Symbol:
Prkcz
Name:
protein kinase C, zeta
RGD ID:
3399
Description:
Enables several functions, including 14-3-3 protein binding activity; enzyme binding activity; and potassium channel regulator activity. Involved in several processes, including activation of phospholipase D activity; positive regulation of cell communication; and regulation of protein localization. Located in several cellular components, including cell leading edge; perinuclear region of cytoplasm; and stress fiber. Is active in Schaffer collateral - CA1 synapse; glutamatergic synapse; and postsynaptic density. Used to study hyperglycemia. Biomarker of type 2 diabetes mellitus. Orthologous to human PRKCZ (protein kinase C zeta); PARTICIPATES IN angiotensin II signaling pathway; epidermal growth factor/neuregulin signaling pathway; protein kinase C (PKC) signaling pathway; INTERACTS WITH (+)-pilocarpine; 17beta-estradiol; 2,4-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
14 - 3 - 3 - zeta isoform; 14-3-3-zetaisoform; nPKC-zeta; Pkcz; protein kinase C zeta type; r14-3-3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PRKCZ (protein kinase C zeta) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Prkcz (protein kinase C, zeta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Prkcz (protein kinase C zeta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PRKCZ (protein kinase C zeta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PRKCZ (protein kinase C zeta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Prkcz (protein kinase C zeta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PRKCZ (protein kinase C zeta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PRKCZ (protein kinase C zeta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Prkcz (protein kinase C zeta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
PRKCI (protein kinase C iota) HGNC
OrthoDB
Alliance orthologs 3
Homo sapiens (human):
PRKCZ (protein kinase C zeta)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Prkcz (protein kinase C, zeta)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
prkcz (protein kinase C, zeta)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
PKC1
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER)
Drosophila melanogaster (fruit fly):
aPKC
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
pkc-3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
prkcz
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 171,101,774 - 171,212,694 (-) NCBI GRCr8 mRatBN7.2 5 165,817,786 - 165,930,386 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 165,819,466 - 165,930,367 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 168,525,295 - 168,635,221 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 170,346,708 - 170,456,637 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 170,309,234 - 170,419,166 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 172,658,071 - 172,769,492 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 172,658,748 - 172,769,421 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 176,116,787 - 176,228,206 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 172,061,825 - 172,172,793 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 172,072,319 - 172,179,534 (-) NCBI Celera 5 164,023,257 - 164,132,959 (-) NCBI Celera Cytogenetic Map 5 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Prkcz Rat (+)-pilocarpine increases expression EXP 6480464 Pilocarpine results in increased expression of PRKCZ protein CTD PMID:15058486 Prkcz Rat (1->4)-beta-D-glucan multiple interactions ISO Prkcz (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of PRKCZ mRNA CTD PMID:36331819 Prkcz Rat (S)-nicotine multiple interactions ISO PRKCZ (Homo sapiens) 6480464 PRKCZ protein affects the reaction [Nicotine results in increased phosphorylation of BAX protein] CTD PMID:17525161 Prkcz Rat (S)-nicotine increases activity ISO PRKCZ (Homo sapiens) 6480464 Nicotine results in increased activity of PRKCZ protein CTD PMID:17525161 Prkcz Rat 1,1-dichloroethene decreases expression ISO Prkcz (Mus musculus) 6480464 vinylidene chloride results in decreased expression of PRKCZ mRNA CTD PMID:26682919 Prkcz Rat 1,2-dichloroethane decreases expression ISO Prkcz (Mus musculus) 6480464 ethylene dichloride results in decreased expression of PRKCZ mRNA CTD PMID:28960355 Prkcz Rat 1,2-dimethylhydrazine decreases expression ISO Prkcz (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of PRKCZ mRNA CTD PMID:22206623 Prkcz Rat 17alpha-ethynylestradiol multiple interactions ISO Prkcz (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PRKCZ mRNA CTD PMID:17942748 Prkcz Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of PRKCZ mRNA CTD PMID:32145629 Prkcz Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO PRKCZ (Homo sapiens) 6480464 Cycloheximide inhibits the reaction [Tetrachlorodibenzodioxin results in increased expression of PRKCZ mRNA] CTD PMID:11007951 Prkcz Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Prkcz (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PRKCZ mRNA CTD PMID:17942748 Prkcz Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO PRKCZ (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of PRKCZ mRNA CTD PMID:11007951 Prkcz Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects localization ISO PRKCZ (Homo sapiens) 6480464 2 more ... CTD PMID:15475174 Prkcz Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of PRKCZ mRNA CTD PMID:21346803 Prkcz Rat 2-methoxyethanol increases expression EXP 6480464 methyl cellosolve metabolite results in increased expression of PRKCZ protein CTD PMID:11794376 Prkcz Rat 2-methylcholine affects expression ISO PRKCZ (Homo sapiens) 6480464 beta-methylcholine affects the expression of PRKCZ mRNA CTD PMID:21179406 Prkcz Rat 2-nitrotoluene increases expression EXP 6480464 2-nitrotoluene results in increased expression of PRKCZ mRNA CTD PMID:16460773 Prkcz Rat 3,4-methylenedioxymethamphetamine increases expression ISO Prkcz (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of PRKCZ mRNA CTD PMID:20188158 Prkcz Rat 4,4'-diaminodiphenylmethane decreases expression ISO Prkcz (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of PRKCZ mRNA CTD PMID:18648102 Prkcz Rat 4,4'-sulfonyldiphenol decreases expression ISO Prkcz (Mus musculus) 6480464 bisphenol S results in decreased expression of PRKCZ mRNA CTD PMID:39298647 Prkcz Rat 4,4'-sulfonyldiphenol affects methylation ISO Prkcz (Mus musculus) 6480464 bisphenol S affects the methylation of PRKCZ gene CTD PMID:31683443 Prkcz Rat 4,4'-sulfonyldiphenol decreases methylation ISO PRKCZ (Homo sapiens) 6480464 bisphenol S results in decreased methylation of PRKCZ gene CTD PMID:31601247 Prkcz Rat 4-amino-2,6-dinitrotoluene affects expression EXP 6480464 4-amino-2 and 6-dinitrotoluene affects the expression of PRKCZ mRNA CTD PMID:21346803 Prkcz Rat 4-hydroxyphenyl retinamide increases expression ISO Prkcz (Mus musculus) 6480464 Fenretinide results in increased expression of PRKCZ mRNA CTD PMID:28973697 Prkcz Rat 4-hydroxyphenyl retinamide decreases expression ISO Prkcz (Mus musculus) 6480464 Fenretinide results in decreased expression of PRKCZ mRNA CTD PMID:28973697 Prkcz Rat 5-fluorouracil affects expression ISO PRKCZ (Homo sapiens) 6480464 Fluorouracil affects the expression of PRKCZ mRNA CTD PMID:16584549 Prkcz Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of PRKCZ mRNA CTD PMID:24780913 Prkcz Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of PRKCZ mRNA CTD PMID:30047161 Prkcz Rat afimoxifene decreases response to substance ISO PRKCZ (Homo sapiens) 6480464 PRKCZ results in decreased susceptibility to afimoxifene CTD PMID:21233418 Prkcz Rat aflatoxin B1 affects expression ISO PRKCZ (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of PRKCZ protein CTD PMID:20106945 Prkcz Rat aflatoxin B1 increases methylation ISO PRKCZ (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of PRKCZ intron CTD PMID:30157460 Prkcz Rat aflatoxin B1 decreases expression ISO PRKCZ (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of PRKCZ mRNA CTD PMID:22100608 and PMID:27153756 Prkcz Rat Aflatoxin B2 alpha increases methylation ISO PRKCZ (Homo sapiens) 6480464 aflatoxin B2 results in increased methylation of PRKCZ intron CTD PMID:30157460 Prkcz Rat AICA ribonucleotide multiple interactions EXP 6480464 1-Butanol inhibits the reaction [AICA ribonucleotide results in increased activity of PRKCZ protein] more ... CTD PMID:11978788 Prkcz Rat AICA ribonucleotide increases activity EXP 6480464 AICA ribonucleotide results in increased activity of PRKCZ protein CTD PMID:11978788 Prkcz Rat aldehydo-D-glucose multiple interactions EXP 6480464 PRKCZ protein promotes the reaction [NRG1 protein results in increased transport of Glucose] CTD PMID:14711829 Prkcz Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of PRKCZ mRNA CTD PMID:30047161 Prkcz Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PRKCZ mRNA CTD PMID:16483693 Prkcz Rat amphetamine affects expression EXP 6480464 Amphetamine affects the expression of PRKCZ mRNA CTD PMID:16101753 Prkcz Rat arsane affects methylation ISO PRKCZ (Homo sapiens) 6480464 Arsenic affects the methylation of PRKCZ gene CTD PMID:25304211 Prkcz Rat arsenic atom affects methylation ISO PRKCZ (Homo sapiens) 6480464 Arsenic affects the methylation of PRKCZ gene CTD PMID:25304211 Prkcz Rat arsenous acid affects response to substance ISO PRKCZ (Homo sapiens) 6480464 PRKCZ mRNA affects the susceptibility to Arsenic Trioxide CTD PMID:23911876 Prkcz Rat atorvastatin calcium multiple interactions EXP 6480464 [Atorvastatin co-treated with dapagliflozin] inhibits the reaction [[Fructose co-treated with Dietary Fats] results in decreased expression of PRKCZ protein] CTD PMID:32259528 Prkcz Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of PRKCZ gene CTD PMID:35440735 Prkcz Rat benzo[a]pyrene decreases expression ISO PRKCZ (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of PRKCZ mRNA CTD PMID:31255691 and PMID:32234424 Prkcz Rat benzo[a]pyrene affects methylation ISO PRKCZ (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of PRKCZ 5' UTR and Benzo(a)pyrene affects the methylation of PRKCZ promoter CTD PMID:27901495 Prkcz Rat benzo[e]pyrene decreases methylation ISO PRKCZ (Homo sapiens) 6480464 benzo(e)pyrene results in decreased methylation of PRKCZ intron CTD PMID:30157460 Prkcz Rat bis(2-ethylhexyl) phthalate multiple interactions ISO PRKCZ (Homo sapiens) 6480464 [Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in increased methylation of PRKCZ gene CTD PMID:33872906 Prkcz Rat bisphenol A increases expression ISO Prkcz (Mus musculus) 6480464 bisphenol A results in increased expression of PRKCZ mRNA and bisphenol A results in increased expression of PRKCZ protein CTD PMID:23545179 and PMID:32156529 Prkcz Rat bisphenol A decreases methylation ISO PRKCZ (Homo sapiens) 6480464 bisphenol A results in decreased methylation of PRKCZ gene CTD PMID:31601247 Prkcz Rat bisphenol A multiple interactions ISO PRKCZ (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of PRKCZ gene CTD PMID:31601247 Prkcz Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PRKCZ mRNA CTD PMID:34947998 Prkcz Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PRKCZ mRNA CTD PMID:25181051 and PMID:32145629 Prkcz Rat bromochloroacetic acid increases expression EXP 6480464 bromochloroacetic acid results in increased expression of PRKCZ mRNA CTD PMID:16460773 Prkcz Rat butan-1-ol multiple interactions ISO PRKCZ (Homo sapiens) 6480464 1-Butanol inhibits the reaction [Carbachol results in increased phosphorylation of and results in increased activity of PRKCZ protein] CTD PMID:15255942 Prkcz Rat butan-1-ol multiple interactions EXP 6480464 1-Butanol inhibits the reaction [AICA ribonucleotide results in increased activity of PRKCZ protein] CTD PMID:11978788 Prkcz Rat cadmium atom increases expression ISO PRKCZ (Homo sapiens) 6480464 Cadmium results in increased expression of PRKCZ mRNA CTD PMID:24376830 Prkcz Rat cadmium dichloride increases expression ISO PRKCZ (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of PRKCZ mRNA CTD PMID:38568856 Prkcz Rat cadmium dichloride decreases expression ISO PRKCZ (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of PRKCZ mRNA CTD PMID:33129824 Prkcz Rat caffeine affects phosphorylation ISO PRKCZ (Homo sapiens) 6480464 Caffeine affects the phosphorylation of PRKCZ protein CTD PMID:35688186 Prkcz Rat capsaicin increases response to substance ISO Prkcz (Mus musculus) 6480464 PRKCZ protein alternative form results in increased susceptibility to Capsaicin CTD PMID:27899695 Prkcz Rat carbachol multiple interactions ISO PRKCZ (Homo sapiens) 6480464 1-Butanol inhibits the reaction [Carbachol results in increased phosphorylation of and results in increased activity of PRKCZ protein] and Carbachol results in increased phosphorylation of and results in increased activity of PRKCZ protein CTD PMID:15255942 Prkcz Rat carbachol increases activity ISO PRKCZ (Homo sapiens) 6480464 Carbachol results in increased activity of PRKCZ protein CTD PMID:15255942 Prkcz Rat carbon nanotube affects expression ISO Prkcz (Mus musculus) 6480464 Nanotubes and Carbon affects the expression of PRKCZ mRNA CTD PMID:25620056 Prkcz Rat carbon nanotube increases expression ISO Prkcz (Mus musculus) 6480464 Nanotubes and Carbon analog results in increased expression of PRKCZ mRNA CTD PMID:25620056 Prkcz Rat carbon nanotube decreases expression ISO Prkcz (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Prkcz Rat CGP 52608 multiple interactions ISO PRKCZ (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to PRKCZ gene] CTD PMID:28238834 Prkcz Rat CGS-21680 multiple interactions EXP 6480464 2-(4-(2-carboxyethyl)phenethylamino)-5'-N-ethylcarboxamidoadenosine affects the localization of and results in increased activity of PRKCZ protein more ... CTD PMID:12590138 Prkcz Rat chromium(6+) affects expression ISO Prkcz (Mus musculus) 6480464 chromium hexavalent ion affects the expression of PRKCZ mRNA CTD PMID:28472532 Prkcz Rat cisplatin multiple interactions ISO PRKCZ (Homo sapiens) 6480464 Cisplatin promotes the reaction [jinfukang results in increased expression of PRKCZ mRNA] and jinfukang promotes the reaction [Cisplatin results in increased expression of PRKCZ mRNA] CTD PMID:27392435 Prkcz Rat clofibrate decreases expression ISO Prkcz (Mus musculus) 6480464 Clofibrate results in decreased expression of PRKCZ mRNA CTD PMID:17585979 and PMID:23811191 Prkcz Rat clozapine increases expression EXP 6480464 Clozapine results in increased expression of PRKCZ mRNA CTD PMID:15860345 Prkcz Rat cocaine multiple interactions ISO Prkcz (Mus musculus) 6480464 [Cocaine co-treated with FOS protein mutant form] results in decreased expression of PRKCZ mRNA CTD PMID:18355967 Prkcz Rat cordycepin increases expression ISO Prkcz (Mus musculus) 6480464 cordycepin results in increased expression of PRKCZ mRNA CTD PMID:32042022 Prkcz Rat crocidolite asbestos increases activity ISO Prkcz (Mus musculus) 6480464 Asbestos and Crocidolite results in increased activity of PRKCZ protein CTD PMID:12626342 Prkcz Rat crocidolite asbestos increases expression ISO Prkcz (Mus musculus) 6480464 Asbestos and Crocidolite results in increased expression of PRKCZ protein CTD PMID:12626342 Prkcz Rat cycloheximide multiple interactions ISO PRKCZ (Homo sapiens) 6480464 Cycloheximide inhibits the reaction [Tetrachlorodibenzodioxin results in increased expression of PRKCZ mRNA] CTD PMID:11007951 Prkcz Rat cyclosporin A increases expression ISO PRKCZ (Homo sapiens) 6480464 Cyclosporine results in increased expression of PRKCZ mRNA CTD PMID:25562108 Prkcz Rat cyclosporin A decreases methylation ISO PRKCZ (Homo sapiens) 6480464 Cyclosporine results in decreased methylation of PRKCZ promoter CTD PMID:27989131 Prkcz Rat cytarabine decreases response to substance ISO PRKCZ (Homo sapiens) 6480464 PRKCZ protein results in decreased susceptibility to Cytarabine CTD PMID:21863889 Prkcz Rat D-glucose multiple interactions EXP 6480464 PRKCZ protein promotes the reaction [NRG1 protein results in increased transport of Glucose] CTD PMID:14711829 Prkcz Rat dapagliflozin multiple interactions EXP 6480464 [Atorvastatin co-treated with dapagliflozin] inhibits the reaction [[Fructose co-treated with Dietary Fats] results in decreased expression of PRKCZ protein] and dapagliflozin inhibits the reaction [[Fructose co-treated with Dietary Fats] results in decreased expression of PRKCZ protein] CTD PMID:32259528 Prkcz Rat daunorubicin decreases response to substance ISO PRKCZ (Homo sapiens) 6480464 PRKCZ protein results in decreased susceptibility to Daunorubicin CTD PMID:21863889 Prkcz Rat deoxycholic acid decreases response to substance ISO PRKCZ (Homo sapiens) 6480464 PRKCZ protein results in decreased susceptibility to Deoxycholic Acid CTD PMID:12507930 Prkcz Rat diarsenic trioxide affects response to substance ISO PRKCZ (Homo sapiens) 6480464 PRKCZ mRNA affects the susceptibility to Arsenic Trioxide CTD PMID:23911876 Prkcz Rat diazinon increases methylation ISO PRKCZ (Homo sapiens) 6480464 Diazinon results in increased methylation of PRKCZ gene CTD PMID:22964155 Prkcz Rat dibenzo[a,l]pyrene decreases expression ISO PRKCZ (Homo sapiens) 6480464 dibenzo(a and l)pyrene results in decreased expression of PRKCZ mRNA CTD PMID:31255691 Prkcz Rat dimethylarsinic acid increases expression EXP 6480464 Cacodylic Acid results in increased expression of PRKCZ mRNA CTD PMID:16122865 Prkcz Rat disodium selenite increases expression ISO PRKCZ (Homo sapiens) 6480464 Sodium Selenite results in increased expression of PRKCZ mRNA CTD PMID:18175754 Prkcz Rat doxorubicin decreases expression ISO PRKCZ (Homo sapiens) 6480464 Doxorubicin results in decreased expression of PRKCZ mRNA CTD PMID:29803840 Prkcz Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of PRKCZ mRNA CTD PMID:31464424 Prkcz Rat epoxiconazole decreases expression ISO Prkcz (Mus musculus) 6480464 epoxiconazole results in decreased expression of PRKCZ mRNA CTD PMID:35436446 Prkcz Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of PRKCZ mRNA CTD PMID:20655511 Prkcz Rat ethanol multiple interactions ISO Prkcz (Mus musculus) 6480464 Ethanol affects the expression of and affects the splicing of PRKCZ mRNA CTD PMID:30319688 Prkcz Rat etoposide increases response to substance ISO PRKCZ (Homo sapiens) 6480464 PRKCZ protein results in increased susceptibility to Etoposide CTD PMID:21863889 Prkcz Rat fenthion decreases expression ISO Prkcz (Mus musculus) 6480464 Fenthion results in decreased expression of PRKCZ mRNA CTD PMID:34813904 Prkcz Rat formaldehyde increases response to substance ISO Prkcz (Mus musculus) 6480464 PRKCZ protein alternative form results in increased susceptibility to Formaldehyde CTD PMID:27899695 Prkcz Rat fructose multiple interactions EXP 6480464 [Atorvastatin co-treated with dapagliflozin] inhibits the reaction [[Fructose co-treated with Dietary Fats] results in decreased expression of PRKCZ protein] more ... CTD PMID:32259528 Prkcz Rat fulvestrant multiple interactions ISO PRKCZ (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of PRKCZ gene CTD PMID:31601247 Prkcz Rat genistein multiple interactions EXP 6480464 Genistein inhibits the reaction [AICA ribonucleotide results in increased activity of PRKCZ protein] CTD PMID:11978788 Prkcz Rat glucose multiple interactions EXP 6480464 PRKCZ protein promotes the reaction [NRG1 protein results in increased transport of Glucose] CTD PMID:14711829 Prkcz Rat haloperidol increases expression EXP 6480464 Haloperidol results in increased expression of PRKCZ mRNA CTD PMID:15860345 Prkcz Rat hydrogen peroxide increases activity ISO Prkcz (Mus musculus) 6480464 Hydrogen Peroxide results in increased activity of PRKCZ protein CTD PMID:12626342 Prkcz Rat hydrogen peroxide increases expression ISO Prkcz (Mus musculus) 6480464 Hydrogen Peroxide results in increased expression of PRKCZ protein CTD PMID:12626342 Prkcz Rat lipopolysaccharide increases phosphorylation ISO PRKCZ (Homo sapiens) 6480464 Lipopolysaccharides results in increased phosphorylation of PRKCZ protein CTD PMID:20920494 Prkcz Rat lipopolysaccharide multiple interactions ISO PRKCZ (Homo sapiens) 6480464 PRKCZ protein promotes the reaction [Lipopolysaccharides affects the localization of NCF1 protein] more ... CTD PMID:20920494 Prkcz Rat LY294002 decreases phosphorylation ISO PRKCZ (Homo sapiens) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one results in decreased phosphorylation of PRKCZ protein CTD PMID:12970779 Prkcz Rat LY294002 affects localization ISO PRKCZ (Homo sapiens) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one affects the localization of PRKCZ protein CTD PMID:15735031 Prkcz Rat maneb multiple interactions ISO Prkcz (Mus musculus) 6480464 [Paraquat co-treated with Maneb] results in decreased expression of PRKCZ mRNA CTD PMID:18386188 Prkcz Rat methapyrilene decreases methylation ISO PRKCZ (Homo sapiens) 6480464 Methapyrilene results in decreased methylation of PRKCZ intron CTD PMID:30157460 Prkcz Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of PRKCZ mRNA CTD PMID:30047161 Prkcz Rat methoxyacetic acid increases expression EXP 6480464 methoxyacetic acid results in increased expression of PRKCZ protein CTD PMID:11794376 Prkcz Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of PRKCZ gene CTD PMID:35440735 Prkcz Rat methylazoxymethanol increases expression ISO Prkcz (Mus musculus) 6480464 methylazoxymethanol results in increased expression of PRKCZ mRNA CTD PMID:17107856 Prkcz Rat mitomycin C increases cleavage ISO PRKCZ (Homo sapiens) 6480464 Mitomycin results in increased cleavage of PRKCZ protein CTD PMID:10960761 Prkcz Rat mono(2-ethylhexyl) phthalate multiple interactions ISO PRKCZ (Homo sapiens) 6480464 [Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in increased methylation of PRKCZ gene CTD PMID:33872906 Prkcz Rat myriocin decreases activity ISO Prkcz (Mus musculus) 6480464 thermozymocidin results in decreased activity of PRKCZ protein CTD PMID:31053639 Prkcz Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] affects the methylation of PRKCZ gene CTD PMID:33148267 Prkcz Rat N-formyl-L-methionyl-L-leucyl-L-phenylalanine multiple interactions EXP 6480464 2-benzyl-3-(4-hydroxymethylphenyl)indazole inhibits the reaction [N-Formylmethionine Leucyl-Phenylalanine affects the localization of and results in increased phosphorylation of PRKCZ protein] and N-Formylmethionine Leucyl-Phenylalanine affects the localization of and results in increased phosphorylation of PRKCZ protein CTD PMID:19445920 Prkcz Rat N-nitrosodiethylamine increases phosphorylation EXP 6480464 Diethylnitrosamine results in increased phosphorylation of PRKCZ protein CTD PMID:21056072 Prkcz Rat N-nitrosodimethylamine increases expression EXP 6480464 Dimethylnitrosamine results in increased expression of PRKCZ mRNA CTD PMID:17032414 Prkcz Rat nickel atom multiple interactions ISO PRKCZ (Homo sapiens) 6480464 trichostatin A inhibits the reaction [Nickel affects the expression of PRKCZ mRNA] CTD PMID:14575637 Prkcz Rat nickel atom increases expression ISO PRKCZ (Homo sapiens) 6480464 Nickel results in increased expression of PRKCZ mRNA CTD PMID:14575637 Prkcz Rat nicotine multiple interactions ISO PRKCZ (Homo sapiens) 6480464 PRKCZ protein affects the reaction [Nicotine results in increased phosphorylation of BAX protein] CTD PMID:17525161 Prkcz Rat nicotine increases activity ISO PRKCZ (Homo sapiens) 6480464 Nicotine results in increased activity of PRKCZ protein CTD PMID:17525161 Prkcz Rat Nor-9-carboxy-delta9-THC multiple interactions ISO PRKCZ (Homo sapiens) 6480464 [Cannabinoids results in increased abundance of 11-nor-delta(9)-tetrahydrocannabinol-9-carboxylic acid] which affects the methylation of PRKCZ gene CTD PMID:30521419 Prkcz Rat paracetamol decreases expression ISO PRKCZ (Homo sapiens) 6480464 Acetaminophen results in decreased expression of PRKCZ mRNA CTD PMID:21420995 Prkcz Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of PRKCZ mRNA CTD PMID:33387578 Prkcz Rat paraquat multiple interactions ISO Prkcz (Mus musculus) 6480464 [Paraquat co-treated with Maneb] results in decreased expression of PRKCZ mRNA CTD PMID:18386188 Prkcz Rat perfluorohexanesulfonic acid decreases expression ISO Prkcz (Mus musculus) 6480464 perfluorohexanesulfonic acid results in decreased expression of PRKCZ mRNA CTD PMID:37995155 Prkcz Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Prkcz (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of PRKCZ mRNA CTD PMID:36331819 Prkcz Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] affects the methylation of PRKCZ gene CTD PMID:33148267 Prkcz Rat PF-3758309 increases expression ISO PRKCZ (Homo sapiens) 6480464 PF 3758309 results in increased expression of PRKCZ mRNA CTD PMID:29048629 Prkcz Rat phenethyl isothiocyanate multiple interactions ISO PRKCZ (Homo sapiens) 6480464 phenethyl isothiocyanate results in decreased phosphorylation of and results in decreased expression of PRKCZ protein CTD PMID:26456889 Prkcz Rat phenylephrine affects localization EXP 6480464 Phenylephrine affects the localization of PRKCZ protein CTD PMID:14736339 Prkcz Rat phenylephrine increases phosphorylation EXP 6480464 Phenylephrine results in increased phosphorylation of PRKCZ protein CTD PMID:27094369 Prkcz Rat phenylephrine decreases activity EXP 6480464 Phenylephrine results in decreased activity of PRKCZ protein CTD PMID:14736339 Prkcz Rat phenylephrine multiple interactions EXP 6480464 GLRX3 protein inhibits the reaction [Phenylephrine results in increased phosphorylation of and results in increased activity of PRKCZ protein] more ... CTD PMID:16809552 and PMID:27094369 Prkcz Rat phorbol 12,13-dibutanoate increases expression ISO Prkcz (Mus musculus) 6480464 Phorbol 12 and 13-Dibutyrate results in increased expression of PRKCZ protein CTD PMID:12626342 Prkcz Rat phorbol 13-acetate 12-myristate increases expression ISO PRKCZ (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate results in increased expression of PRKCZ protein modified form CTD PMID:16532021 Prkcz Rat phorbol 13-acetate 12-myristate multiple interactions EXP 6480464 Tetradecanoylphorbol Acetate affects the localization of and results in increased activity of PRKCZ protein CTD PMID:12590138 Prkcz Rat phorbol 13-acetate 12-myristate affects localization ISO PRKCZ (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate affects the localization of PRKCZ protein CTD PMID:15976015 Prkcz Rat phosphatidic acid multiple interactions ISO PRKCZ (Homo sapiens) 6480464 Phosphatidic Acids results in increased phosphorylation of and results in increased activity of PRKCZ protein CTD PMID:15255942 Prkcz Rat phosphatidic acid increases activity EXP 6480464 Phosphatidic Acids results in increased activity of PRKCZ protein CTD PMID:11978788 Prkcz Rat pirinixic acid multiple interactions ISO Prkcz (Mus musculus) 6480464 PPARA protein promotes the reaction [pirinixic acid results in decreased expression of PRKCZ mRNA] CTD PMID:20059764 Prkcz Rat pirinixic acid decreases expression ISO Prkcz (Mus musculus) 6480464 pirinixic acid results in decreased expression of PRKCZ mRNA CTD PMID:20059764 and PMID:23811191 Prkcz Rat pirinixic acid multiple interactions ISO PRKCZ (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of PRKCZ mRNA CTD PMID:19710929 Prkcz Rat pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of PRKCZ mRNA CTD PMID:30047161 Prkcz Rat progesterone multiple interactions ISO Prkcz (Mus musculus) 6480464 Progesterone inhibits the reaction [C3 protein results in increased phosphorylation of PRKCZ protein] CTD PMID:18615583 Prkcz Rat protein kinase inhibitor decreases activity EXP 6480464 Protein Kinase Inhibitors results in decreased activity of PRKCZ protein CTD PMID:26833564 Prkcz Rat protein kinase inhibitor multiple interactions ISO Prkcz (Mus musculus) 6480464 Protein Kinase Inhibitors results in decreased phosphorylation of and results in decreased activity of PRKCZ protein CTD PMID:31053639 Prkcz Rat protein kinase inhibitor multiple interactions EXP 6480464 [Protein Kinase Inhibitors results in decreased activity of PRKCZ protein] which results in decreased expression of AGER protein more ... CTD PMID:26833564 Prkcz Rat quercetin decreases expression ISO Prkcz (Mus musculus) 6480464 Quercetin results in decreased expression of PRKCZ mRNA CTD PMID:26076811 Prkcz Rat raloxifene multiple interactions ISO PRKCZ (Homo sapiens) 6480464 [Raloxifene Hydrochloride co-treated with ESR2 protein] results in decreased expression of PRKCZ mRNA CTD PMID:19059307 Prkcz Rat riddelliine increases expression EXP 6480464 riddelliine results in increased expression of PRKCZ mRNA CTD PMID:18047727 Prkcz Rat Se-methyl-L-selenocysteine decreases expression ISO Prkcz (Mus musculus) 6480464 selenomethylselenocysteine results in decreased expression of PRKCZ protein CTD PMID:10656618 Prkcz Rat Se-methylselenocysteine decreases expression ISO Prkcz (Mus musculus) 6480464 selenomethylselenocysteine results in decreased expression of PRKCZ protein CTD PMID:10656618 Prkcz Rat selenomethionine affects expression ISO PRKCZ (Homo sapiens) 6480464 Selenomethionine affects the expression of PRKCZ mRNA CTD PMID:17222674 Prkcz Rat silver atom decreases expression ISO PRKCZ (Homo sapiens) 6480464 Silver results in decreased expression of PRKCZ mRNA and Silver results in decreased expression of PRKCZ protein CTD PMID:21611810 Prkcz Rat silver(0) decreases expression ISO PRKCZ (Homo sapiens) 6480464 Silver results in decreased expression of PRKCZ mRNA and Silver results in decreased expression of PRKCZ protein CTD PMID:21611810 Prkcz Rat sodium arsenite increases expression ISO PRKCZ (Homo sapiens) 6480464 sodium arsenite results in increased expression of PRKCZ mRNA CTD PMID:17879257 Prkcz Rat sodium arsenite decreases expression ISO Prkcz (Mus musculus) 6480464 sodium arsenite results in decreased expression of PRKCZ mRNA CTD PMID:37682722 Prkcz Rat sodium arsenite decreases expression ISO PRKCZ (Homo sapiens) 6480464 sodium arsenite results in decreased expression of PRKCZ mRNA CTD PMID:34032870 Prkcz Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of PRKCZ mRNA CTD PMID:30047161 Prkcz Rat T-2 toxin decreases expression EXP 6480464 T-2 Toxin results in decreased expression of PRKCZ mRNA CTD PMID:26141394 Prkcz Rat tamoxifen multiple interactions ISO PRKCZ (Homo sapiens) 6480464 [Tamoxifen co-treated with ESR2 protein] results in decreased expression of PRKCZ mRNA CTD PMID:19059307 Prkcz Rat temozolomide increases expression ISO PRKCZ (Homo sapiens) 6480464 Temozolomide results in increased expression of PRKCZ mRNA CTD PMID:31758290 Prkcz Rat testosterone multiple interactions ISO Prkcz (Mus musculus) 6480464 Testosterone inhibits the reaction [C3 protein results in increased phosphorylation of PRKCZ protein] CTD PMID:18615583 Prkcz Rat testosterone decreases expression ISO PRKCZ (Homo sapiens) 6480464 Testosterone results in decreased expression of PRKCZ mRNA CTD PMID:33359661 Prkcz Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of PRKCZ mRNA CTD PMID:16644059 Prkcz Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of PRKCZ mRNA CTD PMID:17032414 Prkcz Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of PRKCZ mRNA CTD PMID:34492290 Prkcz Rat titanium dioxide decreases methylation ISO Prkcz (Mus musculus) 6480464 titanium dioxide results in decreased methylation of PRKCZ promoter CTD PMID:35295148 Prkcz Rat toluene affects expression EXP 6480464 Toluene affects the expression of PRKCZ mRNA CTD PMID:21827849 Prkcz Rat trichostatin A multiple interactions ISO PRKCZ (Homo sapiens) 6480464 trichostatin A inhibits the reaction [Nickel affects the expression of PRKCZ mRNA] CTD PMID:14575637 Prkcz Rat triphenyl phosphate affects expression ISO PRKCZ (Homo sapiens) 6480464 triphenyl phosphate affects the expression of PRKCZ mRNA CTD PMID:37042841 Prkcz Rat troglitazone increases expression ISO Prkcz (Mus musculus) 6480464 troglitazone results in increased expression of PRKCZ mRNA CTD PMID:28973697 Prkcz Rat valproic acid increases methylation ISO PRKCZ (Homo sapiens) 6480464 Valproic Acid results in increased methylation of PRKCZ gene CTD PMID:29154799 Prkcz Rat valproic acid affects expression ISO PRKCZ (Homo sapiens) 6480464 Valproic Acid affects the expression of PRKCZ mRNA CTD PMID:25979313 Prkcz Rat valproic acid increases expression ISO PRKCZ (Homo sapiens) 6480464 Valproic Acid results in increased expression of PRKCZ mRNA CTD PMID:23527032 Prkcz Rat valproic acid affects expression ISO Prkcz (Mus musculus) 6480464 Valproic Acid affects the expression of PRKCZ mRNA CTD PMID:17292431 Prkcz Rat vanadium atom affects localization ISO Prkcz (Mus musculus) 6480464 Vanadium affects the localization of PRKCZ protein CTD PMID:14971662 Prkcz Rat vanadium(0) affects localization ISO Prkcz (Mus musculus) 6480464 Vanadium affects the localization of PRKCZ protein CTD PMID:14971662 Prkcz Rat vancomycin increases expression ISO Prkcz (Mus musculus) 6480464 Vancomycin results in increased expression of PRKCZ mRNA CTD PMID:18930951 Prkcz Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of PRKCZ mRNA CTD PMID:20566332 Prkcz Rat vinclozolin decreases methylation EXP 6480464 vinclozolin results in decreased methylation of PRKCZ gene CTD PMID:31079544
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(+)-pilocarpine (EXP) (1->4)-beta-D-glucan (ISO) (S)-nicotine (ISO) 1,1-dichloroethene (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,4-dinitrotoluene (EXP) 2-methoxyethanol (EXP) 2-methylcholine (ISO) 2-nitrotoluene (EXP) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-amino-2,6-dinitrotoluene (EXP) 4-hydroxyphenyl retinamide (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) afimoxifene (ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) AICA ribonucleotide (EXP) aldehydo-D-glucose (EXP) amitrole (EXP) ammonium chloride (EXP) amphetamine (EXP) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) atorvastatin calcium (EXP) atrazine (EXP) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bromochloroacetic acid (EXP) butan-1-ol (EXP,ISO) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) capsaicin (ISO) carbachol (ISO) carbon nanotube (ISO) CGP 52608 (ISO) CGS-21680 (EXP) chromium(6+) (ISO) cisplatin (ISO) clofibrate (ISO) clozapine (EXP) cocaine (ISO) cordycepin (ISO) crocidolite asbestos (ISO) cycloheximide (ISO) cyclosporin A (ISO) cytarabine (ISO) D-glucose (EXP) dapagliflozin (EXP) daunorubicin (ISO) deoxycholic acid (ISO) diarsenic trioxide (ISO) diazinon (ISO) dibenzo[a,l]pyrene (ISO) dimethylarsinic acid (EXP) disodium selenite (ISO) doxorubicin (ISO) endosulfan (EXP) epoxiconazole (ISO) ethanol (EXP,ISO) etoposide (ISO) fenthion (ISO) formaldehyde (ISO) fructose (EXP) fulvestrant (ISO) genistein (EXP) glucose (EXP) haloperidol (EXP) hydrogen peroxide (ISO) lipopolysaccharide (ISO) LY294002 (ISO) maneb (ISO) methapyrilene (ISO) methimazole (EXP) methoxyacetic acid (EXP) methoxychlor (EXP) methylazoxymethanol (ISO) mitomycin C (ISO) mono(2-ethylhexyl) phthalate (ISO) myriocin (ISO) N,N-diethyl-m-toluamide (EXP) N-formyl-L-methionyl-L-leucyl-L-phenylalanine (EXP) N-nitrosodiethylamine (EXP) N-nitrosodimethylamine (EXP) nickel atom (ISO) nicotine (ISO) Nor-9-carboxy-delta9-THC (ISO) paracetamol (EXP,ISO) paraquat (ISO) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) permethrin (EXP) PF-3758309 (ISO) phenethyl isothiocyanate (ISO) phenylephrine (EXP) phorbol 12,13-dibutanoate (ISO) phorbol 13-acetate 12-myristate (EXP,ISO) phosphatidic acid (EXP,ISO) pirinixic acid (ISO) pregnenolone 16alpha-carbonitrile (EXP) progesterone (ISO) protein kinase inhibitor (EXP,ISO) quercetin (ISO) raloxifene (ISO) riddelliine (EXP) Se-methyl-L-selenocysteine (ISO) Se-methylselenocysteine (ISO) selenomethionine (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) sulfadimethoxine (EXP) T-2 toxin (EXP) tamoxifen (ISO) temozolomide (ISO) testosterone (ISO) tetrachloromethane (EXP) thioacetamide (EXP) titanium dioxide (ISO) toluene (EXP) trichostatin A (ISO) triphenyl phosphate (ISO) troglitazone (ISO) valproic acid (ISO) vanadium atom (ISO) vanadium(0) (ISO) vancomycin (ISO) vinclozolin (EXP)
Biological Process
activation of phospholipase D activity (IMP) activation of protein kinase B activity (IMP) cell migration (IMP) cell surface receptor signaling pathway (IMP) cellular response to insulin stimulus (IBA,IMP) establishment of cell polarity (IBA,IMP) inflammatory response (IEA) intracellular signal transduction (IBA,IDA,IMP) long-term memory (IMP) long-term synaptic potentiation (IMP) membrane depolarization (IMP) membrane hyperpolarization (IMP) microtubule cytoskeleton organization (ISO) negative regulation of apoptotic process (IDA) negative regulation of hydrolase activity (IDA) negative regulation of insulin receptor signaling pathway (ISO) negative regulation of protein-containing complex assembly (ISO) neuron projection extension (ISO) peptidyl-serine phosphorylation (IDA) positive regulation of cell population proliferation (IMP) positive regulation of cell-matrix adhesion (IMP) positive regulation of ERK1 and ERK2 cascade (IMP,ISO,ISS) positive regulation of excitatory postsynaptic potential (IDA) positive regulation of insulin receptor signaling pathway (IMP) positive regulation of interleukin-10 production (ISO,ISS) positive regulation of interleukin-13 production (ISO,ISS) positive regulation of interleukin-4 production (ISO,ISS) positive regulation of interleukin-5 production (ISO,ISS) positive regulation of NF-kappaB transcription factor activity (IMP) positive regulation of protein transport (IMP) positive regulation of synaptic transmission (IMP) positive regulation of T-helper 2 cell cytokine production (ISO,ISS) positive regulation of T-helper 2 cell differentiation (ISO,ISS) protein localization to plasma membrane (IBA,ISO) protein phosphorylation (IDA,ISO) regulation of neurotransmitter receptor localization to postsynaptic specialization membrane (IDA,IMP) vesicle transport along microtubule (IMP)
1.
cDNA cloning and characterization of mitochondrial import stimulation factor (MSF) purified from rat liver cytosol.
Alam R, etal., J Biochem (Tokyo) 1994 Aug;116(2):416-25.
2.
Activation of protein kinase Czeta increases OAT1 (SLC22A6)- and OAT3 (SLC22A8)-mediated transport.
Barros SA, etal., J Biol Chem. 2009 Jan 30;284(5):2672-9. Epub 2008 Nov 21.
3.
Evidence for a role of MEK and MAPK during signal transduction by protein kinase C zeta.
Berra E, etal., EMBO J. 1995 Dec 15;14(24):6157-63.
4.
PKCzeta protects against UV-C-induced apoptosis by inhibiting acid sphingomyelinase-dependent ceramide production.
Charruyer A, etal., Biochem J. 2007 Jul 1;405(1):77-83.
5.
Regulation of protein kinase C zeta by PI 3-kinase and PDK-1.
Chou MM, etal., Curr Biol. 1998 Sep 24;8(19):1069-77.
6.
ZIP3, a new splice variant of the PKC-zeta-interacting protein family, binds to GABAC receptors, PKC-zeta, and Kv beta 2.
Croci C, etal., J Biol Chem 2003 Feb 21;278(8):6128-35.
7.
Protein kinase C-zeta regulates transcription of the matrix metalloproteinase-9 gene induced by IL-1 and TNF-alpha in glioma cells via NF-kappa B.
Esteve PO, etal., J Biol Chem 2002 Sep 20;277(38):35150-5.
8.
Integrin-mediated activation of Cdc42 controls cell polarity in migrating astrocytes through PKCzeta.
Etienne-Manneville S and Hall A, Cell. 2001 Aug 24;106(4):489-98.
9.
Ceramide recruits and activates protein kinase C zeta (PKC zeta) within structured membrane microdomains.
Fox TE, etal., J Biol Chem. 2007 Apr 27;282(17):12450-7. Epub 2007 Feb 17.
10.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
11.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
12.
Differential stimulation of PKC phosphorylation of potassium channels by ZIP1 and ZIP2.
Gong J, etal., Science. 1999 Sep 3;285(5433):1565-9.
13.
Regulation of the expression of prostate apoptosis response protein 4 (Par-4) in rat granulosa cells.
Gonzalez IH, etal., Apoptosis. 2007 Apr;12(4):769-79.
14.
PKC zeta enhances insulin-like growth factor 1-dependent mitogenic activity in the rat clonal beta cell line RIN 1046-38.
Hennige AM, etal., Biochem Biophys Res Commun 2002 Jan 11;290(1):85-90.
15.
Cellular and subcellular localization of PKM¿.
Hernández AI, etal., Philos Trans R Soc Lond B Biol Sci. 2013 Dec 2;369(1633):20130140. doi: 10.1098/rstb.2013.0140. Print 2014 Jan 5.
16.
Identification of 80K-H as a protein involved in GLUT4 vesicle trafficking.
Hodgkinson CP, etal., Biochem J. 2005 Jun 15;388(Pt 3):785-93.
17.
Vascular endothelial growth factor receptor-2: structure, function, intracellular signalling and therapeutic inhibition.
Holmes K, etal., Cell Signal. 2007 Oct;19(10):2003-12. Epub 2007 Jun 12.
18.
Modulation of delayed rectifier potassium channel by protein kinase C zeta-containing signaling complex in pheochromocytoma cells.
Kim Y, etal., Neuroscience. 2004;125(2):359-68.
19.
Insulin-stimulated protein kinase C lambda/zeta activity is reduced in skeletal muscle of humans with obesity and type 2 diabetes: reversal with weight reduction.
Kim YB, etal., Diabetes. 2003 Aug;52(8):1935-42.
20.
Fatty acid infusion selectively impairs insulin action on Akt1 and protein kinase C lambda /zeta but not on glycogen synthase kinase-3.
Kim YB, etal., J Biol Chem 2002 Sep 6;277(36):32915-22.
21.
Mammalian homologue of the Caenorhabditis elegans UNC-76 protein involved in axonal outgrowth is a protein kinase C zeta-interacting protein.
Kuroda S, etal., J Cell Biol 1999 Feb 8;144(3):403-11.
22.
Interaction codes within the family of mammalian Phox and Bem1p domain-containing proteins.
Lamark T, etal., J Biol Chem. 2003 Sep 5;278(36):34568-81. Epub 2003 Jun 17.
23.
Protein kinase Mzeta is necessary and sufficient for LTP maintenance.
Ling DS, etal., Nat Neurosci. 2002 Apr;5(4):295-6.
24.
The pivotal role of protein kinase C zeta (PKCzeta) in insulin- and AMP-activated protein kinase (AMPK)-mediated glucose uptake in muscle cells.
Liu LZ, etal., Cell Signal. 2010 Oct;22(10):1513-22. Epub 2010 Jun 4.
25.
Protein kinase Czeta mediates insulin-induced glucose transport through actin remodeling in L6 muscle cells.
Liu LZ, etal., Mol Biol Cell. 2006 May;17(5):2322-30. Epub 2006 Mar 8.
26.
Selective changes in protein kinase C isoforms and phosphorylation of endogenous substrate proteins in rat cerebral cortex during pre- and postnatal ethanol exposure.
Mahadev K and Vemuri MC, Arch Biochem Biophys. 1998 Aug 15;356(2):249-57.
27.
Cross-talk between protein kinases Czeta and B in cyclic AMP-mediated sodium taurocholate co-transporting polypeptide translocation in hepatocytes.
McConkey M, etal., J Biol Chem. 2004 May 14;279(20):20882-8. Epub 2004 Mar 8.
28.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
29.
Inhibitory effect of ceramide on insulin-induced protein kinase Czeta translocation in rat adipocytes.
Miura A, etal., Metabolism 2003 Jan;52(1):19-24.
30.
Protein kinase C: poised to signal.
Newton AC Am J Physiol Endocrinol Metab. 2010 Mar;298(3):E395-402. Epub 2009 Nov 24.
31.
The structure, expression, and properties of additional members of the protein kinase C family.
Ono Y, etal., J Biol Chem 1988 May 15;263(14):6927-32.
32.
Protein kinase C zeta subspecies from rat brain: its structure, expression, and properties.
Ono Y, etal., Proc Natl Acad Sci U S A 1989 May;86(9):3099-103.
33.
ANG II stimulates phospholipase D through PKCzeta activation in VSMC: implications in adhesion, spreading, and hypertrophy.
Parmentier JH, etal., Am J Physiol Heart Circ Physiol. 2006 Jan;290(1):H46-54. Epub 2005 Aug 19.
34.
Essential role of PKC-zeta in normal and angiotensin II-accelerated neointimal growth after vascular injury.
Parmentier JH, etal., Am J Physiol Heart Circ Physiol. 2006 Oct;291(4):H1602-13. Epub 2006 May 5.
35.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
36.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
37.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
38.
Tumor necrosis factor alpha and ceramide depolarise the resting membrane potential of thyroid FRTL-5 cells via a protein kinase Czeta-dependent regulation of K+ channels.
Ramstrom C, etal., Cell Signal. 2004 Dec;16(12):1417-24.
39.
Protein kinase C-zeta phosphorylates insulin receptor substrate-1 and impairs its ability to activate phosphatidylinositol 3-kinase in response to insulin.
Ravichandran LV, etal., J Biol Chem. 2001 Feb 2;276(5):3543-9. Epub 2000 Nov 3.
40.
GOA pipeline
RGD automated data pipeline
41.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
42.
Cloning, expression and characterization of an A6-related protein.
Rohwer A, etal., Eur J Biochem. 1999 Jul;263(2):518-25.
43.
An aPKC-exocyst complex controls paxillin phosphorylation and migration through localised JNK1 activation.
Rosse C, etal., PLoS Biol. 2009 Nov;7(11):e1000235. Epub 2009 Nov 3.
44.
Protein kinase C-zeta phosphorylates insulin-responsive aminopeptidase in vitro at Ser-80 and Ser-91.
Ryu J, etal., Arch Biochem Biophys 2002 Jul 1;403(1):71-82.
45.
PKCzeta is required for microtubule-based motility of vesicles containing the ntcp transporter.
Sarkar S, etal., Traffic. 2006 Aug;7(8):1078-91. Epub 2006 May 25.
46.
Expression of Protein Kinase C Isoforms in Pancreatic Islets and Liver of Male Goto-Kakizaki Rats, a Model of Type 2 Diabetes.
Seed Ahmed M, etal., PLoS One. 2015 Sep 23;10(9):e0135781. doi: 10.1371/journal.pone.0135781. eCollection 2015.
47.
Expression of protein kinase C isoforms in cardiac hypertrophy and heart failure due to volume overload.
Sentex E, etal., Can J Physiol Pharmacol. 2006 Feb;84(2):227-38.
48.
Persistent phosphorylation by protein kinase Mzeta maintains late-phase long-term potentiation.
Serrano P, etal., J Neurosci. 2005 Feb 23;25(8):1979-84.
49.
Rapid erasure of long-term memory associations in the cortex by an inhibitor of PKM zeta.
Shema R, etal., Science. 2007 Aug 17;317(5840):951-3.
50.
Protein kinase C-zeta as a downstream effector of phosphatidylinositol 3-kinase during insulin stimulation in rat adipocytes. Potential role in glucose transport.
Standaert ML, etal., J Biol Chem. 1997 Nov 28;272(48):30075-82.
51.
Effect of hyperglycemia on signal transduction in skeletal muscle from diabetic Goto-Kakizaki rats.
Steiler TL, etal., Endocrinology. 2003 Dec;144(12):5259-67. Epub 2003 Aug 21.
52.
The PAR-aPKC system: lessons in polarity.
Suzuki A and Ohno S, J Cell Sci. 2006 Mar 15;119(Pt 6):979-87.
53.
Molecular cloning and characterization of a novel protein kinase C-interacting protein with structural motifs related to RBCC family proteins.
Tokunaga C, etal., Biochem Biophys Res Commun 1998 Mar 17;244(2):353-9.
54.
Protein kinase Czeta and glycogen synthase kinase-3beta control neuronal polarity in developing rodent enteric neurons, whereas SMAD specific E3 ubiquitin protein ligase 1 promotes neurite growth but does not influence polarity.
Vohra BP, etal., J Neurosci. 2007 Aug 29;27(35):9458-68.
55.
PKM zeta maintains late long-term potentiation by N-ethylmaleimide-sensitive factor/GluR2-dependent trafficking of postsynaptic AMPA receptors.
Yao Y, etal., J Neurosci. 2008 Jul 30;28(31):7820-7. doi: 10.1523/JNEUROSCI.0223-08.2008.
Prkcz Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 171,101,774 - 171,212,694 (-) NCBI GRCr8 mRatBN7.2 5 165,817,786 - 165,930,386 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 165,819,466 - 165,930,367 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 168,525,295 - 168,635,221 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 170,346,708 - 170,456,637 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 170,309,234 - 170,419,166 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 172,658,071 - 172,769,492 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 172,658,748 - 172,769,421 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 176,116,787 - 176,228,206 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 172,061,825 - 172,172,793 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 172,072,319 - 172,179,534 (-) NCBI Celera 5 164,023,257 - 164,132,959 (-) NCBI Celera Cytogenetic Map 5 q36 NCBI
PRKCZ Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 2,048,504 - 2,185,395 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 2,050,411 - 2,185,395 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 1,981,850 - 2,116,834 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 1,971,769 - 2,106,694 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 2,014,070 - 2,148,996 NCBI Celera 1 476,373 - 611,123 (-) NCBI Celera Cytogenetic Map 1 p36.33 NCBI HuRef 1 1,259,190 - 1,392,660 (+) NCBI HuRef CHM1_1 1 1,969,035 - 2,101,756 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 1,484,023 - 1,620,370 (+) NCBI T2T-CHM13v2.0
Prkcz Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 155,344,579 - 155,445,856 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 155,344,586 - 155,445,818 (-) Ensembl GRCm39 Ensembl GRCm38 4 155,260,118 - 155,361,428 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 155,260,129 - 155,361,361 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 154,634,229 - 154,735,500 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 154,103,920 - 154,205,191 (-) NCBI MGSCv36 mm8 Celera 4 157,534,125 - 157,635,425 (-) NCBI Celera Cytogenetic Map 4 E2 NCBI cM Map 4 86.17 NCBI
Prkcz Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955486 8,947,579 - 9,021,702 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955486 8,947,579 - 9,021,702 (-) NCBI ChiLan1.0 ChiLan1.0
PRKCZ Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 226,079,980 - 226,217,579 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 224,740,974 - 224,876,729 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 763,942 - 901,531 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 1,918,653 - 2,046,236 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 1,920,219 - 2,045,855 (+) Ensembl panpan1.1 panPan2
PRKCZ Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 57,012,020 - 57,113,346 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 57,012,070 - 57,112,664 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 57,089,028 - 57,190,338 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 57,215,092 - 57,316,595 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 57,214,279 - 57,316,691 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 57,206,002 - 57,307,319 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 57,098,518 - 57,199,838 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 57,488,367 - 57,589,745 (+) NCBI UU_Cfam_GSD_1.0
Prkcz Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 28,082,811 - 28,162,827 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936737 1,303,887 - 1,321,944 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936737 1,303,502 - 1,383,135 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PRKCZ Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 64,068,577 - 64,163,472 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 64,073,343 - 64,159,187 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 58,385,685 - 58,460,767 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PRKCZ Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 129,367,309 - 129,502,681 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 129,365,679 - 129,485,818 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666054 33,720,444 - 33,872,633 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Prkcz
.
Predicted Target Of
Count of predictions: 216 Count of miRNA genes: 146 Interacting mature miRNAs: 165 Transcripts: ENSRNOT00000021285 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
10053720 Scort26 Serum corticosterone level QTL 26 2.06 0.0147 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 124965598 166875058 Rat 631272 Lanf1 Left ventricular atrial natriuretic factor QTL 1 12 heart left ventricle natriuretic peptide A amount (VT:0010596) heart left ventricle natriuretic peptide A level (CMO:0002165) 5 151113452 166875058 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 631562 Apr2 Acute phase response QTL 2 3.7 blood murinoglobulin 1 amount (VT:0010597) plasma murinoglobulin 1 level (CMO:0001931) 5 135927956 166875058 Rat 634349 Bp139 Blood pressure QTL 139 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128924607 166875058 Rat 61444 Strs2 Sensitivity to stroke QTL 2 4.7 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 5 135929696 166875058 Rat 724525 Bp147 Blood pressure QTL 147 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 126424772 166875058 Rat 1549904 Neuinf1 Neuroinflammation QTL 1 3 0 nervous system integrity trait (VT:0010566) blood T lymphocyte count (CMO:0000110) 5 154828214 166875058 Rat 738018 Anxrr4 Anxiety related response QTL 4 5.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 5 130130159 166875058 Rat 8552908 Pigfal4 Plasma insulin-like growth factor 1 level QTL 4 6.6 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 128506074 166875058 Rat 7794791 Mcs33 Mammary carcinoma susceptibility QTL 33 1.93 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 5 131345754 166875058 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1598861 Cm64 Cardiac mass QTL 64 2.9 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 127798274 166875058 Rat 1641920 Colcs1 Colorectal carcinoma susceptibility QTL 1 2.99 0.0055 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 5 121846814 166846814 Rat 1598819 Bp292 Blood pressure QTL 292 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 127798274 166875058 Rat 8694169 Bw148 Body weight QTL 148 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 128506074 166875058 Rat 1331721 Bp210 Blood pressure QTL 210 3.413 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 5 143069996 166846814 Rat
BF387071
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 165,856,505 - 165,856,681 (+) MAPPER mRatBN7.2 Rnor_6.0 5 172,695,873 - 172,696,048 NCBI Rnor6.0 Rnor_5.0 5 176,154,587 - 176,154,762 UniSTS Rnor5.0 RGSC_v3.4 5 172,097,807 - 172,097,982 UniSTS RGSC3.4 Celera 5 164,059,333 - 164,059,508 UniSTS RH 3.4 Map 5 1157.0 UniSTS Cytogenetic Map 5 q36 UniSTS
AW526905
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 165,864,617 - 165,864,738 (+) MAPPER mRatBN7.2 Rnor_6.0 5 172,703,775 - 172,703,895 NCBI Rnor6.0 Rnor_5.0 5 176,162,489 - 176,162,609 UniSTS Rnor5.0 RGSC_v3.4 5 172,106,891 - 172,107,011 UniSTS RGSC3.4 Celera 5 164,067,325 - 164,067,445 UniSTS RH 3.4 Map 5 1155.1 UniSTS Cytogenetic Map 5 q36 UniSTS
AW529459
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 165,885,784 - 165,885,981 (+) MAPPER mRatBN7.2 Rnor_6.0 5 172,724,910 - 172,725,105 NCBI Rnor6.0 Rnor_5.0 5 176,183,624 - 176,183,819 UniSTS Rnor5.0 RGSC_v3.4 5 172,128,239 - 172,128,434 UniSTS RGSC3.4 Celera 5 164,088,355 - 164,088,550 UniSTS RH 3.4 Map 5 1157.2 UniSTS Cytogenetic Map 5 q36 UniSTS
Prkcz
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 165,820,203 - 165,820,573 (+) MAPPER mRatBN7.2 Rnor_6.0 5 172,660,489 - 172,660,858 NCBI Rnor6.0 Rnor_5.0 5 176,119,203 - 176,119,572 UniSTS Rnor5.0 RGSC_v3.4 5 172,062,563 - 172,062,932 UniSTS RGSC3.4 Celera 5 164,023,995 - 164,024,364 UniSTS Cytogenetic Map 5 q36 UniSTS
Prkcz
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 165,819,856 - 165,820,078 (+) MAPPER mRatBN7.2 Rnor_6.0 5 172,660,142 - 172,660,363 NCBI Rnor6.0 Rnor_5.0 5 176,118,856 - 176,119,077 UniSTS Rnor5.0 RGSC_v3.4 5 172,062,216 - 172,062,437 UniSTS RGSC3.4 Celera 5 164,023,648 - 164,023,869 UniSTS Cytogenetic Map 5 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000021285 ⟹ ENSRNOP00000021285
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 165,819,466 - 165,930,367 (-) Ensembl Rnor_6.0 Ensembl 5 172,658,748 - 172,769,421 (-) Ensembl
RefSeq Acc Id:
NM_022507 ⟹ NP_071952
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 171,101,774 - 171,212,674 (-) NCBI mRatBN7.2 5 165,819,466 - 165,930,367 (-) NCBI Rnor_6.0 5 172,659,751 - 172,769,492 (-) NCBI Rnor_5.0 5 176,116,787 - 176,228,206 (-) NCBI RGSC_v3.4 5 172,061,825 - 172,172,793 (-) RGD Celera 5 164,023,257 - 164,132,959 (-) RGD
Sequence:
CGAGGCGGGTGCCGTCGGTCCCGCGCTGCGCGCTCCCTTCCGCGTTCCGCCGTCTGCCCCGCCTGGCAACCCGGCCCTGCTCGGGGGCCGCTAGCCATGGCCGGAGTGCCCTGGACACAGCGCTGACG
hide sequence
RefSeq Acc Id:
XM_006239536 ⟹ XP_006239598
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 171,102,134 - 171,194,781 (-) NCBI mRatBN7.2 5 165,817,786 - 165,912,473 (-) NCBI Rnor_6.0 5 172,658,071 - 172,752,236 (-) NCBI Rnor_5.0 5 176,116,787 - 176,228,206 (-) NCBI
Sequence:
CATGTGCCACCACCACCTTCTCAAGGGTCATTCTTGAGTCTTACTTGACTAGAGTACTAGGTGGCAGAGGAGGGGCCTTGCAAGCACCATGTCTATAAGTTCCACATTTTCTGAAGTGCCTTGCTGGT
hide sequence
RefSeq Acc Id:
XM_039109309 ⟹ XP_038965237
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 171,102,134 - 171,212,694 (-) NCBI mRatBN7.2 5 165,817,786 - 165,930,386 (-) NCBI
RefSeq Acc Id:
XM_039109311 ⟹ XP_038965239
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 171,102,134 - 171,193,776 (-) NCBI mRatBN7.2 5 165,817,786 - 165,911,500 (-) NCBI
RefSeq Acc Id:
XM_039109312 ⟹ XP_038965240
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 171,102,134 - 171,194,268 (-) NCBI mRatBN7.2 5 165,817,786 - 165,912,473 (-) NCBI
RefSeq Acc Id:
XM_063287191 ⟹ XP_063143261
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 171,102,134 - 171,193,879 (-) NCBI
RefSeq Acc Id:
XM_063287193 ⟹ XP_063143263
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 171,102,134 - 171,194,123 (-) NCBI
RefSeq Acc Id:
NP_071952 ⟸ NM_022507
- UniProtKB:
P09217 (UniProtKB/Swiss-Prot), A6IUP2 (UniProtKB/TrEMBL)
- Sequence:
MPSRTDPKMDRSGGRVRLKAHYGGDILITSVDPTTTFQDLCEEVRDMCGLHQQHPLTLKWVDSEGDPCTVSSQMELEEAFRLACQGRDEVLIIHVFPSIPEQPGMPCPGEDKSIYRRGARRWRKLYRA
hide sequence
RefSeq Acc Id:
XP_006239598 ⟸ XM_006239536
- Peptide Label:
isoform X4
- Sequence:
MDSVMPSQEPPVDDKNDGVDLPSEETDGIAYISSSRKHDNIKDDSEDLKPVIDGVDGIKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTEKHVFEQASSNP
hide sequence
Ensembl Acc Id:
ENSRNOP00000021285 ⟸ ENSRNOT00000021285
RefSeq Acc Id:
XP_038965237 ⟸ XM_039109309
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_038965240 ⟸ XM_039109312
- Peptide Label:
isoform X5
RefSeq Acc Id:
XP_038965239 ⟸ XM_039109311
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_063143263 ⟸ XM_063287193
- Peptide Label:
isoform X4
RefSeq Acc Id:
XP_063143261 ⟸ XM_063287191
- Peptide Label:
isoform X3
RGD ID: 13694319 Promoter ID: EPDNEW_R4843 Type: initiation region Name: Prkcz_1 Description: protein kinase C, zeta SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 172,769,430 - 172,769,490 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2001-07-23
Prkcz
protein kinase C, zeta
Name updated to reflect Human and Mouse nomenclature
67952 APPROVED
2001-07-23
Prkcz
14 - 3 - 3 - zeta isoform
Name withdrawn
67952 WITHDRAWN
Note Type
Note
Reference
gene_expression
expressed in pancreatic islets
70640
gene_process
mediates basal and IGF-1-dependent mitogenesis
61695
gene_process
mediates basal and IGF-1-dependent mitogenesis
70640
gene_process
enhances PDX-1 transcription factor binding activity after stimulation of IGF-1 in RIN 1046-38 cells
61695
gene_process
enhances PDX-1 transcription factor binding activity after stimulation of IGF-1 in RIN 1046-38 cells
70640
gene_regulation
induced by IL-1 and TNF-alpha; calcium- and diacylglycerol-insensitive
729628
