Symbol:
Psmc2
Name:
proteasome 26S subunit, ATPase 2
RGD ID:
3428
Description:
Enables TBP-class protein binding activity. Predicted to be involved in proteasome-mediated ubiquitin-dependent protein catabolic process. Predicted to be located in P-body and cytosol. Predicted to be part of proteasome regulatory particle, base subcomplex. Orthologous to human PSMC2 (proteasome 26S subunit, ATPase 2); PARTICIPATES IN ubiquitin/proteasome degradation pathway; INTERACTS WITH (+)-schisandrin B; 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
26S protease regulatory subunit 7; 26S proteasome AAA-ATPase subunit RPT1; 26S proteasome regulatory subunit 7; MSS1; proteasome (prosome, macropain) 26S subunit, ATPase 2; proteasome 26S subunit ATPase 2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PSMC2 (proteasome 26S subunit, ATPase 2) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Psmc2 (proteasome (prosome, macropain) 26S subunit, ATPase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Psmc2 (proteasome 26S subunit, ATPase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PSMC2 (proteasome 26S subunit, ATPase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PSMC2 (proteasome 26S subunit, ATPase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Psmc2 (proteasome 26S subunit, ATPase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PSMC2 (proteasome 26S subunit, ATPase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PSMC2 (proteasome 26S subunit, ATPase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Psmc2 (proteasome 26S subunit, ATPase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
PSMC2 (proteasome 26S subunit, ATPase 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Mus musculus (house mouse):
Psmc2 (proteasome (prosome, macropain) 26S subunit, ATPase 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
psmc2 (proteasome 26S subunit, ATPase 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
rpt-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
RPT1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Rpt1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
psmc2
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 14,148,080 - 14,162,390 (-) NCBI GRCr8 mRatBN7.2 4 13,255,850 - 13,270,160 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 13,255,856 - 13,270,185 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 18,401,118 - 18,415,400 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 14,215,883 - 14,230,158 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 12,586,755 - 12,601,037 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 9,867,132 - 9,881,383 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 9,867,101 - 9,881,484 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 9,868,269 - 9,882,520 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 8,704,100 - 8,718,351 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 8,704,099 - 8,718,351 (-) NCBI Celera 4 8,847,110 - 8,861,246 (-) NCBI Celera Cytogenetic Map 4 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Psmc2 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of PSMC2 mRNA] CTD PMID:31150632 Psmc2 Rat (1->4)-beta-D-glucan multiple interactions ISO Psmc2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PSMC2 mRNA CTD PMID:36331819 Psmc2 Rat (S)-nicotine multiple interactions ISO Psmc2 (Mus musculus) 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Psmc2 Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine decreases expression ISO Psmc2 (Mus musculus) 6480464 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Psmc2 Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine multiple interactions ISO Psmc2 (Mus musculus) 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Psmc2 Rat 17alpha-ethynylestradiol increases expression ISO Psmc2 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of PSMC2 mRNA CTD PMID:17942748 Psmc2 Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of PSMC2 mRNA CTD PMID:29097150 Psmc2 Rat 17alpha-ethynylestradiol multiple interactions ISO Psmc2 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PSMC2 mRNA CTD PMID:17942748 Psmc2 Rat 17alpha-ethynylestradiol affects expression ISO Psmc2 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of PSMC2 mRNA CTD PMID:17555576 Psmc2 Rat 17beta-estradiol increases expression ISO Psmc2 (Mus musculus) 6480464 Estradiol results in increased expression of PSMC2 mRNA CTD PMID:39298647 Psmc2 Rat 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one multiple interactions ISO PSMC2 (Homo sapiens) 6480464 Metribolone promotes the reaction [NDRG1 protein binds to PSMC2 protein] CTD PMID:17220478 Psmc2 Rat 1H-pyrazole increases expression ISO Psmc2 (Mus musculus) 6480464 pyrazole results in increased expression of PSMC2 mRNA CTD PMID:17945193 Psmc2 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Psmc2 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Psmc2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Psmc2 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PSMC2 mRNA CTD PMID:17942748 Psmc2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Psmc2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PSMC2 mRNA CTD PMID:21570461 Psmc2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Psmc2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of PSMC2 mRNA CTD PMID:17942748 and PMID:19465110 Psmc2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PSMC2 mRNA and Tetrachlorodibenzodioxin results in increased expression of PSMC2 protein CTD PMID:19201780 and PMID:26232522 Psmc2 Rat 2,6-dimethoxyphenol multiple interactions ISO PSMC2 (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1 and 3-dimethyl ether] results in decreased expression of and affects the localization of PSMC2 protein CTD PMID:38598786 Psmc2 Rat 2-amino-14,16-dimethyloctadecan-3-ol decreases expression ISO PSMC2 (Homo sapiens) 6480464 2-amino-14 and 16-dimethyloctadecan-3-ol results in decreased expression of PSMC2 protein CTD PMID:32044396 Psmc2 Rat 2-bromohexadecanoic acid multiple interactions ISO PSMC2 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of PSMC2 protein] CTD PMID:38195004 Psmc2 Rat 2-hydroxypropanoic acid decreases expression ISO PSMC2 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of PSMC2 mRNA CTD PMID:30851411 Psmc2 Rat 2-nitrofluorene increases expression EXP 6480464 2-nitrofluorene results in increased expression of PSMC2 mRNA CTD PMID:15890375 Psmc2 Rat 3H-1,2-dithiole-3-thione increases expression ISO Psmc2 (Mus musculus) 6480464 1 and 2-dithiol-3-thione results in increased expression of PSMC2 mRNA CTD PMID:15375163 Psmc2 Rat 4,4'-diaminodiphenylmethane decreases expression ISO Psmc2 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of PSMC2 mRNA CTD PMID:18648102 Psmc2 Rat 4,4'-sulfonyldiphenol increases expression ISO Psmc2 (Mus musculus) 6480464 bisphenol S results in increased expression of PSMC2 mRNA CTD PMID:39298647 Psmc2 Rat 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one increases expression EXP 6480464 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone results in increased expression of PSMC2 mRNA CTD PMID:15890375 Psmc2 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of PSMC2 mRNA CTD PMID:30047161 Psmc2 Rat acrylamide increases expression ISO PSMC2 (Homo sapiens) 6480464 Acrylamide results in increased expression of PSMC2 mRNA CTD PMID:32763439 Psmc2 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of PSMC2 mRNA CTD PMID:15890375 Psmc2 Rat aflatoxin B1 increases expression ISO Psmc2 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of PSMC2 mRNA CTD PMID:19770486 Psmc2 Rat all-trans-retinoic acid decreases expression ISO PSMC2 (Homo sapiens) 6480464 Tretinoin results in decreased expression of PSMC2 mRNA CTD PMID:17218384 Psmc2 Rat all-trans-retinoic acid multiple interactions ISO PSMC2 (Homo sapiens) 6480464 [Tretinoin co-treated with arsenic trioxide] results in increased expression of PSMC2 mRNA CTD PMID:15894607 Psmc2 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of PSMC2 mRNA CTD PMID:30047161 Psmc2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PSMC2 mRNA CTD PMID:16483693 Psmc2 Rat arsane affects methylation ISO PSMC2 (Homo sapiens) 6480464 Arsenic affects the methylation of PSMC2 gene CTD PMID:25304211 Psmc2 Rat arsane multiple interactions ISO PSMC2 (Homo sapiens) 6480464 [arsenic trichloride results in increased abundance of Arsenic] which results in decreased expression of PSMC2 mRNA CTD PMID:35809665 Psmc2 Rat arsenic atom affects methylation ISO PSMC2 (Homo sapiens) 6480464 Arsenic affects the methylation of PSMC2 gene CTD PMID:25304211 Psmc2 Rat arsenic atom multiple interactions ISO PSMC2 (Homo sapiens) 6480464 [arsenic trichloride results in increased abundance of Arsenic] which results in decreased expression of PSMC2 mRNA CTD PMID:35809665 Psmc2 Rat arsenic trichloride multiple interactions ISO PSMC2 (Homo sapiens) 6480464 [arsenic trichloride results in increased abundance of Arsenic] which results in decreased expression of PSMC2 mRNA CTD PMID:35809665 Psmc2 Rat arsenite(3-) multiple interactions ISO PSMC2 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to PSMC2 protein] CTD PMID:32406909 Psmc2 Rat arsenous acid multiple interactions ISO PSMC2 (Homo sapiens) 6480464 [Tretinoin co-treated with Arsenic Trioxide] results in increased expression of PSMC2 mRNA CTD PMID:15894607 Psmc2 Rat arsenous acid decreases expression ISO PSMC2 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of PSMC2 protein CTD PMID:19364129 Psmc2 Rat azoxystrobin multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of PSMC2 mRNA CTD PMID:33854195 Psmc2 Rat benzo[a]pyrene increases expression ISO PSMC2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of PSMC2 protein CTD PMID:20097212 Psmc2 Rat benzo[a]pyrene increases expression ISO Psmc2 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of PSMC2 mRNA CTD PMID:21715664 and PMID:22228805 Psmc2 Rat benzo[a]pyrene diol epoxide I decreases expression ISO PSMC2 (Homo sapiens) 6480464 7 more ... CTD PMID:20018196 Psmc2 Rat beta-naphthoflavone increases expression ISO PSMC2 (Homo sapiens) 6480464 beta-Naphthoflavone results in increased expression of PSMC2 mRNA CTD PMID:19737606 Psmc2 Rat bexarotene increases expression EXP 6480464 bexarotene results in increased expression of PSMC2 mRNA CTD PMID:16648578 Psmc2 Rat bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of PSMC2 mRNA CTD PMID:21318169 Psmc2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PSMC2 mRNA CTD PMID:25181051 Psmc2 Rat bisphenol A decreases expression ISO PSMC2 (Homo sapiens) 6480464 bisphenol A results in decreased expression of PSMC2 mRNA CTD PMID:36232920 Psmc2 Rat bisphenol A increases expression ISO PSMC2 (Homo sapiens) 6480464 bisphenol A results in increased expression of PSMC2 mRNA CTD PMID:36232920 Psmc2 Rat Bisphenol B increases expression ISO PSMC2 (Homo sapiens) 6480464 bisphenol B results in increased expression of PSMC2 protein CTD PMID:34186270 Psmc2 Rat Brodifacoum decreases expression EXP 6480464 bromfenacoum results in decreased expression of PSMC2 protein CTD PMID:28903499 Psmc2 Rat butyric acid decreases expression ISO PSMC2 (Homo sapiens) 6480464 Butyric Acid results in decreased expression of PSMC2 mRNA and Butyric Acid results in decreased expression of PSMC2 protein CTD PMID:34581912 Psmc2 Rat cadmium atom multiple interactions ISO PSMC2 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of PSMC2 protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of PSMC2 protein CTD PMID:38195004 Psmc2 Rat cadmium dichloride increases methylation EXP 6480464 Cadmium Chloride results in increased methylation of PSMC2 promoter CTD PMID:22457795 Psmc2 Rat cadmium dichloride multiple interactions ISO PSMC2 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of PSMC2 protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of PSMC2 protein CTD PMID:38195004 Psmc2 Rat cadmium dichloride increases expression ISO PSMC2 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of PSMC2 mRNA CTD PMID:38568856 Psmc2 Rat chloropicrin increases expression ISO PSMC2 (Homo sapiens) 6480464 chloropicrin results in increased expression of PSMC2 mRNA CTD PMID:26352163 Psmc2 Rat chlorpyrifos multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of PSMC2 mRNA CTD PMID:33854195 Psmc2 Rat chlorpyrifos decreases expression ISO Psmc2 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of PSMC2 mRNA CTD PMID:37019170 Psmc2 Rat chromium(6+) increases expression ISO PSMC2 (Homo sapiens) 6480464 chromium hexavalent ion results in increased expression of PSMC2 protein CTD PMID:28596144 Psmc2 Rat copper(II) sulfate decreases expression ISO PSMC2 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of PSMC2 mRNA CTD PMID:19549813 Psmc2 Rat cyclosporin A increases expression ISO PSMC2 (Homo sapiens) 6480464 Cyclosporine results in increased expression of PSMC2 mRNA CTD PMID:20106945 Psmc2 Rat diarsenic trioxide multiple interactions ISO PSMC2 (Homo sapiens) 6480464 [Tretinoin co-treated with Arsenic Trioxide] results in increased expression of PSMC2 mRNA CTD PMID:15894607 Psmc2 Rat diarsenic trioxide decreases expression ISO PSMC2 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of PSMC2 protein CTD PMID:19364129 Psmc2 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of PSMC2 mRNA CTD PMID:21266533 Psmc2 Rat dichlorine multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in decreased expression of PSMC2 mRNA CTD PMID:18636392 Psmc2 Rat dicrotophos decreases expression ISO PSMC2 (Homo sapiens) 6480464 dicrotophos results in decreased expression of PSMC2 mRNA CTD PMID:28302478 Psmc2 Rat diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of PSMC2 mRNA CTD PMID:15890375 Psmc2 Rat doxorubicin increases expression ISO PSMC2 (Homo sapiens) 6480464 Doxorubicin results in increased expression of PSMC2 mRNA CTD PMID:29803840 Psmc2 Rat ethanol increases expression ISO Psmc2 (Mus musculus) 6480464 Ethanol results in increased expression of PSMC2 mRNA CTD PMID:30319688 Psmc2 Rat ethanol affects splicing ISO Psmc2 (Mus musculus) 6480464 Ethanol affects the splicing of PSMC2 mRNA CTD PMID:30319688 Psmc2 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of PSMC2 mRNA CTD PMID:24136188 Psmc2 Rat flavonoids decreases expression EXP 6480464 Flavonoids results in decreased expression of PSMC2 mRNA CTD PMID:18035473 Psmc2 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of PSMC2 mRNA CTD PMID:24136188 Psmc2 Rat furfural multiple interactions ISO PSMC2 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of PSMC2 protein and [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of PSMC2 protein CTD PMID:38598786 Psmc2 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of PSMC2 mRNA CTD PMID:22061828 Psmc2 Rat glyphosate multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of PSMC2 mRNA CTD PMID:33854195 Psmc2 Rat hyaluronic acid multiple interactions EXP 6480464 Hyaluronic Acid analog inhibits the reaction [Hydrogen Peroxide results in decreased expression of PSMC2 protein] CTD PMID:23178681 Psmc2 Rat hydrogen peroxide affects expression ISO PSMC2 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of PSMC2 mRNA CTD PMID:20044591 Psmc2 Rat hydrogen peroxide increases expression ISO PSMC2 (Homo sapiens) 6480464 Hydrogen Peroxide results in increased expression of PSMC2 mRNA and Hydrogen Peroxide results in increased expression of PSMC2 protein CTD PMID:34581912 Psmc2 Rat hydrogen peroxide decreases expression EXP 6480464 Hydrogen Peroxide results in decreased expression of PSMC2 protein CTD PMID:23178681 Psmc2 Rat hydrogen peroxide multiple interactions EXP 6480464 Hyaluronic Acid analog inhibits the reaction [Hydrogen Peroxide results in decreased expression of PSMC2 protein] CTD PMID:23178681 Psmc2 Rat hypochlorous acid increases expression ISO Psmc2 (Mus musculus) 6480464 Hypochlorous Acid results in increased expression of PSMC2 mRNA CTD PMID:19376150 Psmc2 Rat imidacloprid multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of PSMC2 mRNA CTD PMID:33854195 Psmc2 Rat ivermectin decreases expression ISO PSMC2 (Homo sapiens) 6480464 Ivermectin results in decreased expression of PSMC2 protein CTD PMID:32959892 Psmc2 Rat ketoconazole decreases expression ISO PSMC2 (Homo sapiens) 6480464 Ketoconazole results in decreased expression of PSMC2 mRNA CTD PMID:36621641 Psmc2 Rat lead(0) affects expression ISO PSMC2 (Homo sapiens) 6480464 Lead affects the expression of PSMC2 mRNA CTD PMID:28903495 Psmc2 Rat lovastatin decreases expression ISO Psmc2 (Mus musculus) 6480464 Lovastatin results in decreased expression of PSMC2 mRNA CTD PMID:20493250 Psmc2 Rat Mesaconitine decreases expression EXP 6480464 mesaconitine results in decreased expression of PSMC2 protein CTD PMID:37182599 Psmc2 Rat methapyrilene increases expression EXP 6480464 Methapyrilene results in increased expression of PSMC2 mRNA CTD PMID:15890375 Psmc2 Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of PSMC2 protein CTD PMID:30467583 Psmc2 Rat methidathion decreases expression ISO Psmc2 (Mus musculus) 6480464 methidathion results in decreased expression of PSMC2 mRNA CTD PMID:34813904 Psmc2 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of PSMC2 mRNA CTD PMID:30047161 Psmc2 Rat methyl methanesulfonate increases expression ISO PSMC2 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of PSMC2 mRNA CTD PMID:23649840 Psmc2 Rat monocrotaline increases expression EXP 6480464 Monocrotaline results in increased expression of PSMC2 mRNA CTD PMID:18801959 Psmc2 Rat monosodium L-glutamate multiple interactions ISO Psmc2 (Mus musculus) 6480464 [Trans Fatty Acids co-treated with Sodium Glutamate] results in increased expression of PSMC2 mRNA CTD PMID:22078008 Psmc2 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal increases expression ISO PSMC2 (Homo sapiens) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased expression of PSMC2 mRNA CTD PMID:31806706 Psmc2 Rat N-ethyl-N-nitrosourea increases mutagenesis ISO Psmc2 (Mus musculus) 6480464 Ethylnitrosourea results in increased mutagenesis of PSMC2 intron CTD PMID:27776689 Psmc2 Rat N-nitrosodimethylamine increases expression EXP 6480464 Dimethylnitrosamine results in increased expression of PSMC2 mRNA CTD PMID:15890375 Psmc2 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of PSMC2 mRNA CTD PMID:24136188 Psmc2 Rat nicotine multiple interactions ISO Psmc2 (Mus musculus) 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Psmc2 Rat Nonylphenol decreases expression EXP 6480464 nonylphenol results in decreased expression of PSMC2 protein CTD PMID:19260726 Psmc2 Rat ozone multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in decreased expression of PSMC2 mRNA CTD PMID:18636392 Psmc2 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of PSMC2 protein CTD PMID:16538041 Psmc2 Rat paracetamol decreases expression ISO PSMC2 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of PSMC2 mRNA CTD PMID:21420995 and PMID:26497421 Psmc2 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Psmc2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PSMC2 mRNA CTD PMID:36331819 Psmc2 Rat perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of PSMC2 mRNA CTD PMID:19162173 and PMID:21318169 Psmc2 Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of PSMC2 mRNA CTD PMID:19162173 Psmc2 Rat phorbol 13-acetate 12-myristate increases expression ISO Psmc2 (Mus musculus) 6480464 Tetradecanoylphorbol Acetate results in increased expression of PSMC2 protein CTD PMID:16343552 Psmc2 Rat piperonyl butoxide increases expression EXP 6480464 Piperonyl Butoxide results in increased expression of PSMC2 mRNA CTD PMID:15890375 and PMID:22484513 Psmc2 Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of PSMC2 mRNA CTD PMID:15890375 Psmc2 Rat piroxicam decreases expression ISO PSMC2 (Homo sapiens) 6480464 Piroxicam results in decreased expression of PSMC2 mRNA CTD PMID:21858171 Psmc2 Rat Propiverine affects binding EXP 6480464 propiverine binds to PSMC2 protein CTD PMID:29273565 Psmc2 Rat rac-lactic acid decreases expression ISO PSMC2 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of PSMC2 mRNA CTD PMID:30851411 Psmc2 Rat resveratrol multiple interactions ISO PSMC2 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of PSMC2 mRNA CTD PMID:23557933 Psmc2 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of PSMC2 protein CTD PMID:35544339 Psmc2 Rat sodium arsenite increases expression ISO PSMC2 (Homo sapiens) 6480464 sodium arsenite results in increased expression of PSMC2 mRNA CTD PMID:38568856 Psmc2 Rat sodium arsenite multiple interactions ISO PSMC2 (Homo sapiens) 6480464 sodium arsenite promotes the reaction [PSMC2 protein binds to CAPRIN1 protein] CTD PMID:33939924 Psmc2 Rat sodium chloride multiple interactions ISO PSMC2 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of PSMC2 protein more ... CTD PMID:38598786 Psmc2 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of PSMC2 mRNA CTD PMID:30047161 Psmc2 Rat sulindac increases expression EXP 6480464 Sulindac results in increased expression of PSMC2 mRNA CTD PMID:24136188 Psmc2 Rat sulindac sulfide decreases expression ISO PSMC2 (Homo sapiens) 6480464 sulindac sulfide results in decreased expression of PSMC2 mRNA CTD PMID:16184548 Psmc2 Rat sunitinib decreases expression ISO PSMC2 (Homo sapiens) 6480464 Sunitinib results in decreased expression of PSMC2 mRNA CTD PMID:31533062 Psmc2 Rat T-2 toxin increases expression ISO PSMC2 (Homo sapiens) 6480464 T-2 Toxin results in increased expression of PSMC2 mRNA and T-2 Toxin results in increased expression of PSMC2 protein CTD PMID:34581912 Psmc2 Rat tamoxifen affects expression ISO Psmc2 (Mus musculus) 6480464 Tamoxifen affects the expression of PSMC2 mRNA CTD PMID:17555576 Psmc2 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of PSMC2 mRNA] CTD PMID:31150632 Psmc2 Rat tetrachloromethane increases expression ISO Psmc2 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of PSMC2 mRNA CTD PMID:31919559 Psmc2 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of PSMC2 mRNA CTD PMID:31150632 Psmc2 Rat thiabendazole multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of PSMC2 mRNA CTD PMID:33854195 Psmc2 Rat thiram increases expression ISO PSMC2 (Homo sapiens) 6480464 Thiram results in increased expression of PSMC2 mRNA CTD PMID:38568856 Psmc2 Rat trichostatin A decreases expression ISO PSMC2 (Homo sapiens) 6480464 trichostatin A results in decreased expression of PSMC2 mRNA CTD PMID:24935251 Psmc2 Rat valdecoxib increases expression EXP 6480464 valdecoxib results in increased expression of PSMC2 mRNA CTD PMID:24136188 Psmc2 Rat valproic acid affects expression ISO Psmc2 (Mus musculus) 6480464 Valproic Acid affects the expression of PSMC2 mRNA CTD PMID:17292431 Psmc2 Rat valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of PSMC2 mRNA CTD PMID:21318169 Psmc2 Rat valproic acid increases expression ISO PSMC2 (Homo sapiens) 6480464 Valproic Acid results in increased expression of PSMC2 mRNA CTD PMID:23179753 Psmc2 Rat valproic acid affects expression ISO PSMC2 (Homo sapiens) 6480464 Valproic Acid affects the expression of PSMC2 mRNA CTD PMID:25979313 Psmc2 Rat warfarin decreases expression ISO Psmc2 (Mus musculus) 6480464 Warfarin results in decreased expression of PSMC2 mRNA CTD PMID:20493250 Psmc2 Rat zearalenone decreases expression ISO Psmc2 (Mus musculus) 6480464 Zearalenone results in decreased expression of PSMC2 protein CTD PMID:36252740
Imported Annotations - KEGG (archival)
(+)-schisandrin B (EXP) (1->4)-beta-D-glucan (ISO) (S)-nicotine (ISO) 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (ISO) 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO) 1H-pyrazole (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,6-dimethoxyphenol (ISO) 2-amino-14,16-dimethyloctadecan-3-ol (ISO) 2-bromohexadecanoic acid (ISO) 2-hydroxypropanoic acid (ISO) 2-nitrofluorene (EXP) 3H-1,2-dithiole-3-thione (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (EXP) 6-propyl-2-thiouracil (EXP) acrylamide (ISO) aflatoxin B1 (EXP,ISO) all-trans-retinoic acid (ISO) amitrole (EXP) ammonium chloride (EXP) arsane (ISO) arsenic atom (ISO) arsenic trichloride (ISO) arsenite(3-) (ISO) arsenous acid (ISO) azoxystrobin (EXP) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) beta-naphthoflavone (ISO) bexarotene (EXP) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) Bisphenol B (ISO) Brodifacoum (EXP) butyric acid (ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) chloropicrin (ISO) chlorpyrifos (EXP,ISO) chromium(6+) (ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) diarsenic trioxide (ISO) dibutyl phthalate (EXP) dichlorine (EXP) dicrotophos (ISO) diethylstilbestrol (EXP) doxorubicin (ISO) ethanol (ISO) finasteride (EXP) flavonoids (EXP) flutamide (EXP) furfural (ISO) gentamycin (EXP) glyphosate (EXP) hyaluronic acid (EXP) hydrogen peroxide (EXP,ISO) hypochlorous acid (ISO) imidacloprid (EXP) ivermectin (ISO) ketoconazole (ISO) lead(0) (ISO) lovastatin (ISO) Mesaconitine (EXP) methapyrilene (EXP) methidathion (ISO) methimazole (EXP) methyl methanesulfonate (ISO) monocrotaline (EXP) monosodium L-glutamate (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) N-ethyl-N-nitrosourea (ISO) N-nitrosodimethylamine (EXP) nefazodone (EXP) nicotine (ISO) Nonylphenol (EXP) ozone (EXP) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP) phenobarbital (EXP) phorbol 13-acetate 12-myristate (ISO) piperonyl butoxide (EXP) pirinixic acid (EXP) piroxicam (ISO) Propiverine (EXP) rac-lactic acid (ISO) resveratrol (ISO) rotenone (EXP) sodium arsenite (ISO) sodium chloride (ISO) sulfadimethoxine (EXP) sulindac (EXP) sulindac sulfide (ISO) sunitinib (ISO) T-2 toxin (ISO) tamoxifen (ISO) tetrachloromethane (EXP,ISO) thiabendazole (EXP) thiram (ISO) trichostatin A (ISO) valdecoxib (EXP) valproic acid (EXP,ISO) warfarin (ISO) zearalenone (ISO)
1.
Activity-dependent dynamics and sequestration of proteasomes in dendritic spines.
Bingol B and Schuman EM, Nature. 2006 Jun 29;441(7097):1144-8.
2.
Participation of the 26S proteasome in the regulation of progesterone receptor concentrations in the rat brain.
Camacho-Arroyo I, etal., Neuroendocrinology 2002 Nov;76(5):267-71.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
5.
Structures of the rat proteasomal ATPases: determination of highly conserved structural motifs and rules for their spacing.
Makino Y, etal., Biochem Biophys Res Commun 1996 Mar 27;220(3):1049-54.
6.
Multiple mammalian proteasomal ATPases, but not proteasome itself, are associated with TATA-binding protein and a novel transcriptional activator, TIP120.
Makino Y, etal., Genes Cells. 1999 Sep;4(9):529-39.
7.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
8.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
10.
GOA pipeline
RGD automated data pipeline
11.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
12.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
13.
Tissue and cell distribution of a mammalian proteasomal ATPase, MSS1, and its complex formation with the basal transcription factors.
Yanagi S, etal., Biochem Biophys Res Commun. 2000 Dec 20;279(2):568-73.
Psmc2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 14,148,080 - 14,162,390 (-) NCBI GRCr8 mRatBN7.2 4 13,255,850 - 13,270,160 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 13,255,856 - 13,270,185 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 18,401,118 - 18,415,400 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 14,215,883 - 14,230,158 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 12,586,755 - 12,601,037 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 9,867,132 - 9,881,383 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 9,867,101 - 9,881,484 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 9,868,269 - 9,882,520 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 8,704,100 - 8,718,351 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 8,704,099 - 8,718,351 (-) NCBI Celera 4 8,847,110 - 8,861,246 (-) NCBI Celera Cytogenetic Map 4 q11 NCBI
PSMC2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 7 103,347,524 - 103,369,395 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 7 103,328,570 - 103,370,346 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 7 102,987,971 - 103,009,842 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 7 102,775,325 - 102,795,892 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 7 102,582,039 - 102,602,606 NCBI Celera 7 97,795,300 - 97,815,873 (+) NCBI Celera Cytogenetic Map 7 q22.1 NCBI HuRef 7 97,350,323 - 97,372,344 (+) NCBI HuRef CHM1_1 7 102,920,963 - 102,943,153 (+) NCBI CHM1_1 T2T-CHM13v2.0 7 104,661,962 - 104,683,844 (+) NCBI T2T-CHM13v2.0 CRA_TCAGchr7v2 7 102,348,337 - 102,370,208 (+) NCBI
Psmc2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 21,990,273 - 22,008,785 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 21,990,281 - 22,008,785 (+) Ensembl GRCm39 Ensembl GRCm38 5 21,785,275 - 21,803,787 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 21,785,283 - 21,803,787 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 21,291,101 - 21,309,602 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 21,297,107 - 21,315,608 (+) NCBI MGSCv36 mm8 Celera 5 18,756,208 - 18,774,395 (+) NCBI Celera Cytogenetic Map 5 A3 NCBI cM Map 5 9.97 NCBI
Psmc2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955410 8,341,065 - 8,356,148 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955410 8,341,218 - 8,355,515 (+) NCBI ChiLan1.0 ChiLan1.0
PSMC2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 6 140,201,706 - 140,227,300 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 7 188,473,396 - 188,497,270 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 7 95,338,743 - 95,359,353 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 7 108,083,019 - 108,103,595 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 7 108,083,203 - 108,103,494 (+) Ensembl panpan1.1 panPan2
PSMC2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 18 16,845,593 - 16,859,010 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 18 16,845,594 - 16,858,911 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 18 16,488,537 - 16,501,956 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 18 17,136,145 - 17,149,599 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 18 17,136,146 - 17,149,526 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 18 16,900,975 - 16,914,588 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 18 16,839,559 - 16,853,208 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 18 17,107,769 - 17,121,439 (-) NCBI UU_Cfam_GSD_1.0
Psmc2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 59,026,969 - 59,043,987 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936479 20,148,632 - 20,168,130 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936479 20,150,738 - 20,167,765 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PSMC2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 103,362,599 - 103,376,343 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 103,362,684 - 103,376,048 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 113,971,194 - 113,984,560 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PSMC2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 21 72,323,691 - 72,341,647 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 21 72,323,803 - 72,341,488 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666042 31,660,968 - 31,679,446 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Psmc2
.
Predicted Target Of
Count of predictions: 53 Count of miRNA genes: 49 Interacting mature miRNAs: 51 Transcripts: ENSRNOT00000016450 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2302371 Stl22 Serum triglyceride level QTL 22 5.15 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 4 5218294 57114705 Rat 8552903 Pigfal2 Plasma insulin-like growth factor 1 level QTL 2 7.3 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 4 1 31934116 Rat 724557 Plsm1 Polydactyly-luxate syndrome (PLS) morphotypes QTL 1 0.0003 forelimb integrity trait (VT:0010562) front foot phalanges count (CMO:0001947) 4 1 27716890 Rat 9590100 Sffal4 Serum free fatty acids level QTL 4 7.36 0.05 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 4 1 31934116 Rat 8552906 Pigfal3 Plasma insulin-like growth factor 1 level QTL 3 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 4 10084089 55084089 Rat 1357341 Gluco5 Glucose level QTL 5 6.4 adipocyte free fatty acid secretion trait (VT:0010465) absolute change in adipocyte free fatty acid secretion per unit volume (CMO:0001446) 4 1 33250345 Rat 1357343 Gluco4 Glucose level QTL 4 0.00002 adipocyte glucose uptake trait (VT:0004185) adipocyte maximal glucose uptake to basal glucose uptake ratio (CMO:0000874) 4 1 33250345 Rat 6478766 Anxrr47 Anxiety related response QTL 47 0.09637 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 4 10084089 55084089 Rat 631642 Stl2 Serum triglyceride level QTL 2 3.3 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 4 5219178 56647776 Rat 6478769 Anxrr48 Anxiety related response QTL 48 0.02514 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 10084089 55084089 Rat 631261 Tcas3 Tongue tumor susceptibility QTL 3 6.88 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 4 10814170 91360527 Rat 61333 Gluco16 Glucose level QTL 16 4.3 0.00001 adipocyte glucose uptake trait (VT:0004185) absolute change in adipocyte glucose uptake (CMO:0000873) 4 1 30372989 Rat 634323 Hc2 Hypercalciuria QTL 2 2.15 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 4 210796 45210796 Rat 61408 Scl23 Serum cholesterol level QTL 23 0.0005 blood HDL phospholipid amount (VT:0010504) serum high density lipoprotein phospholipid level (CMO:0001567) 4 1 27716890 Rat 631209 Bw2 Body weight QTL2 4.2 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 4 9940885 44463908 Rat 8694374 Bw155 Body weight QTL 155 3.39 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 4 10084089 55084089 Rat 2303168 Bp330 Blood pressure QTL 330 4.25 0.017 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 5214602 146446691 Rat 9589046 Scfw2 Subcutaneous fat weight QTL 2 5.54 0.001 subcutaneous adipose mass (VT:1000472) abdominal subcutaneous fat pad weight (CMO:0002069) 4 1 31934116 Rat 6478724 Anxrr35 Anxiety related response QTL 35 0.00449 defecation behavior trait (VT:0010462) defecation measurement (CMO:0000997) 4 10084089 55084089 Rat 61351 Bp33 Blood pressure QTL 33 0.0018 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 1 27716890 Rat 61415 Eae11 Experimental allergic encephalomyelitis QTL 11 2.9 nervous system integrity trait (VT:0010566) post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422) 4 1 39505420 Rat 1641905 Colcr1 Colorectal carcinoma resistance QTL 1 4.3 0.0003 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 4 1 29494328 Rat 619616 Bp79 Blood pressure QTL 79 0.0292 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 5214602 78882945 Rat 1358201 Gluco12 Glucose level QTL12 1.6 adipocyte glucose uptake trait (VT:0004185) adipocyte maximal glucose uptake (CMO:0000870) 4 5218392 29593287 Rat 738021 Hcar13 Hepatocarcinoma resistance QTL 13 4.3 liver integrity trait (VT:0010547) liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464) 4 1 32584199 Rat 1358203 Stl19 Serum triglyceride level QTL 19 2.8 0.002 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 4 5218294 65958103 Rat 9590304 Scort17 Serum corticosterone level QTL 17 4.96 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 10084089 55084089 Rat 9589097 Slep11 Serum leptin concentration QTL 11 5.09 0.001 blood leptin amount (VT:0005667) plasma leptin level (CMO:0000781) 4 1 31934116 Rat 2316958 Gluco58 Glucose level QTL 58 10 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 11320076 180699135 Rat 1300141 Bp178 Blood pressure QTL 178 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 10024901 39524530 Rat
RH142410
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 13,255,880 - 13,256,039 (+) MAPPER mRatBN7.2 Rnor_6.0 4 9,867,162 - 9,867,320 NCBI Rnor6.0 Rnor_5.0 4 9,868,299 - 9,868,457 UniSTS Rnor5.0 RGSC_v3.4 4 8,704,130 - 8,704,288 UniSTS RGSC3.4 Celera 4 8,847,140 - 8,847,298 UniSTS Cytogenetic Map 4 q11 UniSTS
RH142567
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 13,263,934 - 13,264,045 (+) MAPPER mRatBN7.2 Rnor_6.0 4 9,875,216 - 9,875,326 NCBI Rnor6.0 Rnor_5.0 4 9,876,353 - 9,876,463 UniSTS Rnor5.0 RGSC_v3.4 4 8,712,184 - 8,712,294 UniSTS RGSC3.4 Celera 4 8,855,194 - 8,855,304 UniSTS Cytogenetic Map 4 q11 UniSTS
RH140841
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 13,255,879 - 13,256,072 (+) MAPPER mRatBN7.2 Rnor_6.0 4 9,867,161 - 9,867,353 NCBI Rnor6.0 Rnor_5.0 4 9,868,298 - 9,868,490 UniSTS Rnor5.0 RGSC_v3.4 4 8,704,129 - 8,704,321 UniSTS RGSC3.4 Celera 4 8,847,139 - 8,847,331 UniSTS RH 3.4 Map 4 40.0 UniSTS Cytogenetic Map 4 q11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000016450 ⟹ ENSRNOP00000016450
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 13,255,856 - 13,270,185 (-) Ensembl Rnor_6.0 Ensembl 4 9,867,101 - 9,881,484 (-) Ensembl
RefSeq Acc Id:
NM_033236 ⟹ NP_150239
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 14,148,080 - 14,162,390 (-) NCBI mRatBN7.2 4 13,255,850 - 13,270,160 (-) NCBI Rnor_6.0 4 9,867,132 - 9,881,383 (-) NCBI Rnor_5.0 4 9,868,269 - 9,882,520 (-) NCBI RGSC_v3.4 4 8,704,100 - 8,718,351 (-) RGD Celera 4 8,847,110 - 8,861,246 (-) RGD
Sequence:
GGGCTTGCGGCTTCTAAAATGCCGGATTACCTAGGTGCAGACCAGCGGAAAACCAAAGAGGATGAGAAGGACGACAAGCCCATCCGAGCTCTGGATGAAGGGGATATCGCCTTGTTGAAAACTTATGG
hide sequence
RefSeq Acc Id:
NP_150239 ⟸ NM_033236
- UniProtKB:
Q6P7R9 (UniProtKB/Swiss-Prot), Q63347 (UniProtKB/Swiss-Prot), Q62690 (UniProtKB/Swiss-Prot), G3V7L6 (UniProtKB/TrEMBL), A6K5A1 (UniProtKB/TrEMBL)
- Sequence:
MPDYLGADQRKTKEDEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKINELTGIKESDTGLAPPALWDLAADKQTLQSEQPLQVARCTKIINADSEDPKYIINVKQFAKFVVDLSDQ
hide sequence
Ensembl Acc Id:
ENSRNOP00000016450 ⟸ ENSRNOT00000016450
RGD ID: 13692805 Promoter ID: EPDNEW_R3329 Type: multiple initiation site Name: Psmc2_1 Description: proteasome 26S subunit, ATPase 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 4 9,881,413 - 9,881,473 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-08-19
Psmc2
proteasome 26S subunit, ATPase 2
Psmc2
proteasome (prosome, macropain) 26S subunit, ATPase 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Psmc2
Proteasome (prosome, macropain) 26S subunit, ATPase
Symbol and Name status set to approved
70586 APPROVED
