:15258898 Raf1 Rat PhIP increases phosphorylation ISO RAF1 (Homo sapiens) 6480464 2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in increased phosphorylation of RAF1 protein CTD PMID:22307971 Raf1 Rat phloretin multiple interactions EXP 6480464 Phloretin inhibits the reaction [Arsenic Trioxide results in decreased expression of RAF1 mRNA] CTD PMID:34037972 Raf1 Rat phlorizin decreases expression ISO Raf1 (Mus musculus) 6480464 Phlorhizin results in decreased expression of RAF1 mRNA CTD PMID:22538082 Raf1 Rat phorbol 13-acetate 12-myristate multiple interactions ISO Raf1 (Mus musculus) 6480464 [Hydrogen Peroxide co-treated with Tetradecanoylphorbol Acetate] results in increased activity of RAF1 protein more ... CTD PMID:14623285 more ... Raf1 Rat phorbol 13-acetate 12-myristate increases expression ISO Raf1 (Mus musculus) 6480464 Tetradecanoylphorbol Acetate results in increased expression of RAF1 protein CTD PMID:19161993 Raf1 Rat phorbol 13-acetate 12-myristate increases activity ISO Raf1 (Mus musculus) 6480464 Tetradecanoylphorbol Acetate results in increased activity of RAF1 protein CTD PMID:14623285 Raf1 Rat pifithrin-alpha hydrobromide multiple interactions ISO RAF1 (Homo sapiens) 6480464 [pifithrin co-treated with Paclitaxel] results in increased phosphorylation of RAF1 protein CTD PMID:18516295 Raf1 Rat pirinixic acid decreases expression ISO Raf1 (Mus musculus) 6480464 pirinixic acid results in decreased expression of RAF1 mRNA CTD PMID:23811191 Raf1 Rat potassium dichromate increases expression ISO RAF1 (Homo sapiens) 6480464 Potassium Dichromate results in increased expression of RAF1 mRNA CTD PMID:11678601 Raf1 Rat pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of RAF1 mRNA CTD PMID:19162173 Raf1 Rat progesterone decreases phosphorylation ISO RAF1 (Homo sapiens) 6480464 Progesterone results in decreased phosphorylation of RAF1 protein CTD PMID:17492661 Raf1 Rat propofol multiple interactions ISO Raf1 (Mus musculus) 6480464 Propofol inhibits the reaction [lipoteichoic acid results in increased phosphorylation of RAF1 protein] CTD PMID:19573522 Raf1 Rat prostaglandin F2alpha increases expression ISO Raf1 (Mus musculus) 6480464 Dinoprost results in increased expression of RAF1 protein modified form CTD PMID:24333336 Raf1 Rat prostaglandin F2alpha multiple interactions ISO Raf1 (Mus musculus) 6480464 resveratrol inhibits the reaction [Dinoprost results in increased expression of RAF1 protein modified form] and SRT1720 inhibits the reaction [Dinoprost results in increased expression of RAF1 protein modified form] CTD PMID:24333336 Raf1 Rat pyrogallol increases expression ISO Raf1 (Mus musculus) 6480464 Pyrogallol results in increased expression of RAF1 mRNA CTD PMID:20362636 Raf1 Rat quercetin multiple interactions ISO RAF1 (Homo sapiens) 6480464 Quercetin inhibits the reaction [EGF protein results in increased phosphorylation of RAF1 protein] and Quercetin inhibits the reaction [TGFA protein results in increased phosphorylation of RAF1 protein] CTD PMID:12888923 Raf1 Rat quercetin decreases expression ISO RAF1 (Homo sapiens) 6480464 Quercetin results in decreased expression of RAF1 protein and Quercetin results in decreased expression of RAF1 protein modified form CTD PMID:12653748 and PMID:21308698 Raf1 Rat quercetin multiple interactions ISO Raf1 (Mus musculus) 6480464 Quercetin binds to and results in decreased activity of RAF1 protein CTD PMID:18245498 Raf1 Rat quercetin decreases phosphorylation ISO RAF1 (Homo sapiens) 6480464 Quercetin results in decreased phosphorylation of RAF1 protein CTD PMID:12888923 Raf1 Rat quinomethionate affects expression ISO RAF1 (Homo sapiens) 6480464 quinomethionate affects the expression of RAF1 mRNA CTD PMID:15387888 Raf1 Rat resveratrol multiple interactions ISO RAF1 (Homo sapiens) 6480464 Resveratrol inhibits the reaction [3 more ... CTD PMID:12510025 more ... Raf1 Rat resveratrol multiple interactions ISO Raf1 (Mus musculus) 6480464 resveratrol inhibits the reaction [Dinoprost results in increased expression of RAF1 protein modified form] CTD PMID:24333336 Raf1 Rat resveratrol decreases expression ISO RAF1 (Homo sapiens) 6480464 resveratrol results in decreased expression of RAF1 protein CTD PMID:18089832 Raf1 Rat resveratrol multiple interactions EXP 6480464 resveratrol inhibits the reaction [3 more ... CTD PMID:18708364 Raf1 Rat rimonabant multiple interactions ISO RAF1 (Homo sapiens) 6480464 Rimonabant inhibits the reaction [Dronabinol results in increased localization of RAF1 protein] and Rimonabant inhibits the reaction [methanandamide results in increased localization of RAF1 protein] CTD PMID:12834810 Raf1 Rat romidepsin decreases expression ISO RAF1 (Homo sapiens) 6480464 romidepsin results in decreased expression of RAF1 protein CTD PMID:15014036 Raf1 Rat rottlerin decreases phosphorylation ISO RAF1 (Homo sapiens) 6480464 rottlerin results in decreased phosphorylation of RAF1 protein CTD PMID:15949478 Raf1 Rat S-nitroso-N-acetyl-D-penicillamine multiple interactions ISO Raf1 (Mus musculus) 6480464 S-Nitroso-N-Acetylpenicillamine promotes the reaction [OPRM1 protein binds to RAF1 protein] CTD PMID:21235400 Raf1 Rat Salvianolic acid A decreases phosphorylation ISO RAF1 (Homo sapiens) 6480464 salvianolic acid A results in decreased phosphorylation of RAF1 protein CTD PMID:29385302 Raf1 Rat semilicoisoflavone B affects phosphorylation ISO RAF1 (Homo sapiens) 6480464 semilicoisoflavone B affects the phosphorylation of RAF1 protein CTD PMID:36901935 Raf1 Rat sevoflurane affects expression EXP 6480464 sevoflurane affects the expression of RAF1 mRNA CTD PMID:15967596 Raf1 Rat simvastatin decreases activity ISO RAF1 (Homo sapiens) 6480464 Simvastatin results in decreased activity of RAF1 protein CTD PMID:19360310 Raf1 Rat simvastatin multiple interactions EXP 6480464 Simvastatin inhibits the reaction [Streptozocin results in increased expression of RAF1 protein] CTD PMID:18569938 Raf1 Rat sirolimus multiple interactions ISO RAF1 (Homo sapiens) 6480464 [7-hydroxystaurosporine co-treated with Sirolimus] results in decreased expression of RAF1 protein CTD PMID:15767555 Raf1 Rat sodium arsenite multiple interactions ISO RAF1 (Homo sapiens) 6480464 [sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] affects the expression of RAF1 mRNA and Lapatinib inhibits the reaction [sodium arsenite results in increased phosphorylation of RAF1 protein] CTD PMID:23192986 and PMID:32890875 Raf1 Rat sodium arsenite increases phosphorylation ISO RAF1 (Homo sapiens) 6480464 sodium arsenite results in increased phosphorylation of RAF1 protein CTD PMID:32890875 Raf1 Rat sodium arsenite decreases expression ISO Raf1 (Mus musculus) 6480464 sodium arsenite results in decreased expression of RAF1 mRNA CTD PMID:19822182 Raf1 Rat sodium arsenite increases activity ISO RAF1 (Homo sapiens) 6480464 sodium arsenite results in increased activity of RAF1 protein CTD PMID:9442025 Raf1 Rat sodium dichromate decreases expression ISO Raf1 (Mus musculus) 6480464 sodium bichromate results in decreased expression of RAF1 mRNA CTD PMID:22155349 Raf1 Rat sodium dichromate increases expression ISO Raf1 (Mus musculus) 6480464 sodium bichromate results in increased expression of RAF1 mRNA CTD PMID:22155349 Raf1 Rat sorafenib decreases activity ISO RAF1 (Homo sapiens) 6480464 sorafenib results in decreased activity of RAF1 protein CTD PMID:19139124 and PMID:21531053 Raf1 Rat SR 144528 multiple interactions ISO RAF1 (Homo sapiens) 6480464 SR 144528 inhibits the reaction [Dronabinol results in increased localization of RAF1 protein] and SR 144528 inhibits the reaction [methanandamide results in increased localization of RAF1 protein] CTD PMID:12834810 Raf1 Rat streptozocin multiple interactions EXP 6480464 manumycin inhibits the reaction [Streptozocin results in increased expression of RAF1 protein] more ... CTD PMID:18569938 and PMID:23562514 Raf1 Rat streptozocin decreases expression EXP 6480464 Streptozocin results in decreased expression of RAF1 protein CTD PMID:23562514 Raf1 Rat streptozocin increases expression EXP 6480464 Streptozocin results in increased expression of RAF1 protein CTD PMID:18569938 Raf1 Rat styrene increases expression ISO RAF1 (Homo sapiens) 6480464 Styrene results in increased expression of RAF1 protein CTD PMID:15212811 Raf1 Rat SU6656 multiple interactions ISO RAF1 (Homo sapiens) 6480464 SU 6656 inhibits the reaction [lead acetate results in increased phosphorylation of RAF1 protein] CTD PMID:19133285 Raf1 Rat tanespimycin decreases expression ISO RAF1 (Homo sapiens) 6480464 tanespimycin results in decreased expression of RAF1 protein CTD PMID:10564678 and PMID:34291863 Raf1 Rat Tautomycin multiple interactions ISO Raf1 (Mus musculus) 6480464 tautomycin inhibits the reaction [[Hydrogen Peroxide co-treated with Tetradecanoylphorbol Acetate] results in increased activity of RAF1 protein] CTD PMID:14623285 Raf1 Rat testosterone increases activity ISO RAF1 (Homo sapiens) 6480464 [Testosterone results in increased activity of RAF1 protein] which results in increased activity of MAP2K1 protein more ... CTD PMID:20372086 Raf1 Rat testosterone multiple interactions EXP 6480464 [FSHB protein co-treated with 1-Methyl-3-isobutylxanthine] inhibits the reaction [Testosterone promotes the reaction [RAF1 results in increased phosphorylation of MAP2K1 protein]] more ... CTD PMID:21177760 Raf1 Rat tetrahydropalmatine increases expression ISO RAF1 (Homo sapiens) 6480464 tetrahydropalmatine results in increased expression of RAF1 protein CTD PMID:20109541 Raf1 Rat thapsigargin multiple interactions ISO Raf1 (Mus musculus) 6480464 Thapsigargin inhibits the reaction [cypermethrin results in increased phosphorylation of and results in increased activity of RAF1 protein] CTD PMID:29149324 Raf1 Rat thapsigargin decreases expression ISO RAF1 (Homo sapiens) 6480464 Thapsigargin results in decreased expression of RAF1 mRNA CTD PMID:22378314 Raf1 Rat tipifarnib increases expression EXP 6480464 tipifarnib results in increased expression of RAF1 mRNA CTD PMID:16403772 Raf1 Rat titanium dioxide increases phosphorylation ISO Raf1 (Mus musculus) 6480464 titanium dioxide analog results in increased phosphorylation of RAF1 protein CTD PMID:25111187 Raf1 Rat trans-caffeic acid multiple interactions ISO RAF1 (Homo sapiens) 6480464 caffeic acid inhibits the reaction [Acetaminophen results in increased phosphorylation of RAF1 protein] CTD PMID:27720869 Raf1 Rat trans-caffeic acid multiple interactions ISO Raf1 (Mus musculus) 6480464 caffeic acid inhibits the reaction [Acetaminophen results in increased phosphorylation of RAF1 protein] CTD PMID:27720869 Raf1 Rat tributylstannane multiple interactions ISO RAF1 (Homo sapiens) 6480464 tributyltin affects the expression of and results in increased phosphorylation of RAF1 protein CTD PMID:24038145 Raf1 Rat trichostatin A affects expression ISO RAF1 (Homo sapiens) 6480464 trichostatin A affects the expression of RAF1 mRNA CTD PMID:28542535 Raf1 Rat trimethyltin increases expression ISO Raf1 (Mus musculus) 6480464 trimethyltin results in increased expression of RAF1 mRNA CTD PMID:20833246 Raf1 Rat triphenyl phosphate affects expression ISO RAF1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of RAF1 mRNA CTD PMID:37042841 Raf1 Rat troglitazone multiple interactions ISO Raf1 (Mus musculus) 6480464 [troglitazone co-treated with Diethylnitrosamine] results in decreased expression of RAF1 mRNA CTD PMID:18597072 Raf1 Rat tunicamycin decreases expression ISO RAF1 (Homo sapiens) 6480464 Tunicamycin results in decreased expression of RAF1 mRNA CTD PMID:22378314 Raf1 Rat urethane multiple interactions ISO Raf1 (Mus musculus) 6480464 tocopheryloxybutyric acid inhibits the reaction [Urethane promotes the reaction [RAF1 protein binds to HRAS protein]] more ... CTD PMID:11062179 Raf1 Rat ursodeoxycholic acid multiple interactions ISO RAF1 (Homo sapiens) 6480464 Ursodeoxycholic Acid inhibits the reaction [Deoxycholic Acid results in increased phosphorylation of and results in increased activity of RAF1 protein] CTD PMID:14747693 Raf1 Rat valproic acid affects expression ISO RAF1 (Homo sapiens) 6480464 Valproic Acid affects the expression of RAF1 mRNA CTD PMID:25979313 Raf1 Rat vemurafenib multiple interactions ISO RAF1 (Homo sapiens) 6480464 RAF1 protein affects the reaction [[KRAS protein mutant form affects the susceptibility to Vemurafenib] promotes the reaction [TNFRSF10B protein results in increased cleavage of CASP3 protein]] more ... CTD PMID:27222248 Raf1 Rat vitamin E multiple interactions ISO Raf1 (Mus musculus) 6480464 Vitamin E inhibits the reaction [Urethane promotes the reaction [RAF1 protein binds to HRAS protein]] CTD PMID:11062179 Raf1 Rat vorinostat multiple interactions ISO RAF1 (Homo sapiens) 6480464 [17-(dimethylaminoethylamino)-17-demethoxygeldanamycin co-treated with vorinostat] results in decreased expression of RAF1 protein and [Bortezomib co-treated with vorinostat] results in decreased expression of RAF1 protein CTD PMID:12893773 and PMID:19440035 Raf1 Rat vorinostat decreases expression ISO RAF1 (Homo sapiens) 6480464 vorinostat results in decreased expression of RAF1 protein CTD PMID:12893773 more ... Raf1 Rat wortmannin multiple interactions ISO RAF1 (Homo sapiens) 6480464 wortmannin promotes the reaction [hydroxyflutamide results in increased phosphorylation of RAF1 protein] and wortmannin promotes the reaction [ON123300 results in increased phosphorylation of RAF1 protein] CTD PMID:24568969 and PMID:28163245 Raf1 Rat zearalenone increases expression ISO Raf1 (Mus musculus) 6480464 Zearalenone results in increased expression of RAF1 mRNA CTD PMID:29758222 Raf1 Rat zinc atom multiple interactions ISO Raf1 (Mus musculus) 6480464 calphostin complex inhibits the reaction [Zinc promotes the reaction [OPRM1 protein binds to PRKCG protein binds to RAF1 protein]] more ... CTD PMID:21235400 Raf1 Rat zinc dichloride multiple interactions EXP 6480464 1 more ... CTD PMID:21575692 Raf1 Rat zinc dichloride increases phosphorylation EXP 6480464 zinc chloride results in increased phosphorylation of RAF1 protein CTD PMID:21575692 Raf1 Rat zinc(0) multiple interactions ISO Raf1 (Mus musculus) 6480464 calphostin complex inhibits the reaction [Zinc promotes the reaction [OPRM1 protein binds to PRKCG protein binds to RAF1 protein]] more ... CTD PMID:21235400 Raf1 Rat zoledronic acid decreases expression ISO RAF1 (Homo sapiens) 6480464 zoledronic acid results in decreased expression of RAF1 protein CTD PMID:12799645
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(1->4)-beta-D-glucan (ISO) (20R)-protopanaxadiol (ISO) (S)-(-)-perillyl alcohol (ISO) (S)-nicotine (ISO) 1,2-dimethylhydrazine (EXP,ISO) 1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile (EXP) 15-deoxy-Delta(12,14)-prostaglandin J2 (ISO) 17beta-estradiol (ISO) 17beta-estradiol 3-benzoate (EXP) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2-deoxy-D-glucose (EXP) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3,3',4,4'-tetrachlorobiphenyl (EXP,ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione (ISO) 3-isobutyl-1-methyl-7H-xanthine (EXP) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (ISO) 4-amino-2,6-dinitrotoluene (EXP) 4-hydroxynon-2-enal (ISO) 5-fluorouracil (ISO) 7,12-dimethyltetraphene (ISO) acetylsalicylic acid (ISO) aconitine (ISO) acrylamide (ISO) actinomycin D (EXP) afimoxifene (ISO) AICA ribonucleotide (EXP) aldehydo-D-glucose (ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) andrographolide (ISO) Aroclor 1254 (EXP,ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (EXP,ISO) atrazine (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) benzo[e]pyrene (ISO) bis(2-chloroethyl) sulfide (ISO) bisdemethoxycurcumin (ISO) bisphenol A (EXP,ISO) bortezomib (ISO) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) calciol (ISO) cannabidiol (ISO) carbon nanotube (ISO) chaetoglobosin A (EXP) choline (ISO) ciglitazone (ISO) cis-caffeic acid (ISO) cisplatin (ISO) citalopram (EXP) clofibrate (ISO) cocaine (EXP) copper atom (ISO) copper(0) (ISO) coumarin (ISO) crocidolite asbestos (ISO) Cruentaren A (ISO) curcumin (ISO) cypermethrin (ISO) D-glucose (ISO) dabrafenib (ISO) decabromodiphenyl ether (ISO) demethoxycurcumin (ISO) deoxycholic acid (ISO) Dephostatin (ISO) diarsenic trioxide (EXP,ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) dibutylstannane (ISO) Dictamnine (ISO) dieldrin (ISO) dimethyl sulfoxide (ISO) dimethylarsinic acid (EXP,ISO) dioxygen (ISO) doxorubicin (ISO) eckol (ISO) emodin (EXP,ISO) endosulfan (ISO) erlotinib hydrochloride (ISO) escitalopram (EXP) ethanol (ISO) ethylene glycol bis(2-aminoethyl)tetraacetic acid (ISO) ferrostatin-1 (ISO) flavonoids (EXP) flutamide (EXP) folic acid (ISO) FR900359 (ISO) gamma-hexachlorocyclohexane (ISO) geldanamycin (ISO) genistein (EXP,ISO) gentamycin (EXP) geraniol (ISO) glucose (ISO) Goe 6976 (EXP) GW 1929 (ISO) heptachlor (ISO) hydrogen peroxide (ISO) hydroquinone (ISO) hydroxyflutamide (ISO) indole-3-methanol (EXP) lapatinib (ISO) lead diacetate (ISO) letrozole (ISO) lipopolysaccharide (EXP) lipoteichoic acid (ISO) lovastatin (ISO) LY294002 (ISO) maneb (ISO) mangiferin (ISO) manumycin A (EXP) melatonin (ISO) metformin (ISO) Methanandamide (ISO) methapyrilene (ISO) methidathion (ISO) methylarsonic acid (ISO) methylmercury chloride (EXP) morphine (EXP,ISO) N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (ISO) N-acetyl-L-cysteine (EXP,ISO) N-acetylsphingosine (EXP) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) N-methyl-4-phenylpyridinium (ISO) N-nitrosodiethylamine (EXP,ISO) N-nitrosodimethylamine (ISO) naphthalene (ISO) naringin (EXP,ISO) niclosamide (ISO) nicotine (ISO) nimodipine (ISO) nitric oxide (EXP) okadaic acid (ISO) ouabain (ISO) oxaliplatin (EXP) ozone (ISO) p-menthan-3-ol (ISO) paclitaxel (ISO) panobinostat (ISO) paracetamol (ISO) paraquat (ISO) Parthenin (ISO) PD173074 (ISO) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perillyl alcohol (ISO) phenethyl isothiocyanate (ISO) phenobarbital (EXP) phenylephrine (EXP) PhIP (ISO) phloretin (EXP) phlorizin (ISO) phorbol 13-acetate 12-myristate (ISO) pifithrin-alpha hydrobromide (ISO) pirinixic acid (ISO) potassium dichromate (ISO) pregnenolone 16alpha-carbonitrile (EXP) progesterone (ISO) propofol (ISO) prostaglandin F2alpha (ISO) pyrogallol (ISO) quercetin (ISO) quinomethionate (ISO) resveratrol (EXP,ISO) rimonabant (ISO) romidepsin (ISO) rottlerin (ISO) S-nitroso-N-acetyl-D-penicillamine (ISO) Salvianolic acid A (ISO) semilicoisoflavone B (ISO) sevoflurane (EXP) simvastatin (EXP,ISO) sirolimus (ISO) sodium arsenite (ISO) sodium dichromate (ISO) sorafenib (ISO) SR 144528 (ISO) streptozocin (EXP) styrene (ISO) SU6656 (ISO) tanespimycin (ISO) Tautomycin (ISO) testosterone (EXP,ISO) tetrahydropalmatine (ISO) thapsigargin (ISO) tipifarnib (EXP) titanium dioxide (ISO) trans-caffeic acid (ISO) tributylstannane (ISO) trichostatin A (ISO) trimethyltin (ISO) triphenyl phosphate (ISO) troglitazone (ISO) tunicamycin (ISO) urethane (ISO) ursodeoxycholic acid (ISO) valproic acid (ISO) vemurafenib (ISO) vitamin E (ISO) vorinostat (ISO) wortmannin (ISO) zearalenone (ISO) zinc atom (ISO) zinc dichloride (EXP) zinc(0) (ISO) zoledronic acid (ISO)
Biological Process
cell differentiation (IEA,ISO) death-inducing signaling complex assembly (IEA,ISO) ERBB2-ERBB3 signaling pathway (IEA,ISO) extrinsic apoptotic signaling pathway via death domain receptors (IEA,ISO) face development (IEA,ISO) heart development (IEP) insulin receptor signaling pathway (IEA,ISO) insulin secretion involved in cellular response to glucose stimulus (IEA,ISO) insulin-like growth factor receptor signaling pathway (IEA,ISO) intermediate filament cytoskeleton organization (IEA,ISO) intracellular glucose homeostasis (IEA,ISO) intracellular signal transduction (TAS) MAPK cascade (IBA,IDA,IEA,IMP) myelination (IEA,ISO) negative regulation of apoptotic process (IEA,ISO) negative regulation of cell population proliferation (IEA,ISO) negative regulation of extrinsic apoptotic signaling pathway via death domain receptors (IEA,ISO) negative regulation of protein-containing complex assembly (IEA,ISO) neurotrophin TRK receptor signaling pathway (IEA,ISO) positive regulation of MAPK cascade (IEA,ISO) positive regulation of peptidyl-serine phosphorylation (ISO) positive regulation of protein phosphorylation (ISO) positive regulation of transcription by RNA polymerase II (IEA,ISO) protein phosphorylation (IDA,IMP,TAS) response to hypoxia (IDA) response to muscle stretch (IEA,ISO) Schwann cell development (IEA,ISO) signal transduction (IEA) somatic stem cell population maintenance (IEA,ISO) thymus development (IEA,ISO) thyroid gland development (IEA,ISO) type B pancreatic cell proliferation (IEA,ISO)
Cellular Component
cytoplasm (IBA,IDA,IEA,ISO) cytosol (IBA,IEA,ISO,TAS) Golgi apparatus (IEA,ISO) membrane (IEA) mitochondrion (IBA,IEA) nucleus (IEA) plasma membrane (IDA,IEA,ISO) pseudopodium (IEA,ISO)
Molecular Function
adenylate cyclase activator activity (IDA,IEA,ISO) adenylate cyclase binding (IPI) ATP binding (IDA,IEA) enzyme binding (IEA,ISO) identical protein binding (IEA,ISO) kinase activity (IEA) MAP kinase kinase kinase activity (IBA,IDA,IEA,IMP,ISO,TAS) metal ion binding (IEA) mitogen-activated protein kinase kinase binding (IMP) nucleotide binding (IEA) protein binding (IPI,ISO) protein kinase activity (IEA,ISO) protein serine kinase activity (IEA) protein serine/threonine kinase activity (IEA,ISO) protein-containing complex binding (IPI) small GTPase binding (IEA,ISO) transferase activity (IEA) zinc ion binding (IEA)
1.
Role of Raf in vascular protection from distinct apoptotic stimuli.
Alavi A, etal., Science 2003 Jul 4;301(5629):94-6.
2.
Mutations in conserved regions 1, 2, and 3 of Raf-1 that activate transforming activity.
Chan EY, etal., Mol Carcinog 2002 Apr;33(4):189-97.
3.
beta-arrestin-dependent endocytosis of proteinase-activated receptor 2 is required for intracellular targeting of activated ERK1/2.
DeFea KA, etal., J Cell Biol. 2000 Mar 20;148(6):1267-81.
4.
Endothelial ERK signaling controls lymphatic fate specification.
Deng Y, etal., J Clin Invest. 2013 Mar;123(3):1202-15. doi: 10.1172/JCI63034. Epub 2013 Feb 8.
5.
Raf kinase activation of adenylyl cyclases: isoform-selective regulation.
Ding Q, etal., Mol Pharmacol. 2004 Oct;66(4):921-8.
6.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
7.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
8.
Hepatic epidermal growth factor-regulated mitogen-activated protein kinase kinase kinase activity in the rat: lack of identity with known forms of raf and MEKK.
Gruppuso PA and Boylan JM, FEBS Lett. 2000 Jan 21;466(1):200-4.
9.
Gene Data File
Integration of LocusLink data, October 12, 2001
10.
Rat c-raf oncogene activation by a rearrangement that produces a fused protein.
Ishikawa F, etal., Mol Cell Biol 1987 Mar;7(3):1226-32.
11.
Diabetes regulates small molecular weight G-protein, H-Ras, in the microvasculature of the retina: implication in the development of retinopathy.
Kanwar M and Kowluru RA, Microvasc Res. 2008 Nov;76(3):189-93. Epub 2008 Apr 25.
12.
Expression of mitogen-activated protein kinase pathways during postnatal development of rat heart.
Kim SO, etal., J Cell Biochem 1998 Nov 1;71(2):286-301.
13.
Molecular and clinical analysis of RAF1 in Noonan syndrome and related disorders: dephosphorylation of serine 259 as the essential mechanism for mutant activation.
Kobayashi T, etal., Hum Mutat. 2010 Mar;31(3):284-94. doi: 10.1002/humu.21187.
14.
Roles of the Raf/MEK/ERK pathway in cell growth, malignant transformation and drug resistance.
McCubrey JA, etal., Biochim Biophys Acta. 2007 Aug;1773(8):1263-84. Epub 2006 Oct 7.
15.
Affinity with Raf is sufficient for Ras to efficiently induce rat mammary carcinomas.
McFarlin DR, etal., Carcinogenesis 2003 Jan;24(1):99-105.
16.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
17.
Raf-1 expression may influence progression to androgen insensitive prostate cancer.
Mukherjee R, etal., Prostate. 2005 Jun 15;64(1):101-7. doi: 10.1002/pros.20211.
18.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
19.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
20.
Systemic delivery of RafsiRNA using cationic cardiolipin liposomes silences Raf-1 expression and inhibits tumor growth in xenograft model of human prostate cancer.
Pal A, etal., Int J Oncol. 2005 Apr;26(4):1087-91.
21.
Gain-of-function RAF1 mutations cause Noonan and LEOPARD syndromes with hypertrophic cardiomyopathy.
Pandit B, etal., Nat Genet. 2007 Aug;39(8):1007-12. Epub 2007 Jul 1.
22.
Combination with liposome-entrapped, ends-modified raf antisense oligonucleotide (LErafAON) improves the anti-tumor efficacies of cisplatin, epirubicin, mitoxantrone, docetaxel and gemcitabine.
Pei J, etal., Anticancer Drugs. 2004 Mar;15(3):243-53.
23.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
24.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
25.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
26.
Germline gain-of-function mutations in RAF1 cause Noonan syndrome.
Razzaque MA, etal., Nat Genet. 2007 Aug;39(8):1013-7. Epub 2007 Jul 1.
27.
GOA pipeline
RGD automated data pipeline
28.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
29.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
30.
MEK1/2 dual-specificity protein kinases: Structure and regulation.
Roskoski R Jr Biochem Biophys Res Commun. 2012 Jan 6;417(1):5-10. Epub 2011 Dec 8.
31.
Regulation and role of Raf-1/B-Raf heterodimerization.
Rushworth LK, etal., Mol Cell Biol. 2006 Mar;26(6):2262-72.
32.
Growth factor-induced MAPK network topology shapes Erk response determining PC-12 cell fate.
Santos SD, etal., Nat Cell Biol. 2007 Mar;9(3):324-30. Epub 2007 Feb 18.
33.
Hypoxia and hypoxia/reoxygenation activate Raf-1, mitogen-activated protein kinase kinase, mitogen-activated protein kinases, and S6 kinase in cultured rat cardiac myocytes.
Seko Y, etal., Circ Res. 1996 Jan;78(1):82-90.
34.
RGS14 is a multifunctional scaffold that integrates G protein and Ras/Raf MAPkinase signalling pathways.
Shu FJ, etal., Cell Signal. 2010 Mar;22(3):366-76. doi: 10.1016/j.cellsig.2009.10.005. Epub .
35.
Expression of c-myc, c-raf-1, and c-Ki-ras in azaserine-induced pancreatic carcinomas and growing pancreas in rats.
Silverman JA, etal., Mol Carcinog. 1990;3(6):379-86.
36.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
37.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
38.
Raf kinase inhibitory protein regulates Raf-1 but not B-Raf kinase activation.
Trakul N, etal., J Biol Chem. 2005 Jul 1;280(26):24931-40. Epub 2005 May 10.
39.
Regulator of G-protein signaling 14 (RGS14) is a selective H-Ras effector.
Willard FS, etal., PLoS One. 2009;4(3):e4884. doi: 10.1371/journal.pone.0004884. Epub 2009 Mar 25.
40.
Rat thy-1 antigens from thymus and brain: their tissue distribution, purification, and chemical composition.
Williams AF, etal., Cold Spring Harb Symp Quant Biol 1977;41 Pt 1:51-61.
41.
[Expression and significance of JNK1, Raf-1 and Livin in the carcinogenesis of sporadic colorectal tubular adenoma].
Wu WX, etal., Zhonghua Zhong Liu Za Zhi. 2010 Sep;32(9):671-5.
42.
MEK-ERK pathway modulation ameliorates disease phenotypes in a mouse model of Noonan syndrome associated with the Raf1(L613V) mutation.
Wu X, etal., J Clin Invest. 2011 Mar;121(3):1009-25. doi: 10.1172/JCI44929. Epub 2011 Feb 21.
43.
Increased BRAF heterodimerization is the common pathogenic mechanism for noonan syndrome-associated RAF1 mutants.
Wu X, etal., Mol Cell Biol. 2012 Oct;32(19):3872-90. doi: 10.1128/MCB.00751-12. Epub 2012 Jul 23.
44.
Insulin enhances growth hormone induction of the MEK/ERK signaling pathway.
Xu J, etal., J Biol Chem. 2006 Jan 13;281(2):982-92. Epub 2005 Nov 4.
45.
Role of the protein kinase C-epsilon-Raf-1-MEK-1/2-p44/42 MAPK signaling cascade in the activation of signal transducers and activators of transcription 1 and 3 and induction of cyclooxygenase-2 after ischemic preconditioning.
Xuan YT, etal., Circulation. 2005 Sep 27;112(13):1971-8. Epub 2005 Sep 19.
Raf1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 150,352,158 - 150,412,813 (-) NCBI GRCr8 mRatBN7.2 4 148,679,534 - 148,740,265 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 148,679,530 - 148,740,317 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 154,903,973 - 154,964,738 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 150,687,056 - 150,747,821 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 149,310,879 - 149,371,650 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 147,532,040 - 147,592,769 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 147,532,042 - 147,592,699 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 210,819,148 - 210,878,226 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 151,752,583 - 151,775,609 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 151,997,425 - 152,020,450 (-) NCBI Celera 4 137,570,499 - 137,631,125 (-) NCBI Celera Cytogenetic Map 4 q42 NCBI
RAF1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 12,583,601 - 12,664,117 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 12,582,101 - 12,664,201 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 12,625,100 - 12,705,616 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 12,600,108 - 12,680,678 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 12,600,107 - 12,680,678 NCBI Celera 3 12,563,426 - 12,643,994 (-) NCBI Celera Cytogenetic Map 3 p25.2 NCBI HuRef 3 12,559,317 - 12,640,382 (-) NCBI HuRef CHM1_1 3 12,575,179 - 12,655,743 (-) NCBI CHM1_1 T2T-CHM13v2.0 3 12,582,405 - 12,665,632 (-) NCBI T2T-CHM13v2.0
Raf1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 115,595,530 - 115,653,596 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 115,595,028 - 115,653,596 (-) Ensembl GRCm39 Ensembl GRCm38 6 115,618,569 - 115,676,635 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 115,618,067 - 115,676,635 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 115,568,591 - 115,626,653 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 115,584,216 - 115,642,122 (-) NCBI MGSCv36 mm8 Celera 6 117,458,696 - 117,516,733 (-) NCBI Celera Cytogenetic Map 6 E3 NCBI cM Map 6 53.62 NCBI
Raf1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955429 18,025,932 - 18,049,723 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955429 17,980,956 - 18,049,723 (+) NCBI ChiLan1.0 ChiLan1.0
RAF1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 12,570,434 - 12,649,715 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 12,575,188 - 12,654,475 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 12,510,084 - 12,590,598 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 12,853,415 - 12,932,871 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 12,853,415 - 12,932,871 (-) Ensembl panpan1.1 panPan2
RAF1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 5,892,839 - 5,972,672 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 5,892,834 - 5,972,090 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 5,929,501 - 6,009,310 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 5,921,808 - 6,000,868 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 5,921,827 - 6,000,864 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 5,637,969 - 5,717,035 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 5,991,105 - 6,070,948 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 5,966,879 - 6,046,000 (+) NCBI UU_Cfam_GSD_1.0
Raf1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404942 17,795,336 - 17,819,736 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936602 1,051,205 - 1,117,096 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936602 1,089,979 - 1,114,376 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
RAF1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 68,580,812 - 68,657,829 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 68,581,128 - 68,657,911 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 75,848,344 - 75,927,158 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
RAF1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 22 48,560,270 - 48,643,537 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 22 48,561,161 - 48,618,020 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 117,857,289 - 117,941,171 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Raf1
.
Predicted Target Of
Count of predictions: 103 Count of miRNA genes: 83 Interacting mature miRNAs: 86 Transcripts: ENSRNOT00000013831 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1582237 Kidm34 Kidney mass QTL 34 4 0.0001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 4 148090542 168069246 Rat 61446 Coreg2 Compensatory renal growth QTL 2 3.5 kidney mass (VT:0002707) compensatory renal growth score (CMO:0001894) 4 148423102 157580971 Rat 1300116 Hrtrt5 Heart rate QTL 5 3.76 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 116179486 151161268 Rat 6478693 Anxrr32 Anxiety related response QTL 32 0.00092 locomotor behavior trait (VT:0001392) measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957) 4 144639524 182687754 Rat 10755501 Bp390 Blood pressure QTL 390 2.5 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 4 26775591 168368347 Rat 631683 Bp116 Blood pressure QTL 116 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 124303370 169303370 Rat 61451 Ciaa4 CIA Autoantibody QTL 4 3.1 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 4 126395976 167139601 Rat 1331738 Bp209 Blood pressure QTL 209 2.979 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 138503169 179293946 Rat 6478700 Anxrr33 Anxiety related response QTL 33 0.00896 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 144639524 182687754 Rat 1549827 Scl46 Serum cholesterol level QTL 46 3.5 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 4 132396220 177396220 Rat 731165 Uae21 Urinary albumin excretion QTL 21 2.4 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 4 106649412 151649412 Rat 737821 Hcar9 Hepatocarcinoma resistance QTL 9 3.7 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 4 109866907 167139601 Rat 7411558 Bw133 Body weight QTL 133 13.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 4 125590636 170590636 Rat 10401796 Kidm48 Kidney mass QTL 48 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 4 145568712 182687754 Rat 6478718 Anxrr34 Anxiety related response QTL 34 0.00896 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 144639524 182687754 Rat 1549832 Bss3 Bone structure and strength QTL 3 11 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 4 109827074 154827074 Rat 70177 Xhs1 X-ray hypersensitivity QTL 1 25.1 intestine integrity trait (VT:0010554) post-insult time to onset of moribundity (CMO:0001896) 4 82798864 152731274 Rat 2303623 Vencon2 Ventilatory control QTL 2 3.8 respiration trait (VT:0001943) minute ventilation (CMO:0000132) 4 135204660 180204660 Rat 1578674 Bmd12 Bone mineral density QTL 12 3.8 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 4 135699135 180699135 Rat 737978 Pia23 Pristane induced arthritis QTL 23 5.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 131730738 167139601 Rat 61362 Oia2 Oil induced arthritis QTL 2 0.001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 138503169 173369699 Rat 70200 Alc18 Alcohol consumption QTL 18 9.2 drinking behavior trait (VT:0001422) ethanol intake volume to total fluid intake volume ratio (CMO:0001591) 4 56647873 149491524 Rat 2293659 Bmd35 Bone mineral density QTL 35 4.5 0.0001 femur strength trait (VT:0010010) femoral neck ultimate force (CMO:0001703) 4 137755016 181392681 Rat 1331759 Hrtrt13 Heart rate QTL 13 3.54628 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 110275411 168266883 Rat 724535 Cm18 Cardiac mass QTL 18 2.6 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 4 118856416 163856416 Rat 2316958 Gluco58 Glucose level QTL 58 10 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 11320076 180699135 Rat 6478754 Anxrr43 Anxiety related response QTL 43 0.14035 locomotor behavior trait (VT:0001392) distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493) 4 144639524 182687754 Rat 2302049 Pia32 Pristane induced arthritis QTL 32 5.1 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112) 4 105789505 150789505 Rat 724558 Plsm2 Polydactyly-luxate syndrome (PLS) morphotypes QTL 2 0.0003 hindlimb integrity trait (VT:0010563) hind foot phalanges count (CMO:0001949) 4 132422778 177422778 Rat 6478763 Anxrr46 Anxiety related response QTL 46 0.07428 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 110870972 155870972 Rat 6478760 Anxrr45 Anxiety related response QTL 45 0.06717 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 110870972 155870972 Rat 1331802 Srn5 Serum renin concentration QTL 5 3.045 renin activity (VT:0005581) plasma renin activity level (CMO:0000116) 4 119428175 157578333 Rat 1298524 Oia8 Oil induced arthritis QTL 8 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 138503169 173369699 Rat 738009 Sach4 Saccharine consumption QTL 4 4.9 0.000016 consumption behavior trait (VT:0002069) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 4 59948935 154902892 Rat 7207480 Bss105 Bone structure and strength QTL 105 8.1 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 4 109827074 154827074 Rat 634335 Anxrr16 Anxiety related response QTL 16 7.22 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 4 93308457 167139447 Rat 6478778 Anxrr51 Anxiety related response QTL 51 0.25384 locomotor behavior trait (VT:0001392) measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957) 4 124778595 169778595 Rat 61406 Scwia1 Streptococcal cell wall induced arthritis QTL 1 2.3 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 4 106805662 151805662 Rat 631511 Pia7 Pristane induced arthritis QTL 7 4.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 131730738 167139601 Rat 634347 Hcar8 Hepatocarcinoma resistance QTL 8 5.8 liver integrity trait (VT:0010547) liver tumorous lesion area to total liver area ratio (CMO:0001075) 4 123143783 168143783 Rat 738031 Alc14 Alcohol consumption QTL 14 7.6 0.00003 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1576316 Ept5 Estrogen-induced pituitary tumorigenesis QTL 5 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 4 83428419 177635233 Rat 1576305 Emca6 Estrogen-induced mammary cancer QTL 6 5.8 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 4 44463720 155883716 Rat 738016 Alc16 Alcohol consumption QTL 16 3.6 0.00015 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1358202 Gluco11 Glucose level QTL 11 2.4 0.02 adipocyte glucose uptake trait (VT:0004185) absolute change in adipocyte glucose uptake (CMO:0000873) 4 85379421 167139601 Rat 61422 Cia13 Collagen induced arthritis QTL 13 4.5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 132642577 167139601 Rat 634342 Cia24 Collagen induced arthritis QTL 24 4.5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 146565735 175236377 Rat 631674 Iddm14 Insulin dependent diabetes mellitus QTL 14 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 4 64528739 157573521 Rat 12798519 Anxrr54 Anxiety related response QTL 54 2.54 0.05 locomotor behavior trait (VT:0001392) distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493) 4 114627026 159627026 Rat 12798523 Anxrr56 Anxiety related response QTL 56 2.83 0.05 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 85253748 150276390 Rat 6478748 Anxrr42 Anxiety related response QTL 42 0.28008 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 144639524 182687754 Rat 12798525 Anxrr57 Anxiety related response QTL 57 3.21 0.05 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 147278504 167139601 Rat
RH127364
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 148,679,257 - 148,679,472 (+) MAPPER mRatBN7.2 Rnor_6.0 4 147,531,764 - 147,531,978 NCBI Rnor6.0 Rnor_5.0 4 210,818,872 - 210,819,086 UniSTS Rnor5.0 RGSC_v3.4 4 151,752,307 - 151,752,521 UniSTS RGSC3.4 Celera 4 137,570,223 - 137,570,437 UniSTS RH 3.4 Map 15 457.3 UniSTS Cytogenetic Map 4 q42 UniSTS
RH142970
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 148,683,589 - 148,683,722 (+) MAPPER mRatBN7.2 Rnor_6.0 4 147,536,095 - 147,536,227 NCBI Rnor6.0 Rnor_5.0 4 210,823,203 - 210,823,335 UniSTS Rnor5.0 RGSC_v3.4 4 151,756,638 - 151,756,770 UniSTS RGSC3.4 Celera 4 137,574,554 - 137,574,686 UniSTS RH 3.4 Map 4 952.1 UniSTS Cytogenetic Map 4 q42 UniSTS
BI284862
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 148,679,723 - 148,679,931 (+) MAPPER mRatBN7.2 Rnor_6.0 4 147,532,230 - 147,532,437 NCBI Rnor6.0 Rnor_5.0 4 210,819,338 - 210,819,545 UniSTS Rnor5.0 RGSC_v3.4 4 151,752,773 - 151,752,980 UniSTS RGSC3.4 Celera 4 137,570,689 - 137,570,896 UniSTS RH 3.4 Map 4 950.71 UniSTS Cytogenetic Map 4 q42 UniSTS
RH139128
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 148,683,086 - 148,683,210 (+) MAPPER mRatBN7.2 Rnor_6.0 4 147,535,592 - 147,535,715 NCBI Rnor6.0 Rnor_5.0 4 210,822,700 - 210,822,823 UniSTS Rnor5.0 RGSC_v3.4 4 151,756,135 - 151,756,258 UniSTS RGSC3.4 Celera 4 137,574,051 - 137,574,174 UniSTS RH 3.4 Map 4 951.41 UniSTS Cytogenetic Map 4 q42 UniSTS
UniSTS:469819
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 148,679,655 - 148,680,192 (+) MAPPER mRatBN7.2 Rnor_6.0 4 147,532,162 - 147,532,698 NCBI Rnor6.0 Rnor_5.0 4 210,819,270 - 210,819,806 UniSTS Rnor5.0 RGSC_v3.4 4 151,752,705 - 151,753,241 UniSTS RGSC3.4 Celera 4 137,570,621 - 137,571,157 UniSTS Cytogenetic Map 4 q42 UniSTS
Raf1
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 4 150,366,757 - 150,367,307 (+) Marker Load Pipeline mRatBN7.2 4 148,694,134 - 148,694,684 (+) MAPPER mRatBN7.2 Rnor_6.0 4 147,546,640 - 147,547,189 NCBI Rnor6.0 Rnor_5.0 4 210,833,748 - 210,834,297 UniSTS Rnor5.0 RGSC_v3.4 4 151,767,183 - 151,767,732 UniSTS RGSC3.4 Celera 4 137,585,099 - 137,585,648 UniSTS Cytogenetic Map 4 q42 UniSTS
Raf1
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 4 150,352,899 - 150,353,489 (+) Marker Load Pipeline mRatBN7.2 4 148,680,275 - 148,680,866 (+) MAPPER mRatBN7.2 Rnor_6.0 4 147,532,782 - 147,533,371 NCBI Rnor6.0 Rnor_5.0 4 210,819,890 - 210,820,479 UniSTS Rnor5.0 Celera 4 137,571,241 - 137,571,830 UniSTS Cytogenetic Map 4 q42 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000013831 ⟹ ENSRNOP00000013831
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 148,679,530 - 148,740,210 (-) Ensembl Rnor_6.0 Ensembl 4 147,532,042 - 147,592,699 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000105918 ⟹ ENSRNOP00000082418
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 148,679,534 - 148,740,317 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000109662 ⟹ ENSRNOP00000092271
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 148,679,534 - 148,740,317 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000119226 ⟹ ENSRNOP00000094673
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 148,679,534 - 148,740,317 (-) Ensembl
RefSeq Acc Id:
NM_012639 ⟹ NP_036771
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 150,352,158 - 150,412,813 (-) NCBI mRatBN7.2 4 148,679,534 - 148,740,195 (-) NCBI Rnor_6.0 4 147,532,040 - 147,592,699 (-) NCBI Rnor_5.0 4 210,819,148 - 210,878,226 (-) NCBI RGSC_v3.4 4 151,752,583 - 151,775,609 (-) RGD Celera 4 137,570,499 - 137,631,125 (-) RGD
Sequence:
GCTTGTTCCGCCATCTTAGATGGCGGGAGTTAGAACGGAGCGAGCTTGAAGCAGGAAGGCTTCTCTGCCGTTCTCCGCAGGCCCTCAGACGGGCCAGCTGGCCGAGCTTTGGGGCGCGTGCCCTGAGG
hide sequence
RefSeq Acc Id:
XM_008763217 ⟹ XP_008761439
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 150,352,165 - 150,412,675 (-) NCBI mRatBN7.2 4 148,679,541 - 148,740,265 (-) NCBI Rnor_6.0 4 147,532,047 - 147,592,769 (-) NCBI
Sequence:
GGTCGCCAAGACGAGTGTCGAGCGCAGGGCTAGCTCGCCGCCGCAGCCTGAGAGCGTCTTCATC
hide sequence
RefSeq Acc Id:
XM_008763218 ⟹ XP_008761440
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 150,352,165 - 150,412,182 (-) NCBI mRatBN7.2 4 148,679,635 - 148,739,511 (-) NCBI Rnor_6.0 4 147,532,047 - 147,592,039 (-) NCBI
Sequence:
GCCCCGTCACAAAGACGTGGGACCTCGCCCGGAGCTTCCAAATGGGAGGCCGGGGATGCTCGAGATTGGGAGCTGGACTGCCTTTTGTGTGAAGCGACAGCCTCCTAGGCTCTGCAGACGCCAGTGAA
hide sequence
RefSeq Acc Id:
XM_039107056 ⟹ XP_038962984
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 150,352,165 - 150,412,299 (-) NCBI mRatBN7.2 4 148,679,635 - 148,739,684 (-) NCBI
RefSeq Acc Id:
XM_039107057 ⟹ XP_038962985
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 150,352,165 - 150,412,133 (-) NCBI mRatBN7.2 4 148,679,635 - 148,739,574 (-) NCBI
RefSeq Acc Id:
XM_063285558 ⟹ XP_063141628
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 150,352,165 - 150,412,299 (-) NCBI
RefSeq Acc Id:
XM_063285559 ⟹ XP_063141629
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 150,352,165 - 150,375,542 (-) NCBI
RefSeq Acc Id:
XM_063285560 ⟹ XP_063141630
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 150,352,165 - 150,375,542 (-) NCBI
RefSeq Acc Id:
NP_036771 ⟸ NM_012639
- UniProtKB:
P11345 (UniProtKB/Swiss-Prot), A6IKZ0 (UniProtKB/TrEMBL), A0A8L2Q6F4 (UniProtKB/TrEMBL)
- Sequence:
MEHIQGAWKTISNGFGLKDAVFDGSSCISPTIVQQFGYQRRASDDGKLTDSSKTSNTIRVFLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLQEHKGKKARLDWNTDAASLIGEELQV
hide sequence
RefSeq Acc Id:
XP_008761439 ⟸ XM_008763217
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I5ZWZ7 (UniProtKB/TrEMBL), A0A8L2Q6F4 (UniProtKB/TrEMBL)
- Sequence:
MEHIQGAWKTISNGFGLKDAVFDGSSCISPTIVQQFGYQRRASDDGKLTDSSKTSNTIRVFLPN
hide sequence
RefSeq Acc Id:
XP_008761440 ⟸ XM_008763218
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I5ZWZ7 (UniProtKB/TrEMBL), A0A8L2Q6F4 (UniProtKB/TrEMBL)
- Sequence:
MEHIQGAWKTISNGFGLKDAVFDGSSCISPTIVQQFGYQRRASDDGKLTDSSKTSNTIRVFLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLQEHKGKKARLDWNTDAASLIGEELQV
hide sequence
Ensembl Acc Id:
ENSRNOP00000013831 ⟸ ENSRNOT00000013831
RefSeq Acc Id:
XP_038962984 ⟸ XM_039107056
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I5ZWZ7 (UniProtKB/TrEMBL), A0A8L2Q6F4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038962985 ⟸ XM_039107057
- Peptide Label:
isoform X2
- UniProtKB:
P11345 (UniProtKB/Swiss-Prot), A6IKZ0 (UniProtKB/TrEMBL), A0A8L2Q6F4 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000094673 ⟸ ENSRNOT00000119226
Ensembl Acc Id:
ENSRNOP00000082418 ⟸ ENSRNOT00000105918
Ensembl Acc Id:
ENSRNOP00000092271 ⟸ ENSRNOT00000109662
RefSeq Acc Id:
XP_063141628 ⟸ XM_063285558
- Peptide Label:
isoform X2
- UniProtKB:
P11345 (UniProtKB/Swiss-Prot), A6IKZ0 (UniProtKB/TrEMBL), A0A8L2Q6F4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063141630 ⟸ XM_063285560
- Peptide Label:
isoform X4
- UniProtKB:
A0A8L2Q6F4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063141629 ⟸ XM_063285559
- Peptide Label:
isoform X3
- UniProtKB:
A0A8L2Q6F4 (UniProtKB/TrEMBL)
RGD ID: 13693324 Promoter ID: EPDNEW_R3849 Type: initiation region Name: Raf1_1 Description: Raf-1 proto-oncogene, serine/threonine kinase SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 4 147,592,708 - 147,592,768 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-03-16
Raf1
Raf-1 proto-oncogene, serine/threonine kinase
Raf1
v-raf-leukemia viral oncogene 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-05-15
Raf1
v-raf-leukemia viral oncogene 1
Raf1
v-raf-1 murine leukemia viral oncogene homolog 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-11-17
Raf1
v-raf-1 murine leukemia viral oncogene homolog 1
murine leukemia viral (v-raf-1) oncogene homolog 1 (3611-MSV)
Name updated
1299863 APPROVED
2002-06-10
Raf1
v-raf-1 murine leukemia viral oncogene homolog 1
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_function
phosphorylates Map2k1 and Mek2
70317
gene_function
phosphorylates Map2k1 and Mek2
70441
gene_process
may activate Mapk1 and Mapk3 in fetal heart development
70317
gene_process
may activate Mapk1 and Mapk3 in fetal heart development
70441
