Symbol:
Prkca
Name:
protein kinase C, alpha
RGD ID:
3395
Description:
Enables calcium,diacylglycerol-dependent serine/threonine kinase activity and signaling receptor binding activity. Involved in several processes, including positive regulation of ERK1 and ERK2 cascade; protein phosphorylation; and response to corticosterone. Located in cytosol and perinuclear region of cytoplasm. Part of protein-containing complex. Used to study hypertension. Biomarker of brain ischemia; congestive heart failure; and ischemia. Human ortholog(s) of this gene implicated in dilated cardiomyopathy; high grade glioma (multiple); large cell carcinoma; and reproductive organ cancer (multiple). Orthologous to human PRKCA (protein kinase C alpha); PARTICIPATES IN eicosanoid signaling pathway; endothelin signaling pathway; Fc epsilon receptor mediated signaling pathway; INTERACTS WITH (S)-nicotine; 1-(5-isoquinolinesulfonyl)-2-methylpiperazine; 1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
PKC-A; PKC-alpha; Pkca; protein kinase C alpha type
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PRKCA (protein kinase C alpha)
HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther
Mus musculus (house mouse):
Prkca (protein kinase C, alpha)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Prkca (protein kinase C alpha)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PRKCA (protein kinase C alpha)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PRKCA (protein kinase C alpha)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Prkca (protein kinase C alpha)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PRKCA (protein kinase C alpha)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PRKCA (protein kinase C alpha)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Prkca (protein kinase C alpha)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
PRKCB (protein kinase C beta)
HGNC
OrthoDB
Alliance orthologs 3
Homo sapiens (human):
PRKCA (protein kinase C alpha)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Prkca (protein kinase C, alpha)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
PKC1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
Pkc53E
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
inaC
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
pkc-2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
prkcaa
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
prkcab
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|OrthoFinder|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
prkca
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Candidate Gene For:
Eau3 Pia10 Cia5
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 93,388,991 - 93,787,617 (-) NCBI GRCr8 mRatBN7.2 10 92,889,390 - 93,288,013 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 92,894,012 - 93,288,012 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 97,947,717 - 98,345,380 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 97,410,758 - 97,808,441 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 92,819,189 - 93,215,677 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 96,186,509 - 96,585,168 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 96,191,133 - 96,584,947 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 95,919,013 - 96,311,328 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 97,367,196 - 97,638,910 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 97,382,023 - 97,632,491 (-) NCBI Celera 10 91,557,626 - 91,951,823 (-) NCBI Celera RH 3.4 Map 10 1035.79 RGD Cytogenetic Map 10 q32.1 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Prkca Rat (1->4)-beta-D-glucan multiple interactions ISO Prkca (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PRKCA mRNA CTD PMID:36331819 Prkca Rat (5Z,8Z,11Z,13E)-15-HETE multiple interactions ISO PRKCA (Homo sapiens) 6480464 15-hydroxy-5 more ... CTD PMID:15613483 Prkca Rat (5Z,8Z,11Z,13E)-15-HETE multiple interactions ISO Prkca (Mus musculus) 6480464 calphostin C inhibits the reaction [15-hydroxy-5 more ... CTD PMID:15451026 Prkca Rat (5Z,8Z,11Z,13E)-15-HETE affects localization ISO PRKCA (Homo sapiens) 6480464 15-hydroxy-5 more ... CTD PMID:15613483 Prkca Rat (5Z,8Z,11Z,13E)-15-HETE increases activity ISO Prkca (Mus musculus) 6480464 15-hydroxy-5 more ... CTD PMID:15451026 Prkca Rat (9R)-9-[(dimethylamino)methyl]-6,7,10,11-tetrahydro-9H,18H-5,21:12,17-dimethenodibenzo[e,k]pyrrolo[3,4-h][1,4,13]oxadiazacyclohexadecine-18,20-dione affects response to substance ISO Prkca (Mus musculus) 6480464 PRKCA affects the susceptibility to ruboxistaurin CTD PMID:19556521 Prkca Rat (S)-naringenin multiple interactions ISO PRKCA (Homo sapiens) 6480464 [naringenin co-treated with bisphenol A] results in increased expression of PRKCA mRNA more ... CTD PMID:25866363 and PMID:36235125 Prkca Rat (S)-nicotine increases activity ISO PRKCA (Homo sapiens) 6480464 Nicotine results in increased activity of PRKCA protein CTD PMID:12421819 Prkca Rat (S)-nicotine increases expression EXP 6480464 Nicotine results in increased expression of PRKCA mRNA CTD PMID:20426880 Prkca Rat 1,2-dimethylhydrazine decreases expression ISO Prkca (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of PRKCA mRNA CTD PMID:22206623 and PMID:26388957 Prkca Rat 1,2-dimethylhydrazine multiple interactions ISO Prkca (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in decreased expression of PRKCA mRNA] CTD PMID:22206623 Prkca Rat 1-(5-isoquinolinesulfonyl)-2-methylpiperazine multiple interactions EXP 6480464 1-(5-Isoquinolinesulfonyl)-2-Methylpiperazine inhibits the reaction [Heptachlor affects the localization of PRKCA protein] and 1-(5-Isoquinolinesulfonyl)-2-Methylpiperazine inhibits the reaction [Tetradecanoylphorbol Acetate affects the localization of PRKCA protein] CTD PMID:14678745 Prkca Rat 1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile increases expression EXP 6480464 Citalopram results in increased expression of PRKCA mRNA CTD PMID:28467792 Prkca Rat 17alpha-ethynylestradiol affects expression ISO Prkca (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of PRKCA mRNA CTD PMID:17555576 Prkca Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of PRKCA mRNA CTD PMID:29097150 Prkca Rat 17beta-estradiol multiple interactions ISO PRKCA (Homo sapiens) 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in decreased expression of PRKCA mRNA more ... CTD PMID:19619570 and PMID:23000059 Prkca Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of PRKCA mRNA CTD PMID:26496021 Prkca Rat 17beta-estradiol increases phosphorylation ISO PRKCA (Homo sapiens) 6480464 Estradiol results in increased phosphorylation of PRKCA protein CTD PMID:23000059 Prkca Rat 17beta-estradiol decreases activity ISO PRKCA (Homo sapiens) 6480464 Estradiol results in decreased activity of PRKCA protein CTD PMID:8946564 Prkca Rat 17beta-estradiol increases expression ISO PRKCA (Homo sapiens) 6480464 Estradiol results in increased expression of PRKCA mRNA CTD PMID:19619570 Prkca Rat 17beta-estradiol 17-glucosiduronic acid multiple interactions EXP 6480464 Go 6976 inhibits the reaction [estradiol-17 beta-glucuronide affects the localization of PRKCA protein] CTD PMID:18972403 Prkca Rat 17beta-estradiol 17-glucosiduronic acid affects localization EXP 6480464 estradiol-17 beta-glucuronide affects the localization of PRKCA protein CTD PMID:18972403 Prkca Rat 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one multiple interactions ISO PRKCA (Homo sapiens) 6480464 Metribolone promotes the reaction [EZR protein binds to PRKCA protein] and PRKCA protein affects the reaction [Metribolone results in increased phosphorylation of EZR protein] CTD PMID:16873375 Prkca Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO PRKCA (Homo sapiens) 6480464 Dihydrotestosterone results in increased expression of PRKCA mRNA CTD PMID:29581250 Prkca Rat 2,2',4,4',5,5'-hexachlorobiphenyl increases expression EXP 6480464 2 more ... CTD PMID:16263226 Prkca Rat 2,2',4,4',5,5'-hexachlorobiphenyl increases activity EXP 6480464 2 more ... CTD PMID:16263226 Prkca Rat 2,2',4,4'-Tetrabromodiphenyl ether increases phosphorylation ISO PRKCA (Homo sapiens) 6480464 2 more ... CTD PMID:26988655 and PMID:28189027 Prkca Rat 2,2',4,4'-Tetrabromodiphenyl ether multiple interactions ISO Prkca (Mus musculus) 6480464 [Flame Retardants results in increased abundance of 2 more ... CTD PMID:38995820 Prkca Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Prkca (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Prkca Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO PRKCA (Homo sapiens) 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in decreased expression of PRKCA mRNA more ... CTD PMID:19121332 and PMID:19619570 Prkca Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PRKCA mRNA CTD PMID:32109520 Prkca Rat 2,3,7,8-tetrachlorodibenzodioxine affects activity ISO PRKCA (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the activity of PRKCA protein CTD PMID:8946564 Prkca Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Prkca (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PRKCA mRNA CTD PMID:21570461 Prkca Rat 2,3,7,8-tetrachlorodibenzodioxine affects localization ISO PRKCA (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the localization of PRKCA protein CTD PMID:19121332 Prkca Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO PRKCA (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of PRKCA mRNA CTD PMID:19619570 and PMID:19684285 Prkca Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO PRKCA (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of PRKCA mRNA CTD PMID:12377990 and PMID:19684285 Prkca Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin binds to AHR protein] which affects the localization of PRKCA protein CTD PMID:15761253 Prkca Rat 2,3,7,8-tetrachlorodibenzodioxine increases localization EXP 6480464 Tetrachlorodibenzodioxin results in increased localization of PRKCA protein CTD PMID:17222441 Prkca Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Prkca (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of PRKCA CTD PMID:17943652 Prkca Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Prkca Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects localization ISO PRKCA (Homo sapiens) 6480464 2 more ... CTD PMID:15475174 Prkca Rat 2,6-di-tert-butyl-4-methylphenol decreases expression ISO Prkca (Mus musculus) 6480464 Butylated Hydroxytoluene results in decreased expression of PRKCA protein CTD PMID:7716780 Prkca Rat 2-methylcholine affects expression ISO PRKCA (Homo sapiens) 6480464 beta-methylcholine affects the expression of PRKCA mRNA CTD PMID:21179406 Prkca Rat 3,3',4,4'-tetrachlorobiphenyl increases activity EXP 6480464 3 more ... CTD PMID:16263226 Prkca Rat 3,3',4,4'-tetrachlorobiphenyl increases expression EXP 6480464 3 more ... CTD PMID:16263226 Prkca Rat 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione multiple interactions ISO Prkca (Mus musculus) 6480464 bisindolylmaleimide I inhibits the reaction [Tetradecanoylphorbol Acetate results in increased activity of PRKCA protein] CTD PMID:20172950 Prkca Rat 3alpha-hydroxy-5beta-pregnan-20-one decreases expression ISO Prkca (Mus musculus) 6480464 Pregnanolone results in decreased expression of PRKCA protein CTD PMID:16581232 Prkca Rat 3H-1,2-dithiole-3-thione increases expression EXP 6480464 1 and 2-dithiol-3-thione results in increased expression of PRKCA mRNA CTD PMID:19162173 Prkca Rat 4,4'-sulfonyldiphenol affects methylation ISO Prkca (Mus musculus) 6480464 bisphenol S affects the methylation of PRKCA gene CTD PMID:31683443 Prkca Rat 4,4'-sulfonyldiphenol increases expression ISO PRKCA (Homo sapiens) 6480464 bisphenol S results in increased expression of PRKCA protein CTD PMID:34186270 Prkca Rat 4-amino-2,6-dinitrotoluene affects expression EXP 6480464 4-amino-2 and 6-dinitrotoluene affects the expression of PRKCA mRNA CTD PMID:21346803 Prkca Rat 4-hydroxyphenyl retinamide decreases expression ISO Prkca (Mus musculus) 6480464 Fenretinide results in decreased expression of PRKCA mRNA CTD PMID:28973697 Prkca Rat 5-(2-methylpiperazine-1-sulfonyl)isoquinoline multiple interactions EXP 6480464 1-(5-Isoquinolinesulfonyl)-2-Methylpiperazine inhibits the reaction [Heptachlor affects the localization of PRKCA protein] and 1-(5-Isoquinolinesulfonyl)-2-Methylpiperazine inhibits the reaction [Tetradecanoylphorbol Acetate affects the localization of PRKCA protein] CTD PMID:14678745 Prkca Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of PRKCA mRNA CTD PMID:24780913 Prkca Rat 7,12-dimethyltetraphene multiple interactions EXP 6480464 Ghee inhibits the reaction [9 more ... CTD PMID:21088903 Prkca Rat 7,12-dimethyltetraphene increases expression EXP 6480464 9 more ... CTD PMID:21088903 Prkca Rat 8-Br-cAMP increases expression ISO PRKCA (Homo sapiens) 6480464 8-Bromo Cyclic Adenosine Monophosphate results in increased expression of PRKCA mRNA CTD PMID:22079614 Prkca Rat acrylamide multiple interactions EXP 6480464 PRKCA protein affects the reaction [Acrylamide results in increased phosphorylation of MAPK1 protein] CTD PMID:33545342 Prkca Rat aflatoxin B1 decreases expression ISO PRKCA (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of PRKCA mRNA CTD PMID:21641981 Prkca Rat aflatoxin B1 decreases methylation ISO PRKCA (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of PRKCA intron CTD PMID:30157460 Prkca Rat Aflatoxin B2 alpha affects methylation ISO PRKCA (Homo sapiens) 6480464 aflatoxin B2 affects the methylation of PRKCA intron CTD PMID:30157460 Prkca Rat aldehydo-D-glucose increases phosphorylation ISO PRKCA (Homo sapiens) 6480464 Glucose results in increased phosphorylation of PRKCA protein CTD PMID:22162761 Prkca Rat aldehydo-D-glucose multiple interactions ISO Prkca (Mus musculus) 6480464 [Glucose co-treated with Silymarin] results in increased phosphorylation of PRKCA protein more ... CTD PMID:29753610 Prkca Rat aldehydo-D-glucose multiple interactions EXP 6480464 Glucose promotes the reaction [zinc chloride affects the localization of and results in increased activity of PRKCA protein] CTD PMID:20800666 Prkca Rat all-trans-retinoic acid multiple interactions ISO PRKCA (Homo sapiens) 6480464 PRKCA protein affects the reaction [Tretinoin results in increased activity of STS protein] CTD PMID:16178010 Prkca Rat all-trans-retinoic acid increases expression ISO PRKCA (Homo sapiens) 6480464 Tretinoin results in increased expression of PRKCA mRNA CTD PMID:33167477 Prkca Rat all-trans-retinoic acid multiple interactions EXP 6480464 [Tretinoin co-treated with Calcium] results in increased activity of PRKCA protein more ... CTD PMID:16114872 Prkca Rat all-trans-retinoic acid increases phosphorylation ISO Prkca (Mus musculus) 6480464 Tretinoin results in increased phosphorylation of PRKCA protein CTD PMID:19476501 Prkca Rat all-trans-retinoic acid increases expression ISO Prkca (Mus musculus) 6480464 Tretinoin results in increased expression of PRKCA mRNA and Tretinoin results in increased expression of PRKCA protein CTD PMID:11851873 and PMID:16505366 Prkca Rat all-trans-retinoic acid multiple interactions ISO Prkca (Mus musculus) 6480464 AGN 193109 inhibits the reaction [Tretinoin results in increased expression of PRKCA mRNA] CTD PMID:16505366 Prkca Rat all-trans-retinoic acid increases phosphorylation ISO PRKCA (Homo sapiens) 6480464 Tretinoin results in increased phosphorylation of PRKCA protein CTD PMID:19476501 Prkca Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PRKCA mRNA CTD PMID:16483693 Prkca Rat ammonium chloride decreases expression EXP 6480464 Ammonium Chloride results in decreased expression of PRKCA protein CTD PMID:16483693 Prkca Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of PRKCA mRNA CTD PMID:16101753 Prkca Rat amphetamine multiple interactions EXP 6480464 PRKCA protein promotes the reaction [Amphetamine results in decreased expression of NPY mRNA] CTD PMID:16101753 Prkca Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of PRKCA mRNA CTD PMID:30779732 Prkca Rat amphetamine increases response to substance EXP 6480464 PRKCA protein results in increased susceptibility to Amphetamine CTD PMID:16101753 Prkca Rat antirheumatic drug decreases expression ISO PRKCA (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of PRKCA mRNA CTD PMID:24449571 Prkca Rat aristolochic acid A decreases expression ISO PRKCA (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of PRKCA mRNA CTD PMID:33212167 Prkca Rat Aroclor 1254 affects localization ISO PRKCA (Homo sapiens) 6480464 Chlorodiphenyl (54% Chlorine) affects the localization of PRKCA protein CTD PMID:15475174 Prkca Rat arsane affects methylation ISO PRKCA (Homo sapiens) 6480464 Arsenic affects the methylation of PRKCA gene CTD PMID:25304211 Prkca Rat arsenic atom affects methylation ISO PRKCA (Homo sapiens) 6480464 Arsenic affects the methylation of PRKCA gene CTD PMID:25304211 Prkca Rat arsenite(3-) increases expression ISO Prkca (Mus musculus) 6480464 arsenite results in increased expression of PRKCA mRNA CTD PMID:33053406 Prkca Rat arsenous acid decreases expression ISO Prkca (Mus musculus) 6480464 Arsenic Trioxide results in decreased expression of PRKCA mRNA CTD PMID:24831965 Prkca Rat arsenous acid affects response to substance ISO PRKCA (Homo sapiens) 6480464 PRKCA mRNA affects the susceptibility to Arsenic Trioxide CTD PMID:23911876 Prkca Rat arsenous acid multiple interactions EXP 6480464 Arsenic Trioxide promotes the reaction [Berberine results in decreased activity of PRKCA protein] CTD PMID:18294404 Prkca Rat atorvastatin calcium multiple interactions EXP 6480464 [Atorvastatin co-treated with dapagliflozin] inhibits the reaction [[Fructose co-treated with Dietary Fats] results in increased expression of and results in increased phosphorylation of PRKCA protein] CTD PMID:32259528 Prkca Rat ATP multiple interactions ISO PRKCA (Homo sapiens) 6480464 [[Adenosine Triphosphate co-treated with PRKCA protein] results in increased phosphorylation of RALBP1 protein] which results in increased transport of Doxorubicin CTD PMID:16087181 Prkca Rat atrazine increases expression ISO PRKCA (Homo sapiens) 6480464 Atrazine results in increased expression of PRKCA mRNA CTD PMID:18585445 Prkca Rat Azoxymethane multiple interactions ISO Prkca (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of PRKCA mRNA CTD PMID:29950665 Prkca Rat Azoxymethane increases expression EXP 6480464 Azoxymethane results in increased expression of PRKCA mRNA CTD PMID:11983831 Prkca Rat baicalein decreases phosphorylation ISO PRKCA (Homo sapiens) 6480464 baicalein results in decreased phosphorylation of PRKCA protein CTD PMID:21803068 Prkca Rat beauvericin multiple interactions ISO PRKCA (Homo sapiens) 6480464 [beauvericin co-treated with enniatins] results in increased expression of PRKCA protein CTD PMID:32407736 Prkca Rat benzene decreases expression ISO PRKCA (Homo sapiens) 6480464 Benzene results in decreased expression of PRKCA mRNA CTD PMID:33064461 Prkca Rat benzo[a]pyrene decreases expression ISO Prkca (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of PRKCA mRNA CTD PMID:19770486 Prkca Rat benzo[a]pyrene affects methylation ISO PRKCA (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of PRKCA intron CTD PMID:30157460 Prkca Rat benzo[a]pyrene decreases methylation ISO Prkca (Mus musculus) 6480464 Benzo(a)pyrene results in decreased methylation of PRKCA intron CTD PMID:27901495 Prkca Rat benzo[a]pyrene decreases methylation ISO PRKCA (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of PRKCA 3' UTR CTD PMID:27901495 Prkca Rat benzo[a]pyrene decreases expression ISO PRKCA (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of PRKCA mRNA CTD PMID:16269432 more ... Prkca Rat benzo[a]pyrene diol epoxide I decreases expression ISO PRKCA (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 and PMID:26238291 Prkca Rat benzo[e]pyrene decreases methylation ISO PRKCA (Homo sapiens) 6480464 benzo(e)pyrene results in decreased methylation of PRKCA intron CTD PMID:30157460 Prkca Rat berberine multiple interactions EXP 6480464 arsenic trioxide promotes the reaction [Berberine results in decreased activity of PRKCA protein] and Berberine results in decreased activity of and affects the localization of PRKCA protein CTD PMID:18294404 Prkca Rat beta-lapachone decreases expression ISO PRKCA (Homo sapiens) 6480464 beta-lapachone results in decreased expression of PRKCA mRNA CTD PMID:38218311 Prkca Rat bis(2-ethylhexyl) phthalate multiple interactions ISO PRKCA (Homo sapiens) 6480464 PRKCA protein affects the reaction [Diethylhexyl Phthalate inhibits the reaction [lipopolysaccharide and Escherichia coli O111 B4 results in increased expression of IL12B protein]] CTD PMID:28673093 Prkca Rat bisoprolol decreases expression EXP 6480464 Bisoprolol results in decreased expression of PRKCA protein CTD PMID:20668454 Prkca Rat bisphenol A increases phosphorylation ISO PRKCA (Homo sapiens) 6480464 bisphenol A results in increased phosphorylation of PRKCA protein CTD PMID:22564983 Prkca Rat bisphenol A multiple interactions ISO PRKCA (Homo sapiens) 6480464 [naringenin co-treated with bisphenol A] results in increased expression of PRKCA mRNA and [naringenin metabolite co-treated with bisphenol A] results in increased expression of PRKCA mRNA CTD PMID:36235125 Prkca Rat bisphenol A decreases methylation ISO PRKCA (Homo sapiens) 6480464 bisphenol A results in decreased methylation of PRKCA gene CTD PMID:31601247 Prkca Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PRKCA mRNA CTD PMID:29097150 Prkca Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PRKCA mRNA CTD PMID:25181051 more ... Prkca Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of PRKCA mRNA and [Phytochemicals co-treated with bisphenol A] affects the expression of PRKCA CTD PMID:20136622 and PMID:26496021 Prkca Rat bisphenol AF increases expression ISO PRKCA (Homo sapiens) 6480464 bisphenol AF results in increased expression of PRKCA protein CTD PMID:34186270 Prkca Rat Bisphenol B increases expression ISO PRKCA (Homo sapiens) 6480464 bisphenol B results in increased expression of PRKCA protein CTD PMID:34186270 Prkca Rat bisphenol F increases expression ISO PRKCA (Homo sapiens) 6480464 bisphenol F results in increased expression of PRKCA protein CTD PMID:34186270 Prkca Rat brimonidine tartrate affects localization EXP 6480464 Brimonidine Tartrate affects the localization of PRKCA protein CTD PMID:12388232 Prkca Rat brimonidine tartrate multiple interactions EXP 6480464 Nitric Oxide deficiency promotes the reaction [Brimonidine Tartrate affects the localization of PRKCA protein] CTD PMID:12388232 Prkca Rat bryostatin 1 decreases expression ISO PRKCA (Homo sapiens) 6480464 bryostatin 1 results in decreased expression of PRKCA protein CTD PMID:8892972 Prkca Rat bryostatin 1 multiple interactions ISO PRKCA (Homo sapiens) 6480464 [bryostatin 1 co-treated with mezerein] results in decreased expression of PRKCA protein CTD PMID:8892972 Prkca Rat butan-1-ol multiple interactions EXP 6480464 [1-Butanol inhibits the reaction [PRKCA protein binds to PLD1 protein]] which results in decreased activity of PLD1 protein CTD PMID:15652502 Prkca Rat cadmium atom decreases expression EXP 6480464 Cadmium results in decreased expression of PRKCA protein CTD PMID:25981801 Prkca Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of PRKCA protein CTD PMID:25981801 Prkca Rat cadmium dichloride increases expression ISO PRKCA (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of PRKCA mRNA CTD PMID:38382870 Prkca Rat calcium atom multiple interactions EXP 6480464 [Tretinoin co-treated with Calcium] results in increased activity of PRKCA protein CTD PMID:16114872 Prkca Rat calcium atom increases response to substance EXP 6480464 PRKCA protein results in increased susceptibility to Calcium CTD PMID:12388232 Prkca Rat calcium(0) multiple interactions EXP 6480464 [Tretinoin co-treated with Calcium] results in increased activity of PRKCA protein CTD PMID:16114872 Prkca Rat calcium(0) increases response to substance EXP 6480464 PRKCA protein results in increased susceptibility to Calcium CTD PMID:12388232 Prkca Rat Calphostin C multiple interactions EXP 6480464 calphostin C inhibits the reaction [Heptachlor affects the localization of PRKCA protein] and calphostin C inhibits the reaction [Tetradecanoylphorbol Acetate affects the localization of PRKCA protein] CTD PMID:14678745 Prkca Rat Calphostin C multiple interactions ISO Prkca (Mus musculus) 6480464 calphostin C inhibits the reaction [15-hydroxy-5 more ... CTD PMID:15451026 more ... Prkca Rat Calphostin C multiple interactions ISO PRKCA (Homo sapiens) 6480464 calphostin C inhibits the reaction [Tetrachlorodibenzodioxin results in increased activity of PRKCA protein] and calphostin C inhibits the reaction [Tetradecanoylphorbol Acetate results in increased activity of PRKCA protein] CTD PMID:16091123 and PMID:19121332 Prkca Rat cannabidiol increases expression ISO Prkca (Mus musculus) 6480464 Cannabidiol results in increased expression of PRKCA mRNA CTD PMID:33019509 Prkca Rat cannabigerol increases expression ISO Prkca (Mus musculus) 6480464 cannabigerol results in increased expression of PRKCA mRNA CTD PMID:33019509 Prkca Rat capsaicin multiple interactions ISO PRKCA (Homo sapiens) 6480464 bisindolylmaleimide inhibits the reaction [Capsaicin results in increased expression of PRKCA protein] CTD PMID:21474332 Prkca Rat capsaicin multiple interactions EXP 6480464 chelerythrine inhibits the reaction [Capsaicin results in increased expression of PRKCA protein] and iodoresiniferatoxin inhibits the reaction [Capsaicin results in increased expression of PRKCA protein] CTD PMID:18752301 Prkca Rat capsaicin increases expression EXP 6480464 Capsaicin results in increased expression of PRKCA mRNA and Capsaicin results in increased expression of PRKCA protein CTD PMID:18752301 Prkca Rat capsaicin increases expression ISO PRKCA (Homo sapiens) 6480464 Capsaicin results in increased expression of PRKCA protein CTD PMID:21474332 Prkca Rat carbamazepine affects expression ISO PRKCA (Homo sapiens) 6480464 Carbamazepine affects the expression of PRKCA mRNA CTD PMID:24752500 Prkca Rat carbon nanotube decreases expression ISO Prkca (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Prkca Rat carvedilol decreases expression EXP 6480464 carvedilol results in decreased expression of PRKCA protein CTD PMID:20668454 Prkca Rat celecoxib multiple interactions ISO Prkca (Mus musculus) 6480464 Celecoxib inhibits the reaction [deoxynivalenol affects the localization of PRKCA protein] CTD PMID:32416088 Prkca Rat CGP 52608 multiple interactions ISO PRKCA (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to PRKCA gene] CTD PMID:28238834 Prkca Rat chelerythrine multiple interactions EXP 6480464 chelerythrine inhibits the reaction [Capsaicin results in increased expression of PRKCA protein] CTD PMID:18752301 Prkca Rat chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of PRKCA mRNA CTD PMID:18668222 Prkca Rat chromium(6+) multiple interactions ISO PRKCA (Homo sapiens) 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in decreased expression of PRKCA mRNA CTD PMID:38479592 Prkca Rat cisplatin multiple interactions ISO PRKCA (Homo sapiens) 6480464 [[PRKCA protein results in increased phosphorylation of GSTP1 protein] which results in increased metabolism of Cisplatin] which results in decreased susceptibility to Cisplatin more ... CTD PMID:20654585 and PMID:27392435 Prkca Rat cisplatin decreases expression ISO PRKCA (Homo sapiens) 6480464 Cisplatin results in decreased expression of PRKCA mRNA CTD PMID:19561079 more ... Prkca Rat citalopram increases expression EXP 6480464 Citalopram results in increased expression of PRKCA mRNA CTD PMID:28467792 Prkca Rat clobetasol decreases expression ISO Prkca (Mus musculus) 6480464 Clobetasol results in decreased expression of PRKCA mRNA CTD PMID:27462272 Prkca Rat cobalt dichloride decreases expression ISO PRKCA (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of PRKCA mRNA CTD PMID:19320972 and PMID:19376846 Prkca Rat cobalt dichloride multiple interactions EXP 6480464 cobaltous chloride results in increased oxidation of and results in increased activity of PRKCA protein CTD PMID:18375950 Prkca Rat cocaine increases expression EXP 6480464 Cocaine results in increased expression of PRKCA protein CTD PMID:12808488 Prkca Rat cocaine decreases expression ISO Prkca (Mus musculus) 6480464 Cocaine results in decreased expression of PRKCA mRNA CTD PMID:18355967 Prkca Rat cocaine multiple interactions ISO Prkca (Mus musculus) 6480464 FOS protein mutant form inhibits the reaction [Cocaine results in decreased expression of PRKCA mRNA] CTD PMID:18355967 Prkca Rat copper atom multiple interactions ISO PRKCA (Homo sapiens) 6480464 [Thiosemicarbazones binds to Copper] which results in decreased expression of PRKCA protein CTD PMID:20931265 Prkca Rat copper atom decreases expression EXP 6480464 Copper deficiency results in decreased expression of PRKCA protein CTD PMID:11983831 Prkca Rat copper(0) multiple interactions ISO PRKCA (Homo sapiens) 6480464 [Thiosemicarbazones binds to Copper] which results in decreased expression of PRKCA protein CTD PMID:20931265 Prkca Rat copper(0) decreases expression EXP 6480464 Copper deficiency results in decreased expression of PRKCA protein CTD PMID:11983831 Prkca Rat corticosterone multiple interactions ISO Prkca (Mus musculus) 6480464 1-(6-((3-methoxyestra-1 more ... CTD PMID:16581232 Prkca Rat coumarin increases phosphorylation ISO PRKCA (Homo sapiens) 6480464 coumarin results in increased phosphorylation of PRKCA protein CTD PMID:35688186 Prkca Rat crocidolite asbestos increases activity ISO Prkca (Mus musculus) 6480464 Asbestos and Crocidolite results in increased activity of PRKCA protein CTD PMID:12626342 Prkca Rat crocidolite asbestos increases expression ISO Prkca (Mus musculus) 6480464 Asbestos and Crocidolite results in increased expression of PRKCA protein CTD PMID:12626342 Prkca Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of PRKCA mRNA CTD PMID:26577399 Prkca Rat curcumin multiple interactions ISO PRKCA (Homo sapiens) 6480464 [PRKCA protein results in increased phosphorylation of CFTR protein] promotes the reaction [Curcumin results in increased activity of CFTR protein] and PRKCA protein affects the reaction [Curcumin results in increased expression of HMOX1 protein] CTD PMID:17178710 and PMID:18357586 Prkca Rat curcumin decreases expression ISO PRKCA (Homo sapiens) 6480464 Curcumin analog results in decreased expression of PRKCA mRNA CTD PMID:26409325 Prkca Rat D-gluconic acid multiple interactions EXP 6480464 [gluconic acid co-treated with Deoxycholic Acid] results in increased expression of PRKCA mRNA CTD PMID:16556975 Prkca Rat D-glucose multiple interactions EXP 6480464 Glucose promotes the reaction [zinc chloride affects the localization of and results in increased activity of PRKCA protein] CTD PMID:20800666 Prkca Rat D-glucose multiple interactions ISO Prkca (Mus musculus) 6480464 [Glucose co-treated with Silymarin] results in increased phosphorylation of PRKCA protein more ... CTD PMID:29753610 Prkca Rat D-glucose increases phosphorylation ISO PRKCA (Homo sapiens) 6480464 Glucose results in increased phosphorylation of PRKCA protein CTD PMID:22162761 Prkca Rat daidzein increases activity EXP 6480464 daidzein results in increased activity of PRKCA protein CTD PMID:16972265 Prkca Rat dapagliflozin multiple interactions EXP 6480464 [Atorvastatin co-treated with dapagliflozin] inhibits the reaction [[Fructose co-treated with Dietary Fats] results in increased expression of and results in increased phosphorylation of PRKCA protein] CTD PMID:32259528 Prkca Rat deoxycholic acid multiple interactions EXP 6480464 [gluconic acid co-treated with Deoxycholic Acid] results in increased expression of PRKCA mRNA CTD PMID:16556975 Prkca Rat deoxynivalenol multiple interactions ISO Prkca (Mus musculus) 6480464 Celecoxib inhibits the reaction [deoxynivalenol affects the localization of PRKCA protein] and Ro 31-8220 inhibits the reaction [deoxynivalenol affects the localization of PRKCA protein] CTD PMID:32416088 Prkca Rat deoxynivalenol affects localization ISO Prkca (Mus musculus) 6480464 deoxynivalenol affects the localization of PRKCA protein CTD PMID:32416088 Prkca Rat dexamethasone affects expression ISO PRKCA (Homo sapiens) 6480464 Dexamethasone affects the expression of PRKCA mRNA CTD PMID:12732289 Prkca Rat dextran sulfate multiple interactions ISO Prkca (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of PRKCA mRNA CTD PMID:29950665 Prkca Rat diarsenic trioxide affects response to substance ISO PRKCA (Homo sapiens) 6480464 PRKCA mRNA affects the susceptibility to Arsenic Trioxide CTD PMID:23911876 Prkca Rat diarsenic trioxide multiple interactions EXP 6480464 Arsenic Trioxide promotes the reaction [Berberine results in decreased activity of PRKCA protein] CTD PMID:18294404 Prkca Rat diarsenic trioxide decreases expression ISO Prkca (Mus musculus) 6480464 Arsenic Trioxide results in decreased expression of PRKCA mRNA CTD PMID:24831965 Prkca Rat dibutyl phthalate increases expression ISO Prkca (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of PRKCA mRNA CTD PMID:17361019 and PMID:21266533 Prkca Rat dichloroacetic acid increases expression ISO Prkca (Mus musculus) 6480464 Dichloroacetic Acid results in increased expression of PRKCA mRNA CTD PMID:28962523 Prkca Rat diclofenac affects expression ISO PRKCA (Homo sapiens) 6480464 Diclofenac affects the expression of PRKCA mRNA CTD PMID:24752500 Prkca Rat dicrotophos increases expression ISO PRKCA (Homo sapiens) 6480464 dicrotophos results in increased expression of PRKCA mRNA CTD PMID:28302478 Prkca Rat dieldrin affects methylation ISO Prkca (Mus musculus) 6480464 Dieldrin affects the methylation of PRKCA gene CTD PMID:38995845 Prkca Rat diethylstilbestrol decreases expression ISO Prkca (Mus musculus) 6480464 Diethylstilbestrol results in decreased expression of PRKCA CTD PMID:17943652 Prkca Rat dihydroartemisinin multiple interactions ISO PRKCA (Homo sapiens) 6480464 artenimol inhibits the reaction [Tetradecanoylphorbol Acetate affects the localization of PRKCA protein] and artenimol inhibits the reaction [Tetradecanoylphorbol Acetate results in increased phosphorylation of PRKCA protein] CTD PMID:20152819 Prkca Rat dimethylarsinic acid increases expression EXP 6480464 Cacodylic Acid results in increased expression of PRKCA mRNA CTD PMID:17481689 Prkca Rat dimethylarsinous acid decreases expression ISO PRKCA (Homo sapiens) 6480464 dimethylarsinous acid results in decreased expression of PRKCA mRNA CTD PMID:16507463 Prkca Rat disodium selenite multiple interactions EXP 6480464 Sodium Selenite inhibits the reaction [2-cresol results in increased expression of PRKCA mRNA] CTD PMID:21705299 Prkca Rat dizocilpine maleate multiple interactions ISO Prkca (Mus musculus) 6480464 Dizocilpine Maleate inhibits the reaction [Morphine promotes the reaction [OPRM1 protein binds to PRKCA protein]] CTD PMID:18652891 Prkca Rat dorsomorphin multiple interactions ISO PRKCA (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Prkca Rat doxorubicin multiple interactions ISO Prkca (Mus musculus) 6480464 Doxorubicin inhibits the reaction [Quercetin results in decreased expression of PRKCA protein] CTD PMID:15538571 Prkca Rat doxorubicin multiple interactions ISO PRKCA (Homo sapiens) 6480464 [[Adenosine Triphosphate co-treated with PRKCA protein] results in increased phosphorylation of RALBP1 protein] which results in increased transport of Doxorubicin and PRKCA protein affects the reaction [RALBP1 protein affects the transport of and affects the susceptibility to Doxorubicin] CTD PMID:16087181 and PMID:16579994 Prkca Rat emodin affects localization EXP 6480464 Emodin affects the localization of PRKCA protein CTD PMID:15133857 Prkca Rat enalapril decreases expression EXP 6480464 Enalapril results in decreased expression of PRKCA protein modified form CTD PMID:21565836 Prkca Rat enniatin multiple interactions ISO PRKCA (Homo sapiens) 6480464 [beauvericin co-treated with enniatins] results in increased expression of PRKCA protein CTD PMID:32407736 Prkca Rat entinostat increases expression ISO PRKCA (Homo sapiens) 6480464 entinostat results in increased expression of PRKCA mRNA CTD PMID:26272509 Prkca Rat entinostat multiple interactions ISO PRKCA (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PRKCA mRNA CTD PMID:27188386 Prkca Rat escitalopram increases expression EXP 6480464 Escitalopram results in increased expression of PRKCA mRNA CTD PMID:28467792 Prkca Rat ethanol multiple interactions ISO PRKCA (Homo sapiens) 6480464 [Ethanol results in increased localization of and results in increased activity of PRKCA protein] promotes the reaction [Tetradecanoylphorbol Acetate results in increased abundance of Superoxides] CTD PMID:10651808 Prkca Rat ethanol affects splicing ISO Prkca (Mus musculus) 6480464 Ethanol affects the splicing of PRKCA mRNA CTD PMID:30319688 Prkca Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of PRKCA mRNA CTD PMID:20655511 Prkca Rat ethanol multiple interactions EXP 6480464 Ethanol inhibits the reaction [Streptozocin results in increased expression of PRKCA protein] more ... CTD PMID:12198386 and PMID:20655511 Prkca Rat ethylene glycol bis(2-aminoethyl)tetraacetic acid multiple interactions ISO Prkca (Mus musculus) 6480464 Egtazic Acid inhibits the reaction [Tetradecanoylphorbol Acetate results in increased activity of PRKCA protein] CTD PMID:20172950 Prkca Rat Evodiamine increases phosphorylation ISO Prkca (Mus musculus) 6480464 evodiamine results in increased phosphorylation of PRKCA protein CTD PMID:19854188 Prkca Rat Evodiamine multiple interactions ISO Prkca (Mus musculus) 6480464 EGFR mutant form inhibits the reaction [evodiamine results in increased phosphorylation of PRKCA protein] and RTKI cpd inhibits the reaction [evodiamine results in increased phosphorylation of PRKCA protein] CTD PMID:19854188 Prkca Rat fluticasone decreases expression ISO PRKCA (Homo sapiens) 6480464 Fluticasone results in decreased expression of PRKCA protein CTD PMID:15634547 Prkca Rat folic acid multiple interactions ISO Prkca (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in decreased expression of PRKCA mRNA] CTD PMID:22206623 Prkca Rat folic acid decreases expression ISO Prkca (Mus musculus) 6480464 Folic Acid results in decreased expression of PRKCA mRNA CTD PMID:25629700 Prkca Rat folpet increases expression ISO Prkca (Mus musculus) 6480464 folpet results in increased expression of PRKCA mRNA CTD PMID:31558096 Prkca Rat fructose multiple interactions EXP 6480464 [Atorvastatin co-treated with dapagliflozin] inhibits the reaction [[Fructose co-treated with Dietary Fats] results in increased expression of and results in increased phosphorylation of PRKCA protein] and [Fructose co-treated with Dietary Fats] results in increased expression of and results in increased phosphorylation of PRKCA protein CTD PMID:32259528 Prkca Rat gallic acid decreases activity ISO PRKCA (Homo sapiens) 6480464 Gallic Acid results in decreased activity of PRKCA protein CTD PMID:22387266 Prkca Rat genistein increases expression ISO PRKCA (Homo sapiens) 6480464 Genistein results in increased expression of PRKCA mRNA CTD PMID:16705744 Prkca Rat genistein decreases expression ISO Prkca (Mus musculus) 6480464 Genistein results in decreased expression of PRKCA mRNA CTD PMID:32186404 Prkca Rat genistein multiple interactions EXP 6480464 Genistein inhibits the reaction [lead acetate results in increased phosphorylation of PRKCA protein] CTD PMID:26797587 Prkca Rat glucose multiple interactions EXP 6480464 Glucose promotes the reaction [zinc chloride affects the localization of and results in increased activity of PRKCA protein] CTD PMID:20800666 Prkca Rat glucose multiple interactions ISO Prkca (Mus musculus) 6480464 [Glucose co-treated with Silymarin] results in increased phosphorylation of PRKCA protein more ... CTD PMID:29753610 Prkca Rat glucose increases phosphorylation ISO PRKCA (Homo sapiens) 6480464 Glucose results in increased phosphorylation of PRKCA protein CTD PMID:22162761 Prkca Rat glyphosate decreases methylation EXP 6480464 Glyphosate results in decreased methylation of PRKCA gene CTD PMID:31011160 Prkca Rat Goe 6976 decreases expression ISO PRKCA (Homo sapiens) 6480464 Go 6976 results in decreased expression of PRKCA mRNA CTD PMID:16374459 Prkca Rat Goe 6976 decreases activity ISO PRKCA (Homo sapiens) 6480464 Go 6976 results in decreased activity of PRKCA protein CTD PMID:18357586 Prkca Rat Goe 6976 multiple interactions ISO PRKCA (Homo sapiens) 6480464 Go 6976 inhibits the reaction [isophthalate analog affects the localization of PRKCA protein] and Go 6976 results in decreased expression of and results in decreased activity of PRKCA protein CTD PMID:16374459 and PMID:23643828 Prkca Rat Goe 6976 multiple interactions EXP 6480464 Go 6976 inhibits the reaction [estradiol-17 beta-glucuronide affects the localization of PRKCA protein] CTD PMID:18972403 Prkca Rat Goe 6976 decreases phosphorylation ISO Prkca (Mus musculus) 6480464 Go 6976 results in decreased phosphorylation of PRKCA protein CTD PMID:19393235 Prkca Rat heptachlor multiple interactions EXP 6480464 1-(5-Isoquinolinesulfonyl)-2-Methylpiperazine inhibits the reaction [Heptachlor affects the localization of PRKCA protein] more ... CTD PMID:14678745 Prkca Rat hydrogen cyanide decreases expression ISO Prkca (Mus musculus) 6480464 Hydrogen Cyanide results in decreased expression of PRKCA mRNA CTD PMID:33914522 Prkca Rat hydrogen peroxide multiple interactions ISO Prkca (Mus musculus) 6480464 [PI103 co-treated with Hydrogen Peroxide] results in decreased expression of PRKCA protein and [Quercetin co-treated with Hydrogen Peroxide] results in decreased expression of PRKCA protein CTD PMID:27494022 Prkca Rat hydrogen peroxide affects expression ISO PRKCA (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of PRKCA mRNA and Hydrogen Peroxide affects the expression of PRKCA protein CTD PMID:21179406 Prkca Rat hydrogen peroxide increases phosphorylation ISO PRKCA (Homo sapiens) 6480464 Hydrogen Peroxide results in increased phosphorylation of PRKCA protein CTD PMID:19699794 Prkca Rat hydrogen peroxide multiple interactions EXP 6480464 [Hydrogen Peroxide co-treated with Vanadates] results in increased phosphorylation of [PLD1 protein binds to PRKCA protein] and [Hydrogen Peroxide co-treated with Vanadates] results in increased phosphorylation of PRKCA protein CTD PMID:15150437 Prkca Rat hydrogen peroxide increases expression ISO Prkca (Mus musculus) 6480464 Hydrogen Peroxide results in increased expression of PRKCA protein CTD PMID:12626342 Prkca Rat hydrogen peroxide increases activity ISO Prkca (Mus musculus) 6480464 Hydrogen Peroxide results in increased activity of PRKCA protein CTD PMID:12626342 Prkca Rat imidaprilat multiple interactions ISO Prkca (Mus musculus) 6480464 imidaprilat inhibits the reaction [AGT protein results in increased activity of and results in increased localization of PRKCA protein] CTD PMID:16257180 Prkca Rat irinotecan increases phosphorylation ISO PRKCA (Homo sapiens) 6480464 Irinotecan metabolite results in increased phosphorylation of PRKCA protein and Irinotecan results in increased phosphorylation of PRKCA protein CTD PMID:15723263 Prkca Rat isophthalic acid affects localization ISO PRKCA (Homo sapiens) 6480464 isophthalate analog affects the localization of PRKCA protein CTD PMID:23643828 Prkca Rat isophthalic acid multiple interactions ISO PRKCA (Homo sapiens) 6480464 Go 6976 inhibits the reaction [isophthalate analog affects the localization of PRKCA protein] CTD PMID:23643828 Prkca Rat isoprenaline increases expression EXP 6480464 Isoproterenol results in increased expression of PRKCA mRNA and Isoproterenol results in increased expression of PRKCA protein CTD PMID:12775975 Prkca Rat ivermectin decreases expression ISO PRKCA (Homo sapiens) 6480464 Ivermectin results in decreased expression of PRKCA protein CTD PMID:32959892 Prkca Rat lead diacetate decreases expression ISO PRKCA (Homo sapiens) 6480464 lead acetate results in decreased expression of PRKCA protein CTD PMID:11861786 Prkca Rat lead diacetate decreases expression EXP 6480464 lead acetate results in decreased expression of PRKCA protein CTD PMID:16547843 and PMID:25981801 Prkca Rat lead diacetate multiple interactions EXP 6480464 [lead acetate results in increased abundance of Lead] which results in decreased expression of and results in decreased phosphorylation of PRKCA protein more ... CTD PMID:26797587 and PMID:36925031 Prkca Rat lead diacetate increases phosphorylation EXP 6480464 lead acetate results in increased phosphorylation of PRKCA protein CTD PMID:26797587 Prkca Rat lead diacetate increases expression ISO Prkca (Mus musculus) 6480464 lead acetate results in increased expression of PRKCA mRNA CTD PMID:22609695 Prkca Rat lead diacetate multiple interactions ISO PRKCA (Homo sapiens) 6480464 4-((3-bromophenyl)amino)-6 more ... CTD PMID:11861786 and PMID:19133285 Prkca Rat lead(0) multiple interactions EXP 6480464 [lead acetate results in increased abundance of Lead] which results in decreased expression of and results in decreased phosphorylation of PRKCA protein more ... CTD PMID:19133285 and PMID:36925031 Prkca Rat lead(0) decreases expression EXP 6480464 Lead results in decreased expression of PRKCA protein CTD PMID:16547843 and PMID:25981801 Prkca Rat leflunomide increases expression ISO PRKCA (Homo sapiens) 6480464 leflunomide results in increased expression of PRKCA mRNA CTD PMID:28988120 Prkca Rat leptomycin B multiple interactions ISO PRKCA (Homo sapiens) 6480464 [leptomycin B co-treated with TP53 gene mutant form] results in decreased expression of PRKCA mRNA CTD PMID:20803015 Prkca Rat linsidomine multiple interactions EXP 6480464 [linsidomine co-treated with Staurosporine] results in decreased expression of PRKCA protein and Staurosporine inhibits the reaction [linsidomine results in increased phosphorylation of PRKCA protein] CTD PMID:11994256 Prkca Rat lipopolysaccharide multiple interactions ISO Prkca (Mus musculus) 6480464 Lipopolysaccharides affects the localization of and results in increased activity of PRKCA protein and PRKCA promotes the reaction [Lipopolysaccharides results in increased expression of TNF protein] CTD PMID:16330529 and PMID:22102721 Prkca Rat lithium atom increases response to substance ISO Prkca (Mus musculus) 6480464 PRKCA gene results in increased susceptibility to Lithium CTD PMID:25006961 Prkca Rat lithium atom decreases response to substance ISO Prkca (Mus musculus) 6480464 PRKCA gene mutant form results in decreased susceptibility to Lithium CTD PMID:25006961 Prkca Rat lithium atom multiple interactions ISO Prkca (Mus musculus) 6480464 PRKCA gene mutant form inhibits the reaction [Lithium results in decreased expression of AQP2 protein] and PRKCA gene mutant form inhibits the reaction [Lithium results in decreased expression of SLC14A2 protein] CTD PMID:25006961 Prkca Rat lithium hydride multiple interactions ISO Prkca (Mus musculus) 6480464 PRKCA gene mutant form inhibits the reaction [Lithium results in decreased expression of AQP2 protein] and PRKCA gene mutant form inhibits the reaction [Lithium results in decreased expression of SLC14A2 protein] CTD PMID:25006961 Prkca Rat lithium hydride decreases response to substance ISO Prkca (Mus musculus) 6480464 PRKCA gene mutant form results in decreased susceptibility to Lithium CTD PMID:25006961 Prkca Rat lithium hydride increases response to substance ISO Prkca (Mus musculus) 6480464 PRKCA gene results in increased susceptibility to Lithium CTD PMID:25006961 Prkca Rat lovastatin increases expression ISO PRKCA (Homo sapiens) 6480464 Lovastatin results in increased expression of PRKCA protein CTD PMID:38432573 Prkca Rat luteolin multiple interactions ISO PRKCA (Homo sapiens) 6480464 Luteolin analog inhibits the reaction [Tetradecanoylphorbol Acetate affects the localization of PRKCA protein] CTD PMID:30133131 Prkca Rat manganese atom increases phosphorylation EXP 6480464 Manganese results in increased phosphorylation of PRKCA protein CTD PMID:21812036 Prkca Rat manganese atom decreases expression EXP 6480464 Manganese results in decreased expression of PRKCA protein CTD PMID:25981801 Prkca Rat manganese(0) increases phosphorylation EXP 6480464 Manganese results in increased phosphorylation of PRKCA protein CTD PMID:21812036 Prkca Rat manganese(0) decreases expression EXP 6480464 Manganese results in decreased expression of PRKCA protein CTD PMID:25981801 Prkca Rat manganese(II) chloride multiple interactions EXP 6480464 1 more ... CTD PMID:17084486 Prkca Rat manganese(II) chloride decreases expression EXP 6480464 manganese chloride results in decreased expression of PRKCA protein CTD PMID:25981801 Prkca Rat manganese(II) chloride increases activity EXP 6480464 manganese chloride results in increased activity of PRKCA protein CTD PMID:17084486 Prkca Rat manganese(II) chloride affects localization EXP 6480464 manganese chloride affects the localization of PRKCA protein CTD PMID:17084486 Prkca Rat mercury atom increases expression EXP 6480464 Mercury results in increased expression of PRKCA mRNA CTD PMID:12730625 Prkca Rat mercury(0) increases expression EXP 6480464 Mercury results in increased expression of PRKCA mRNA CTD PMID:12730625 Prkca Rat metformin multiple interactions ISO PRKCA (Homo sapiens) 6480464 [Metformin co-treated with Pioglitazone] results in decreased expression of PRKCA mRNA and Metformin inhibits the reaction [Tetradecanoylphorbol Acetate results in increased phosphorylation of PRKCA protein] CTD PMID:20590612 and PMID:32589349 Prkca Rat metformin decreases expression ISO PRKCA (Homo sapiens) 6480464 Metformin results in decreased expression of PRKCA mRNA CTD PMID:32589349 Prkca Rat methamphetamine multiple interactions ISO PRKCA (Homo sapiens) 6480464 1-(6-((3-methoxyestra-1 more ... CTD PMID:33421459 Prkca Rat methamphetamine increases expression ISO PRKCA (Homo sapiens) 6480464 Methamphetamine results in increased expression of PRKCA mRNA and Methamphetamine results in increased expression of PRKCA protein CTD PMID:33421459 Prkca Rat methapyrilene decreases methylation ISO PRKCA (Homo sapiens) 6480464 Methapyrilene results in decreased methylation of PRKCA intron CTD PMID:30157460 Prkca Rat methotrexate decreases response to substance ISO PRKCA (Homo sapiens) 6480464 PRKCA mRNA results in decreased susceptibility to Methotrexate CTD PMID:18694510 Prkca Rat methoxychlor decreases expression EXP 6480464 Methoxychlor results in decreased expression of PRKCA mRNA CTD PMID:23303685 Prkca Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of PRKCA gene CTD PMID:35440735 Prkca Rat methylarsonic acid increases expression EXP 6480464 monomethylarsonic acid results in increased expression of PRKCA mRNA CTD PMID:17481689 Prkca Rat methylseleninic acid increases expression ISO PRKCA (Homo sapiens) 6480464 methylselenic acid results in increased expression of PRKCA mRNA CTD PMID:12517777 Prkca Rat methyltestosterone multiple interactions ISO PRKCA (Homo sapiens) 6480464 [Methyltestosterone co-treated with Cholic Acids] affects the expression of PRKCA mRNA CTD PMID:27344345 Prkca Rat Mezerein multiple interactions ISO PRKCA (Homo sapiens) 6480464 [bryostatin 1 co-treated with mezerein] results in decreased expression of PRKCA protein CTD PMID:8892972 Prkca Rat mianserin decreases expression ISO PRKCA (Homo sapiens) 6480464 Mianserin results in decreased expression of PRKCA mRNA CTD PMID:24154490 Prkca Rat microcystin-LR decreases expression EXP 6480464 cyanoginosin LR results in decreased expression of PRKCA mRNA CTD PMID:36657700 Prkca Rat mifepristone multiple interactions ISO Prkca (Mus musculus) 6480464 Mifepristone binds to and results in decreased activity of PRKCA protein CTD PMID:16581232 Prkca Rat miltefosine decreases phosphorylation ISO PRKCA (Homo sapiens) 6480464 miltefosine results in decreased phosphorylation of PRKCA protein CTD PMID:31265827 Prkca Rat mono(2-ethylhexyl) phthalate decreases expression ISO Prkca (Mus musculus) 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of PRKCA mRNA CTD PMID:22401849 Prkca Rat morphine multiple interactions ISO Prkca (Mus musculus) 6480464 Dizocilpine Maleate inhibits the reaction [Morphine promotes the reaction [OPRM1 protein binds to PRKCA protein]] more ... CTD PMID:18652891 Prkca Rat mycophenolic acid increases expression ISO PRKCA (Homo sapiens) 6480464 Mycophenolic Acid results in increased expression of PRKCA protein CTD PMID:21396949 Prkca Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of PRKCA gene CTD PMID:33148267 Prkca Rat N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide decreases activity ISO PRKCA (Homo sapiens) 6480464 N-(2-(4-bromocinnamylamino)ethyl)-5-isoquinolinesulfonamide results in decreased activity of PRKCA protein CTD PMID:16361081 Prkca Rat N-formyl-L-methionyl-L-leucyl-L-phenylalanine multiple interactions EXP 6480464 2-benzyl-3-(4-hydroxymethylphenyl)indazole inhibits the reaction [N-Formylmethionine Leucyl-Phenylalanine affects the localization of and results in increased phosphorylation of PRKCA protein] and N-Formylmethionine Leucyl-Phenylalanine affects the localization of and results in increased phosphorylation of PRKCA protein CTD PMID:19445920 Prkca Rat N-methyl-4-phenylpyridinium affects expression ISO PRKCA (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium affects the expression of PRKCA mRNA CTD PMID:12710931 Prkca Rat N-nitrosodiethylamine multiple interactions ISO Prkca (Mus musculus) 6480464 Diethylnitrosamine results in increased phosphorylation of and results in increased activity of PRKCA protein and MET protein inhibits the reaction [Diethylnitrosamine results in increased phosphorylation of and results in increased activity of PRKCA protein] CTD PMID:17942915 Prkca Rat N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of PRKCA mRNA and Diethylnitrosamine results in increased expression of PRKCA protein CTD PMID:17106253 and PMID:28804948 Prkca Rat N-nitrosodiethylamine multiple interactions EXP 6480464 bicyclol inhibits the reaction [Diethylnitrosamine results in increased expression of PRKCA mRNA] and Plant Extracts inhibits the reaction [Diethylnitrosamine results in increased expression of PRKCA protein] CTD PMID:17106253 and PMID:28804948 Prkca Rat nickel atom increases expression ISO PRKCA (Homo sapiens) 6480464 Nickel results in increased expression of PRKCA mRNA CTD PMID:24768652 and PMID:25583101 Prkca Rat nickel dichloride increases expression ISO PRKCA (Homo sapiens) 6480464 nickel chloride results in increased expression of PRKCA mRNA CTD PMID:17312168 Prkca Rat nicotine increases activity ISO PRKCA (Homo sapiens) 6480464 Nicotine results in increased activity of PRKCA protein CTD PMID:12421819 Prkca Rat nicotine increases expression EXP 6480464 Nicotine results in increased expression of PRKCA mRNA CTD PMID:20426880 Prkca Rat nimodipine multiple interactions EXP 6480464 Nimodipine inhibits the reaction [[lead acetate results in increased abundance of Lead] which results in decreased expression of and results in decreased phosphorylation of PRKCA protein] CTD PMID:36925031 Prkca Rat nitric oxide multiple interactions EXP 6480464 Nitric Oxide deficiency promotes the reaction [Brimonidine Tartrate affects the localization of PRKCA protein] CTD PMID:12388232 Prkca Rat o-cresol increases expression EXP 6480464 2-cresol results in increased expression of PRKCA mRNA CTD PMID:21705299 Prkca Rat o-cresol multiple interactions EXP 6480464 Sodium Selenite inhibits the reaction [2-cresol results in increased expression of PRKCA mRNA] CTD PMID:21705299 Prkca Rat obeticholic acid increases expression ISO PRKCA (Homo sapiens) 6480464 obeticholic acid results in increased expression of PRKCA mRNA CTD PMID:27939613 Prkca Rat ochratoxin A decreases expression EXP 6480464 ochratoxin A results in decreased expression of PRKCA mRNA CTD PMID:12700408 Prkca Rat p-cresol increases phosphorylation EXP 6480464 4-cresol results in increased phosphorylation of PRKCA protein CTD PMID:22813906 Prkca Rat p-cresol increases response to substance EXP 6480464 PRKCA protein results in increased susceptibility to 4-cresol CTD PMID:22813906 Prkca Rat p-cresol multiple interactions EXP 6480464 1 more ... CTD PMID:22813906 and PMID:23466501 Prkca Rat panobinostat multiple interactions ISO PRKCA (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PRKCA mRNA CTD PMID:27188386 Prkca Rat panobinostat increases expression ISO PRKCA (Homo sapiens) 6480464 panobinostat results in increased expression of PRKCA mRNA CTD PMID:26272509 Prkca Rat paracetamol decreases expression ISO PRKCA (Homo sapiens) 6480464 Acetaminophen results in decreased expression of PRKCA mRNA CTD PMID:21420995 Prkca Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of PRKCA mRNA CTD PMID:33387578 Prkca Rat paracetamol increases expression ISO PRKCA (Homo sapiens) 6480464 Acetaminophen results in increased expression of PRKCA mRNA CTD PMID:25704631 and PMID:29067470 Prkca Rat paricalcitol multiple interactions EXP 6480464 paricalcitol inhibits the reaction [EDN1 protein results in increased expression of PRKCA protein modified form] and paricalcitol inhibits the reaction [Phenylephrine results in increased expression of PRKCA protein modified form] CTD PMID:21565836 Prkca Rat paricalcitol decreases expression EXP 6480464 paricalcitol results in decreased expression of PRKCA protein modified form CTD PMID:21565836 Prkca Rat perfluorooctane-1-sulfonic acid affects expression ISO Prkca (Mus musculus) 6480464 perfluorooctane sulfonic acid affects the expression of PRKCA mRNA CTD PMID:19429403 Prkca Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Prkca (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PRKCA mRNA CTD PMID:36331819 Prkca Rat perfluorooctanoic acid affects expression ISO Prkca (Mus musculus) 6480464 perfluorooctanoic acid affects the expression of PRKCA mRNA CTD PMID:19429403 Prkca Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of PRKCA gene CTD PMID:33148267 Prkca Rat phenethyl isothiocyanate multiple interactions ISO PRKCA (Homo sapiens) 6480464 phenethyl isothiocyanate results in decreased phosphorylation of and results in decreased expression of PRKCA protein CTD PMID:26456889 Prkca Rat phenobarbital affects expression ISO Prkca (Mus musculus) 6480464 Phenobarbital affects the expression of PRKCA mRNA CTD PMID:19136022 Prkca Rat phenylephrine multiple interactions ISO Prkca (Mus musculus) 6480464 DGKE protein inhibits the reaction [Phenylephrine results in increased localization of PRKCA protein] and Diglycerides affects the reaction [Phenylephrine results in increased localization of PRKCA protein] CTD PMID:18487437 Prkca Rat phenylephrine increases expression EXP 6480464 Phenylephrine results in increased expression of PRKCA protein modified form CTD PMID:21565836 Prkca Rat phenylephrine multiple interactions EXP 6480464 GLRX3 protein inhibits the reaction [Phenylephrine results in increased phosphorylation of and results in increased activity of PRKCA protein] more ... CTD PMID:16809552 and PMID:21565836 Prkca Rat phenylephrine increases activity EXP 6480464 Phenylephrine results in increased activity of PRKCA protein CTD PMID:12435817 Prkca Rat phenylephrine increases localization ISO Prkca (Mus musculus) 6480464 Phenylephrine results in increased localization of PRKCA protein CTD PMID:18487437 Prkca Rat phenylmercury acetate increases expression ISO PRKCA (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of PRKCA mRNA CTD PMID:26272509 Prkca Rat phenylmercury acetate multiple interactions ISO PRKCA (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PRKCA mRNA CTD PMID:27188386 Prkca Rat phorbol 12,13-dibutanoate decreases expression ISO PRKCA (Homo sapiens) 6480464 Phorbol 12 and 13-Dibutyrate results in decreased expression of PRKCA protein CTD PMID:17171646 Prkca Rat phorbol 12,13-dibutanoate multiple interactions EXP 6480464 Phorbol 12 and 13-Dibutyrate results in decreased expression of and affects the localization of PRKCA protein CTD PMID:9242432 Prkca Rat phorbol 12,13-dibutanoate increases expression ISO Prkca (Mus musculus) 6480464 Phorbol 12 and 13-Dibutyrate results in increased expression of PRKCA protein CTD PMID:12626342 Prkca Rat phorbol 13-acetate 12-myristate decreases expression ISO PRKCA (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate results in decreased expression of PRKCA protein CTD PMID:15330761 more ... Prkca Rat phorbol 13-acetate 12-myristate increases phosphorylation ISO PRKCA (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate results in increased phosphorylation of PRKCA protein CTD PMID:20152819 more ... Prkca Rat phorbol 13-acetate 12-myristate affects localization ISO PRKCA (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate affects the localization of PRKCA protein CTD PMID:15976015 more ... Prkca Rat phorbol 13-acetate 12-myristate increases activity ISO Prkca (Mus musculus) 6480464 Tetradecanoylphorbol Acetate results in increased activity of PRKCA protein CTD PMID:20172950 Prkca Rat phorbol 13-acetate 12-myristate affects localization EXP 6480464 Tetradecanoylphorbol Acetate affects the localization of PRKCA protein CTD PMID:12720544 more ... Prkca Rat phorbol 13-acetate 12-myristate decreases expression EXP 6480464 Tetradecanoylphorbol Acetate results in decreased expression of PRKCA protein CTD PMID:12590138 Prkca Rat phorbol 13-acetate 12-myristate increases activity ISO PRKCA (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate results in increased activity of PRKCA protein CTD PMID:21705328 Prkca Rat phorbol 13-acetate 12-myristate increases expression ISO PRKCA (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate results in increased expression of PRKCA protein modified form CTD PMID:16532021 Prkca Rat phorbol 13-acetate 12-myristate multiple interactions EXP 6480464 1-(5-Isoquinolinesulfonyl)-2-Methylpiperazine inhibits the reaction [Tetradecanoylphorbol Acetate affects the localization of PRKCA protein] more ... CTD PMID:12590138 more ... Prkca Rat phorbol 13-acetate 12-myristate increases localization ISO Prkca (Mus musculus) 6480464 Tetradecanoylphorbol Acetate results in increased localization of PRKCA protein CTD PMID:10656618 Prkca Rat phorbol 13-acetate 12-myristate increases expression ISO Prkca (Mus musculus) 6480464 Tetradecanoylphorbol Acetate results in increased expression of PRKCA mRNA CTD PMID:17106253 Prkca Rat phorbol 13-acetate 12-myristate affects localization ISO Prkca (Mus musculus) 6480464 Tetradecanoylphorbol Acetate affects the localization of PRKCA protein CTD PMID:16343552 Prkca Rat phorbol 13-acetate 12-myristate multiple interactions ISO Prkca (Mus musculus) 6480464 4-(5-benzo(1 more ... CTD PMID:16099101 more ... Prkca Rat phorbol 13-acetate 12-myristate decreases phosphorylation ISO PRKCA (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate results in decreased phosphorylation of PRKCA protein CTD PMID:15380616 Prkca Rat phorbol 13-acetate 12-myristate multiple interactions ISO PRKCA (Homo sapiens) 6480464 [Ethanol results in increased localization of and results in increased activity of PRKCA protein] promotes the reaction [Tetradecanoylphorbol Acetate results in increased abundance of Superoxides] more ... CTD PMID:10651808 more ... Prkca Rat pioglitazone multiple interactions ISO PRKCA (Homo sapiens) 6480464 [Metformin co-treated with Pioglitazone] results in decreased expression of PRKCA mRNA CTD PMID:32589349 Prkca Rat pioglitazone decreases expression ISO PRKCA (Homo sapiens) 6480464 Pioglitazone results in decreased expression of PRKCA mRNA CTD PMID:32589349 Prkca Rat piperine multiple interactions ISO PRKCA (Homo sapiens) 6480464 piperine inhibits the reaction [Tetradecanoylphorbol Acetate results in increased phosphorylation of and affects the localization of PRKCA protein] CTD PMID:21354279 Prkca Rat pirinixic acid affects expression ISO Prkca (Mus musculus) 6480464 pirinixic acid affects the expression of PRKCA mRNA CTD PMID:19136022 Prkca Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of PRKCA mRNA CTD PMID:12832660 Prkca Rat pirinixic acid increases expression ISO Prkca (Mus musculus) 6480464 pirinixic acid results in increased expression of PRKCA mRNA CTD PMID:20813756 Prkca Rat procyanidin B2 multiple interactions EXP 6480464 procyanidin B2 inhibits the reaction [Streptozocin results in increased expression of PRKCA protein] CTD PMID:25199697 Prkca Rat progesterone decreases phosphorylation ISO Prkca (Mus musculus) 6480464 Progesterone results in decreased phosphorylation of PRKCA protein CTD PMID:18615583 Prkca Rat progesterone multiple interactions ISO Prkca (Mus musculus) 6480464 PRKCA protein promotes the reaction [[Tetradecanoylphorbol Acetate results in increased expression of and results in increased phosphorylation of STAR protein] which results in increased abundance of Progesterone] and Progesterone inhibits the reaction [C3 protein results in increased phosphorylation of PRKCA protein] CTD PMID:18615583 and PMID:21047949 Prkca Rat propane-1,2-diol multiple interactions EXP 6480464 [Propylene Glycol co-treated with Tobacco Smoke Pollution] results in increased expression of PRKCA mRNA more ... CTD PMID:18278451 Prkca Rat propranolol decreases expression EXP 6480464 Propranolol results in decreased expression of PRKCA protein CTD PMID:20668454 Prkca Rat puerarin multiple interactions EXP 6480464 puerarin inhibits the reaction [[Propylene Glycol co-treated with Tobacco Smoke Pollution] results in increased expression of PRKCA mRNA] and puerarin inhibits the reaction [[Propylene Glycol co-treated with Tobacco Smoke Pollution] results in increased expression of PRKCA protein] CTD PMID:18278451 Prkca Rat quercetin decreases expression ISO PRKCA (Homo sapiens) 6480464 Quercetin results in decreased expression of PRKCA protein CTD PMID:26311153 Prkca Rat quercetin decreases expression ISO Prkca (Mus musculus) 6480464 Quercetin results in decreased expression of PRKCA more ... CTD PMID:15538571 more ... Prkca Rat quercetin multiple interactions ISO Prkca (Mus musculus) 6480464 [Quercetin co-treated with Hydrogen Peroxide] results in decreased expression of PRKCA protein and Doxorubicin inhibits the reaction [Quercetin results in decreased expression of PRKCA protein] CTD PMID:15538571 and PMID:27494022 Prkca Rat reactive oxygen species multiple interactions EXP 6480464 Reactive Oxygen Species affects the reaction [manganese chloride results in increased activity of PRKCA protein] CTD PMID:17084486 Prkca Rat resveratrol multiple interactions ISO PRKCA (Homo sapiens) 6480464 PRKCA protein affects the reaction [EGF protein inhibits the reaction [resveratrol results in increased phosphorylation of and results in increased activity of and results in increased localization of MAPK1 protein]] more ... CTD PMID:14739659 more ... Prkca Rat resveratrol decreases expression ISO Prkca (Mus musculus) 6480464 resveratrol results in decreased expression of PRKCA protein CTD PMID:25505154 Prkca Rat resveratrol decreases activity ISO PRKCA (Homo sapiens) 6480464 resveratrol results in decreased activity of PRKCA protein CTD PMID:11709203 Prkca Rat riddelliine increases expression EXP 6480464 riddelliine results in increased expression of PRKCA mRNA CTD PMID:18047727 Prkca Rat ritonavir multiple interactions ISO Prkca (Mus musculus) 6480464 Ritonavir binds to and affects the localization of PRKCA protein CTD PMID:22020176 Prkca Rat ritonavir increases activity ISO Prkca (Mus musculus) 6480464 Ritonavir results in increased activity of PRKCA protein CTD PMID:22020176 Prkca Rat ritonavir increases expression ISO Prkca (Mus musculus) 6480464 Ritonavir results in increased expression of PRKCA protein CTD PMID:22020176 Prkca Rat Ro 31-8220 multiple interactions ISO Prkca (Mus musculus) 6480464 Ro 31-8220 inhibits the reaction [deoxynivalenol affects the localization of PRKCA protein] CTD PMID:32416088 Prkca Rat Ro 31-8220 multiple interactions EXP 6480464 Ro 31-8220 promotes the reaction [[lead acetate results in increased abundance of Lead] which results in decreased expression of and results in decreased phosphorylation of PRKCA protein] CTD PMID:36925031 Prkca Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of PRKCA mRNA CTD PMID:28374803 Prkca Rat S-butyl-DL-homocysteine (S,R)-sulfoximine decreases activity EXP 6480464 Buthionine Sulfoximine results in decreased activity of PRKCA protein CTD PMID:11118818 Prkca Rat S-nitroso-N-acetyl-D-penicillamine multiple interactions ISO Prkca (Mus musculus) 6480464 S-Nitroso-N-Acetylpenicillamine promotes the reaction [OPRM1 protein binds to PRKCA protein] CTD PMID:18652891 Prkca Rat SB 431542 multiple interactions ISO Prkca (Mus musculus) 6480464 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide inhibits the reaction [Tetradecanoylphorbol Acetate results in increased activity of PRKCA protein] CTD PMID:20172950 Prkca Rat SB 431542 multiple interactions ISO PRKCA (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Prkca Rat silicon dioxide decreases expression ISO Prkca (Mus musculus) 6480464 Silicon Dioxide results in decreased expression of PRKCA mRNA CTD PMID:23221170 Prkca Rat sirolimus multiple interactions ISO PRKCA (Homo sapiens) 6480464 Sirolimus inhibits the reaction [Estradiol results in increased phosphorylation of PRKCA protein] CTD PMID:23000059 Prkca Rat sodium arsenite decreases expression ISO PRKCA (Homo sapiens) 6480464 sodium arsenite results in decreased expression of PRKCA mRNA CTD PMID:16507463 Prkca Rat sodium arsenite decreases expression ISO Prkca (Mus musculus) 6480464 sodium arsenite results in decreased expression of PRKCA mRNA CTD PMID:33933676 Prkca Rat sodium arsenite multiple interactions ISO PRKCA (Homo sapiens) 6480464 sodium arsenite promotes the reaction [PRKCA protein binds to CAPRIN1 protein] CTD PMID:33939924 Prkca Rat sodium arsenite multiple interactions EXP 6480464 sodium arsenite promotes the reaction [AGO2 protein binds to PRKCA protein] CTD PMID:30404558 Prkca Rat sodium arsenite increases expression ISO PRKCA (Homo sapiens) 6480464 sodium arsenite results in increased expression of PRKCA mRNA CTD PMID:12016162 Prkca Rat sodium chloride increases expression ISO PRKCA (Homo sapiens) 6480464 Sodium Chloride results in increased expression of PRKCA mRNA CTD PMID:23634900 Prkca Rat sorafenib decreases expression ISO PRKCA (Homo sapiens) 6480464 sorafenib results in decreased expression of PRKCA mRNA CTD PMID:26409325 Prkca Rat staurosporine multiple interactions ISO PRKCA (Homo sapiens) 6480464 Staurosporine affects the localization of and affects the activity of PRKCA protein CTD PMID:16225760 Prkca Rat staurosporine multiple interactions EXP 6480464 [linsidomine co-treated with Staurosporine] results in decreased expression of PRKCA protein more ... CTD PMID:11994256 and PMID:14678745 Prkca Rat streptozocin multiple interactions EXP 6480464 Ethanol inhibits the reaction [Streptozocin results in increased expression of PRKCA protein] and procyanidin B2 inhibits the reaction [Streptozocin results in increased expression of PRKCA protein] CTD PMID:12198386 and PMID:25199697 Prkca Rat streptozocin increases expression EXP 6480464 Streptozocin results in increased expression of PRKCA protein CTD PMID:12198386 and PMID:25199697 Prkca Rat SU6656 multiple interactions ISO PRKCA (Homo sapiens) 6480464 SU 6656 inhibits the reaction [lead acetate results in increased activity of PRKCA protein] CTD PMID:19133285 Prkca Rat sulforaphane increases expression ISO PRKCA (Homo sapiens) 6480464 sulforaphane results in increased expression of PRKCA mRNA CTD PMID:26833863 Prkca Rat superoxide multiple interactions ISO PRKCA (Homo sapiens) 6480464 [Ethanol results in increased localization of and results in increased activity of PRKCA protein] promotes the reaction [Tetradecanoylphorbol Acetate results in increased abundance of Superoxides] CTD PMID:10651808 Prkca Rat tamoxifen affects expression ISO Prkca (Mus musculus) 6480464 Tamoxifen affects the expression of PRKCA mRNA CTD PMID:17555576 Prkca Rat tamoxifen decreases phosphorylation ISO Prkca (Mus musculus) 6480464 Tamoxifen results in decreased phosphorylation of PRKCA protein CTD PMID:19393235 Prkca Rat taurine decreases expression EXP 6480464 Taurine results in decreased expression of PRKCA protein CTD PMID:18822960 Prkca Rat temozolomide decreases expression ISO PRKCA (Homo sapiens) 6480464 Temozolomide results in decreased expression of PRKCA mRNA CTD PMID:31758290 Prkca Rat tert-butyl hydroperoxide decreases expression ISO PRKCA (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of PRKCA mRNA CTD PMID:15336504 Prkca Rat tert-butyl hydroperoxide increases activity EXP 6480464 tert-Butylhydroperoxide results in increased activity of PRKCA protein CTD PMID:16716901 Prkca Rat tert-butyl hydroperoxide affects localization EXP 6480464 tert-Butylhydroperoxide affects the localization of PRKCA protein CTD PMID:16716901 Prkca Rat testosterone multiple interactions ISO Prkca (Mus musculus) 6480464 Testosterone inhibits the reaction [C3 protein results in increased phosphorylation of PRKCA protein] CTD PMID:18615583 Prkca Rat testosterone decreases phosphorylation ISO Prkca (Mus musculus) 6480464 Testosterone results in decreased phosphorylation of PRKCA protein CTD PMID:18615583 Prkca Rat testosterone enanthate decreases expression EXP 6480464 testosterone enanthate results in decreased expression of PRKCA mRNA CTD PMID:25603467 Prkca Rat testosterone undecanoate increases expression ISO PRKCA (Homo sapiens) 6480464 testosterone undecanoate results in increased expression of PRKCA mRNA CTD PMID:19074003 Prkca Rat tetrachloroethene increases expression ISO Prkca (Mus musculus) 6480464 Tetrachloroethylene results in increased expression of PRKCA mRNA CTD PMID:28973375 Prkca Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of PRKCA mRNA CTD PMID:31150632 Prkca Rat tetrahydropalmatine decreases expression ISO PRKCA (Homo sapiens) 6480464 tetrahydropalmatine results in decreased expression of PRKCA protein CTD PMID:20109541 Prkca Rat thapsigargin increases expression ISO Prkca (Mus musculus) 6480464 Thapsigargin results in increased expression of PRKCA protein CTD PMID:24648495 Prkca Rat thapsigargin decreases expression EXP 6480464 Thapsigargin results in decreased expression of PRKCA protein CTD PMID:35544339 Prkca Rat thapsigargin decreases expression ISO PRKCA (Homo sapiens) 6480464 Thapsigargin results in decreased expression of PRKCA mRNA CTD PMID:22378314 Prkca Rat theophylline decreases expression ISO PRKCA (Homo sapiens) 6480464 Theophylline results in decreased expression of PRKCA mRNA CTD PMID:16083514 Prkca Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of PRKCA mRNA CTD PMID:23411599 Prkca Rat thiram decreases activity ISO PRKCA (Homo sapiens) 6480464 Thiram results in decreased activity of PRKCA protein CTD PMID:15998240 Prkca Rat thiram increases expression ISO PRKCA (Homo sapiens) 6480464 Thiram results in increased expression of PRKCA mRNA CTD PMID:38568856 Prkca Rat titanium dioxide multiple interactions ISO Prkca (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of PRKCA mRNA CTD PMID:29950665 Prkca Rat titanium dioxide decreases methylation ISO Prkca (Mus musculus) 6480464 titanium dioxide results in decreased methylation of PRKCA gene CTD PMID:35295148 Prkca Rat tributylstannane decreases expression ISO PRKCA (Homo sapiens) 6480464 tributyltin results in decreased expression of PRKCA mRNA CTD PMID:27678064 Prkca Rat trichostatin A increases expression ISO PRKCA (Homo sapiens) 6480464 trichostatin A results in increased expression of PRKCA mRNA CTD PMID:24935251 and PMID:26272509 Prkca Rat trichostatin A multiple interactions ISO PRKCA (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PRKCA mRNA CTD PMID:27188386 Prkca Rat trimellitic anhydride increases expression ISO Prkca (Mus musculus) 6480464 trimellitic anhydride results in increased expression of PRKCA mRNA CTD PMID:19042947 Prkca Rat trimethylarsine oxide increases expression EXP 6480464 trimethylarsine oxide results in increased expression of PRKCA mRNA CTD PMID:17481689 Prkca Rat triphenyl phosphate affects expression ISO PRKCA (Homo sapiens) 6480464 triphenyl phosphate affects the expression of PRKCA mRNA CTD PMID:37042841 Prkca Rat Triptolide increases expression EXP 6480464 triptolide results in increased expression of PRKCA protein CTD PMID:32519852 Prkca Rat tunicamycin increases expression ISO Prkca (Mus musculus) 6480464 Tunicamycin results in increased expression of PRKCA mRNA CTD PMID:17127020 Prkca Rat tyrphostin AG 1478 multiple interactions ISO Prkca (Mus musculus) 6480464 RTKI cpd inhibits the reaction [evodiamine results in increased phosphorylation of PRKCA protein] CTD PMID:19854188 Prkca Rat U-73122 multiple interactions ISO Prkca (Mus musculus) 6480464 1-(6-((3-methoxyestra-1 more ... CTD PMID:16581232 Prkca Rat U-73122 multiple interactions ISO PRKCA (Homo sapiens) 6480464 1-(6-((3-methoxyestra-1 more ... CTD PMID:19281832 and PMID:33421459 Prkca Rat urethane multiple interactions ISO Prkca (Mus musculus) 6480464 IFNG protein inhibits the reaction [Urethane results in decreased expression of PRKCA mRNA] CTD PMID:11091364 Prkca Rat urethane increases expression ISO PRKCA (Homo sapiens) 6480464 Urethane results in increased expression of PRKCA mRNA CTD PMID:28818685 Prkca Rat urethane decreases expression ISO Prkca (Mus musculus) 6480464 Urethane results in decreased expression of PRKCA mRNA CTD PMID:11091364 Prkca Rat valproic acid affects expression ISO Prkca (Mus musculus) 6480464 Valproic Acid affects the expression of PRKCA mRNA CTD PMID:17963808 Prkca Rat valproic acid increases expression ISO PRKCA (Homo sapiens) 6480464 Valproic Acid results in increased expression of PRKCA mRNA CTD PMID:19101580 more ... Prkca Rat valproic acid multiple interactions ISO PRKCA (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PRKCA mRNA CTD PMID:27188386 Prkca Rat valproic acid decreases expression ISO PRKCA (Homo sapiens) 6480464 Valproic Acid results in decreased expression of PRKCA mRNA CTD PMID:25192806 Prkca Rat valproic acid affects expression ISO PRKCA (Homo sapiens) 6480464 Valproic Acid affects the expression of PRKCA mRNA CTD PMID:25979313 Prkca Rat valproic acid increases methylation ISO PRKCA (Homo sapiens) 6480464 Valproic Acid results in increased methylation of PRKCA gene CTD PMID:29154799 and PMID:29501571 Prkca Rat valproic acid decreases expression ISO Prkca (Mus musculus) 6480464 Valproic Acid results in decreased expression of PRKCA protein CTD PMID:15249158 Prkca Rat vanadium atom multiple interactions ISO Prkca (Mus musculus) 6480464 PRKCA protein affects the reaction [Vanadium results in increased phosphorylation of and results in increased activity of AKT1 protein] and PRKCA protein affects the reaction [Vanadium results in increased phosphorylation of and results in increased activity of RPS6KB1 protein] CTD PMID:14971662 Prkca Rat vanadium(0) multiple interactions ISO Prkca (Mus musculus) 6480464 PRKCA protein affects the reaction [Vanadium results in increased phosphorylation of and results in increased activity of AKT1 protein] and PRKCA protein affects the reaction [Vanadium results in increased phosphorylation of and results in increased activity of RPS6KB1 protein] CTD PMID:14971662 Prkca Rat vitamin D multiple interactions ISO Prkca (Mus musculus) 6480464 Vitamin D inhibits the reaction [Dust results in increased activity of PRKCA protein] CTD PMID:23281135 Prkca Rat vorinostat multiple interactions ISO PRKCA (Homo sapiens) 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PRKCA mRNA CTD PMID:27188386 Prkca Rat vorinostat increases expression ISO PRKCA (Homo sapiens) 6480464 vorinostat results in increased expression of PRKCA mRNA CTD PMID:26272509 Prkca Rat zinc atom multiple interactions ISO PRKCA (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of PRKCA mRNA CTD PMID:18593933 Prkca Rat zinc atom multiple interactions ISO Prkca (Mus musculus) 6480464 calphostin C inhibits the reaction [Zinc promotes the reaction [OPRM1 protein binds to PRKCA protein]] and Zinc promotes the reaction [OPRM1 protein binds to PRKCA protein] CTD PMID:18652891 Prkca Rat zinc dichloride multiple interactions EXP 6480464 1 more ... CTD PMID:20800666 and PMID:21575692 Prkca Rat zinc dichloride affects localization EXP 6480464 zinc chloride affects the localization of PRKCA protein CTD PMID:21575692 Prkca Rat zinc(0) multiple interactions ISO PRKCA (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of PRKCA mRNA CTD PMID:18593933 Prkca Rat zinc(0) multiple interactions ISO Prkca (Mus musculus) 6480464 calphostin C inhibits the reaction [Zinc promotes the reaction [OPRM1 protein binds to PRKCA protein]] and Zinc promotes the reaction [OPRM1 protein binds to PRKCA protein] CTD PMID:18652891
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(1->4)-beta-D-glucan (ISO) (5Z,8Z,11Z,13E)-15-HETE (ISO) (9R)-9-[(dimethylamino)methyl]-6,7,10,11-tetrahydro-9H,18H-5,21:12,17-dimethenodibenzo[e,k]pyrrolo[3,4-h][1,4,13]oxadiazacyclohexadecine-18,20-dione (ISO) (S)-naringenin (ISO) (S)-nicotine (EXP,ISO) 1,2-dimethylhydrazine (ISO) 1-(5-isoquinolinesulfonyl)-2-methylpiperazine (EXP) 1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile (EXP) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP,ISO) 17beta-estradiol 17-glucosiduronic acid (EXP) 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (EXP) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,6-di-tert-butyl-4-methylphenol (ISO) 2-methylcholine (ISO) 3,3',4,4'-tetrachlorobiphenyl (EXP) 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione (ISO) 3alpha-hydroxy-5beta-pregnan-20-one (ISO) 3H-1,2-dithiole-3-thione (EXP) 4,4'-sulfonyldiphenol (ISO) 4-amino-2,6-dinitrotoluene (EXP) 4-hydroxyphenyl retinamide (ISO) 5-(2-methylpiperazine-1-sulfonyl)isoquinoline (EXP) 6-propyl-2-thiouracil (EXP) 7,12-dimethyltetraphene (EXP) 8-Br-cAMP (ISO) acrylamide (EXP) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) aldehydo-D-glucose (EXP,ISO) all-trans-retinoic acid (EXP,ISO) ammonium chloride (EXP) amphetamine (EXP) antirheumatic drug (ISO) aristolochic acid A (ISO) Aroclor 1254 (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (EXP,ISO) atorvastatin calcium (EXP) ATP (ISO) atrazine (ISO) Azoxymethane (EXP,ISO) baicalein (ISO) beauvericin (ISO) benzene (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) benzo[e]pyrene (ISO) berberine (EXP) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisoprolol (EXP) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) brimonidine tartrate (EXP) bryostatin 1 (ISO) butan-1-ol (EXP) cadmium atom (EXP) cadmium dichloride (EXP,ISO) calcium atom (EXP) calcium(0) (EXP) Calphostin C (EXP,ISO) cannabidiol (ISO) cannabigerol (ISO) capsaicin (EXP,ISO) carbamazepine (ISO) carbon nanotube (ISO) carvedilol (EXP) celecoxib (ISO) CGP 52608 (ISO) chelerythrine (EXP) chlorpyrifos (EXP) chromium(6+) (ISO) cisplatin (ISO) citalopram (EXP) clobetasol (ISO) cobalt dichloride (EXP,ISO) cocaine (EXP,ISO) copper atom (EXP,ISO) copper(0) (EXP,ISO) corticosterone (ISO) coumarin (ISO) crocidolite asbestos (ISO) Cuprizon (EXP) curcumin (ISO) D-gluconic acid (EXP) D-glucose (EXP,ISO) daidzein (EXP) dapagliflozin (EXP) deoxycholic acid (EXP) deoxynivalenol (ISO) dexamethasone (ISO) dextran sulfate (ISO) diarsenic trioxide (EXP,ISO) dibutyl phthalate (ISO) dichloroacetic acid (ISO) diclofenac (ISO) dicrotophos (ISO) dieldrin (ISO) diethylstilbestrol (ISO) dihydroartemisinin (ISO) dimethylarsinic acid (EXP) dimethylarsinous acid (ISO) disodium selenite (EXP) dizocilpine maleate (ISO) dorsomorphin (ISO) doxorubicin (ISO) emodin (EXP) enalapril (EXP) enniatin (ISO) entinostat (ISO) escitalopram (EXP) ethanol (EXP,ISO) ethylene glycol bis(2-aminoethyl)tetraacetic acid (ISO) Evodiamine (ISO) fluticasone (ISO) folic acid (ISO) folpet (ISO) fructose (EXP) gallic acid (ISO) genistein (EXP,ISO) glucose (EXP,ISO) glyphosate (EXP) Goe 6976 (EXP,ISO) heptachlor (EXP) hydrogen cyanide (ISO) hydrogen peroxide (EXP,ISO) imidaprilat (ISO) irinotecan (ISO) isophthalic acid (ISO) isoprenaline (EXP) ivermectin (ISO) lead diacetate (EXP,ISO) lead(0) (EXP) leflunomide (ISO) leptomycin B (ISO) linsidomine (EXP) lipopolysaccharide (ISO) lithium atom (ISO) lithium hydride (ISO) lovastatin (ISO) luteolin (ISO) manganese atom (EXP) manganese(0) (EXP) manganese(II) chloride (EXP) mercury atom (EXP) mercury(0) (EXP) metformin (ISO) methamphetamine (ISO) methapyrilene (ISO) methotrexate (ISO) methoxychlor (EXP) methylarsonic acid (EXP) methylseleninic acid (ISO) methyltestosterone (ISO) Mezerein (ISO) mianserin (ISO) microcystin-LR (EXP) mifepristone (ISO) miltefosine (ISO) mono(2-ethylhexyl) phthalate (ISO) morphine (ISO) mycophenolic acid (ISO) N,N-diethyl-m-toluamide (EXP) N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide (ISO) N-formyl-L-methionyl-L-leucyl-L-phenylalanine (EXP) N-methyl-4-phenylpyridinium (ISO) N-nitrosodiethylamine (EXP,ISO) nickel atom (ISO) nickel dichloride (ISO) nicotine (EXP,ISO) nimodipine (EXP) nitric oxide (EXP) o-cresol (EXP) obeticholic acid (ISO) ochratoxin A (EXP) p-cresol (EXP) panobinostat (ISO) paracetamol (EXP,ISO) paricalcitol (EXP) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) permethrin (EXP) phenethyl isothiocyanate (ISO) phenobarbital (ISO) phenylephrine (EXP,ISO) phenylmercury acetate (ISO) phorbol 12,13-dibutanoate (EXP,ISO) phorbol 13-acetate 12-myristate (EXP,ISO) pioglitazone (ISO) piperine (ISO) pirinixic acid (EXP,ISO) procyanidin B2 (EXP) progesterone (ISO) propane-1,2-diol (EXP) propranolol (EXP) puerarin (EXP) quercetin (ISO) reactive oxygen species (EXP) resveratrol (ISO) riddelliine (EXP) ritonavir (ISO) Ro 31-8220 (EXP,ISO) rotenone (EXP) S-butyl-DL-homocysteine (S,R)-sulfoximine (EXP) S-nitroso-N-acetyl-D-penicillamine (ISO) SB 431542 (ISO) silicon dioxide (ISO) sirolimus (ISO) sodium arsenite (EXP,ISO) sodium chloride (ISO) sorafenib (ISO) staurosporine (EXP,ISO) streptozocin (EXP) SU6656 (ISO) sulforaphane (ISO) superoxide (ISO) tamoxifen (ISO) taurine (EXP) temozolomide (ISO) tert-butyl hydroperoxide (EXP,ISO) testosterone (ISO) testosterone enanthate (EXP) testosterone undecanoate (ISO) tetrachloroethene (ISO) tetrachloromethane (EXP) tetrahydropalmatine (ISO) thapsigargin (EXP,ISO) theophylline (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) tributylstannane (ISO) trichostatin A (ISO) trimellitic anhydride (ISO) trimethylarsine oxide (EXP) triphenyl phosphate (ISO) Triptolide (EXP) tunicamycin (ISO) tyrphostin AG 1478 (ISO) U-73122 (ISO) urethane (ISO) valproic acid (ISO) vanadium atom (ISO) vanadium(0) (ISO) vitamin D (ISO) vorinostat (ISO) zinc atom (ISO) zinc dichloride (EXP) zinc(0) (ISO)
Biological Process
angiogenesis (IEA) apoptotic process (IEA) cell adhesion (IEA) cell population proliferation (ISO) cellular response to carbohydrate stimulus (ISO) central nervous system neuron axonogenesis (IMP) chondrocyte differentiation (ISO) chromatin remodeling (IEA) desmosome assembly (IEA,ISO) establishment of protein localization (TAS) induction of positive chemotaxis (ISO) intracellular calcium ion homeostasis (ISO) intracellular signal transduction (IBA,IDA) intrinsic apoptotic signaling pathway (ISO) learning or memory (IMP) muscle cell cellular homeostasis (ISO) negative regulation of cell population proliferation (ISO) negative regulation of cytokine production involved in inflammatory response (ISO) negative regulation of D-glucose import (ISO) negative regulation of glial cell apoptotic process (IEA,ISO,ISS) negative regulation of insulin receptor signaling pathway (ISO) negative regulation of MAPK cascade (ISO) negative regulation of protein kinase activity (ISO) negative regulation of protein phosphorylation (ISO) negative regulation of translation (IMP) neutrophil chemotaxis (ISO) peptidyl-serine autophosphorylation (ISO) peptidyl-threonine phosphorylation (IMP) positive regulation of angiogenesis (IEA,ISO,ISS) positive regulation of angiotensin-activated signaling pathway (IEA,ISO) positive regulation of blood vessel endothelial cell migration (IEA,ISO) positive regulation of bone resorption (ISO) positive regulation of cardiac muscle hypertrophy (IDA) positive regulation of cell adhesion (IEA,ISO,ISS) positive regulation of cell migration (IEA,ISO,ISS) positive regulation of cytokine production involved in inflammatory response (ISO) positive regulation of dense core granule biogenesis (ISO,ISS) positive regulation of endothelial cell migration (IEA,ISO,ISS) positive regulation of endothelial cell proliferation (IEA,ISO,ISS) positive regulation of ERK1 and ERK2 cascade (IMP) positive regulation of exocytosis (IMP) positive regulation of inflammatory response (ISO) positive regulation of lipopolysaccharide-mediated signaling pathway (IEA,ISO,ISS) positive regulation of macrophage differentiation (ISO,ISS) positive regulation of mitotic cell cycle (IEA,ISO,ISS) positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction (ISO) positive regulation of protein phosphorylation (ISO) positive regulation of smooth muscle cell proliferation (IMP) positive regulation of synapse assembly (IMP) presynaptic modulation of chemical synaptic transmission (ISO) protein autophosphorylation (IDA) protein kinase C signaling (IEA,ISO) protein phosphorylation (IDA,ISO) regulation of cell communication (IEA) regulation of muscle contraction (ISO) regulation of peptidyl-tyrosine phosphorylation (ISO) regulation of platelet aggregation (IEA,ISO,ISS) regulation of signaling (IEA) regulation of synaptic vesicle exocytosis (ISO) regulation of the force of heart contraction (ISO) response to corticosterone (IEP) response to estradiol (IMP) response to ethanol (IMP) response to interleukin-1 (IEA,ISO) response to mechanical stimulus (IEP) response to peptide hormone (IEP) response to phorbol 13-acetate 12-myristate (IDA,IEP) response to reactive oxygen species (IMP) response to toxic substance (IEP) stem cell differentiation (ISO)
Cellular Component
alphav-beta3 integrin-PKCalpha complex (ISO) apical part of cell (ISO) axon (ISO) calyx of Held (ISO) ciliary basal body (IEA,ISO) cone photoreceptor outer segment (ISO) cytoplasm (IEA,ISO,ISS) cytosol (IDA,IEA,ISO) dendrite (ISO) endoplasmic reticulum (IEA,ISO) intercalated disc (ISO) membrane (IEA,ISO) mitochondrial membrane (IEA) mitochondrion (IEA,ISO) neuronal cell body (ISO) nucleus (IEA,ISO) ooplasm (ISO) perinuclear region of cytoplasm (IDA) plasma membrane (IEA,ISO,ISS) presynaptic cytosol (ISO) protein-containing complex (IDA,ISO)
Molecular Function
ATP binding (IEA) calcium,diacylglycerol-dependent serine/threonine kinase activity (IDA,IEA,ISO) diacylglycerol-dependent serine/threonine kinase activity (IEA,ISO) enzyme binding (IEA,ISO) histone H3T6 kinase activity (IEA,ISO) integrin binding (ISO) kinase activity (IEA) lipid binding (ISO) metal ion binding (IEA) nucleotide binding (IEA) protein binding (IPI,ISO) protein kinase activity (IEA,ISO) protein serine kinase activity (IEA) protein serine/threonine kinase activity (IBA,IEA,ISO) signaling receptor binding (IPI) transferase activity (IEA) zinc ion binding (IEA)
1.
Protein kinase C alpha expression in normal breast, ductal carcinoma in situ and invasive ductal carcinoma.
Ainsworth PD, etal., Eur J Cancer. 2004 Oct;40(15):2269-73.
2.
Protein kinase C translocation and PKC-dependent protein phosphorylation during myocardial ischemia.
Albert CJ and Ford DA, Am J Physiol. 1999 Feb;276(2 Pt 2):H642-50.
3.
Invasive human pituitary tumors express a point-mutated alpha-protein kinase-C.
Alvaro V, etal., J Clin Endocrinol Metab. 1993 Nov;77(5):1125-9.
4.
Subtype activation and interaction of protein kinase C and mitogen-activated protein kinase controlling receptor expression in cerebral arteries and microvessels after subarachnoid hemorrhage.
Ansar S and Edvinsson L, Stroke. 2008 Jan;39(1):185-90. Epub 2007 Nov 21.
5.
Protein kinase C isoform expression as a predictor of disease outcome on endocrine therapy in breast cancer.
Assender JW, etal., J Clin Pathol. 2007 Nov;60(11):1216-21.
6.
Age-associated changes in the expression pattern of cyclooxygenase-2 and related apoptotic markers in the cancer susceptible region of rat prostate.
Badawi AF, etal., Carcinogenesis. 2004 Sep;25(9):1681-8. Epub 2004 Apr 29.
7.
Alterations in protein kinase C isoenzyme expression and autophosphorylation during the progression of pressure overload-induced left ventricular hypertrophy.
Bayer AL, etal., Mol Cell Biochem. 2003 Jan;242(1-2):145-52.
8.
Augmented protein kinase C-alpha-induced myofilament protein phosphorylation contributes to myofilament dysfunction in experimental congestive heart failure.
Belin RJ, etal., Circ Res. 2007 Jul 20;101(2):195-204. Epub 2007 Jun 7.
9.
Sevoflurane-induced cardioprotection depends on PKC-alpha activation via production of reactive oxygen species.
Bouwman RA, etal., Br J Anaesth. 2007 Nov;99(5):639-45. Epub 2007 Sep 27.
10.
Increased protein kinase C activity and expression of Ca2+-sensitive isoforms in the failing human heart.
Bowling N, etal., Circulation. 1999 Jan 26;99(3):384-91.
11.
Regulation of protein kinase C isozymes in volume overload cardiac hypertrophy.
Braun MU, etal., Mol Cell Biochem. 2004 Jul;262(1-2):135-43.
12.
PKC alpha regulates the hypertrophic growth of cardiomyocytes through extracellular signal-regulated kinase1/2 (ERK1/2).
Braz JC, etal., J Cell Biol. 2002 Mar 4;156(5):905-19. Epub 2002 Feb 25.
13.
Altered PKC expression and phosphorylation in response to the nature, direction, and magnitude of mechanical stretch.
Bullard TA, etal., Can J Physiol Pharmacol. 2007 Feb;85(2):243-50.
14.
Microtubule affinity-regulating kinase 2 functions downstream of the PAR-3/PAR-6/atypical PKC complex in regulating hippocampal neuronal polarity.
Chen YM, etal., Proc Natl Acad Sci U S A. 2006 May 30;103(22):8534-9. doi: 10.1073/pnas.0509955103. Epub 2006 May 22.
15.
Skin immunosenescence: decreased receptor for activated C kinase-1 expression correlates with defective tumour necrosis factor-alpha production in epidermal cells.
Corsini E, etal., Br J Dermatol. 2009 Jan;160(1):16-25. Epub 2008 Oct 11.
16.
Alcohol-induced protein kinase Calpha phosphorylation of Munc18c in carbachol-stimulated acini causes basolateral exocytosis.
Cosen-Binker LI, etal., Gastroenterology. 2007 Apr;132(4):1527-45. Epub 2007 Jan 26.
17.
Ca(2+)-dependent protein kinase C isoforms are critical to estradiol 17beta-D-glucuronide-induced cholestasis in the rat.
Crocenzi FA, etal., Hepatology. 2008 Dec;48(6):1885-95.
18.
Quantitative trait loci disposing for both experimental arthritis and encephalomyelitis in the DA rat; impact on severity of myelin oligodendrocyte glycoprotein-induced experimental autoimmune encephalomyelitis and antibody isotype pattern.
Dahlman I, etal., Eur J Immunol 1998 Jul;28(7):2188-96
19.
PICK1 interacts with and regulates PKC phosphorylation of mGLUR7.
Dev KK, etal., J Neurosci. 2000 Oct 1;20(19):7252-7.
20.
Modulation of synaptic plasticity by antimanic agents: the role of AMPA glutamate receptor subunit 1 synaptic expression.
Du J, etal., J Neurosci. 2004 Jul 21;24(29):6578-89.
21.
Adenovirus-delivered short hairpin RNA targeting PKCalpha improves contractile function in reconstituted heart tissue.
El-Armouche A, etal., J Mol Cell Cardiol. 2007 Sep;43(3):371-6. Epub 2007 Jun 7.
22.
Protein kinase C alpha expression is inversely related to ER status in endometrial carcinoma: possible role in AP-1-mediated proliferation of ER-negative endometrial cancer.
Fournier DB, etal., Gynecol Oncol. 2001 Jun;81(3):366-72.
23.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
24.
Antitumor activity of a PKC-alpha antisense oligonucleotide in combination with standard chemotherapeutic agents against various human tumors transplanted into nude mice.
Geiger T, etal., Anticancer Drug Des. 1998 Jan;13(1):35-45.
25.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
26.
Evidence that protein kinase Calpha interacts with and regulates the glial glutamate transporter GLT-1.
Gonzalez MI, etal., J Neurochem. 2005 Sep;94(5):1180-8. Epub 2005 Jul 25.
27.
Regulation of LPA receptor function by estrogens.
Gonzalez-Arenas A, etal., Biochim Biophys Acta. 2008 Feb;1783(2):253-62. Epub 2007 Dec 5.
28.
A recurrent kinase domain mutation in PRKCA defines chordoid glioma of the third ventricle.
Goode B, etal., Nat Commun. 2018 Feb 23;9(1):810. doi: 10.1038/s41467-018-02826-8.
29.
Protein kinase C alpha signaling inhibits cyclin D1 translation in intestinal epithelial cells.
Hizli AA, etal., J Biol Chem. 2006 May 26;281(21):14596-603. Epub 2006 Mar 23.
30.
Vascular endothelial growth factor receptor-2: structure, function, intracellular signalling and therapeutic inhibition.
Holmes K, etal., Cell Signal. 2007 Oct;19(10):2003-12. Epub 2007 Jun 12.
31.
A structural basis for enhancement of long-term associative memory in single dendritic spines regulated by PKC.
Hongpaisan J and Alkon DL, Proc Natl Acad Sci U S A. 2007 Dec 4;104(49):19571-6. Epub 2007 Dec 4.
32.
Effect of cigarette smoke extract on proliferation of rat pulmonary artery smooth muscle cells and the relevant roles of protein kinase C.
Hu J, etal., Chin Med J (Engl). 2007 Sep 5;120(17):1523-8.
33.
Mechanisms of regulation of phospholipase D1 by protein kinase Calpha.
Hu T and Exton JH, J Biol Chem 2003 Jan 24;278(4):2348-55.
34.
Protein kinase C isozymes in hypertension and hypertrophy: insight from SHHF rat hearts.
Johnsen DD, etal., Mol Cell Biochem. 2005 Feb;270(1-2):63-9.
35.
Effect of phorbol ester and platelet-derived growth factor on protein kinase C in rat hepatic stellate cells.
Kobayashi Y, etal., Liver Int. 2007 Oct;27(8):1066-75.
36.
Role of protein kinase C-alpha in superficial bladder carcinoma recurrence.
Kong C, etal., Urology. 2005 Jun;65(6):1228-32.
37.
Molecular evolution of the metazoan protein kinase C multigene family.
Kruse M, etal., J Mol Evol 1996 Oct;43(4):374-83.
38.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
39.
Direct binding of syndecan-4 cytoplasmic domain to the catalytic domain of protein kinase C alpha (PKC alpha) increases focal adhesion localization of PKC alpha.
Lim ST, etal., J Biol Chem. 2003 Apr 18;278(16):13795-802. Epub 2003 Feb 5.
40.
Interaction of estrogen receptor alpha with protein kinase C alpha and c-Src in osteoblasts during differentiation.
Longo M, etal., Bone. 2004 Jan;34(1):100-11.
41.
Selective changes in protein kinase C isoforms and phosphorylation of endogenous substrate proteins in rat cerebral cortex during pre- and postnatal ethanol exposure.
Mahadev K and Vemuri MC, Arch Biochem Biophys. 1998 Aug 15;356(2):249-57.
42.
The ATP-dependent membrane localization of protein kinase Calpha is regulated by Ca2+ influx and phosphatidylinositol 4,5-bisphosphate in differentiated PC12 cells.
Marin-Vicente C, etal., Mol Biol Cell. 2005 Jun;16(6):2848-61. Epub 2005 Apr 6.
43.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
44.
Targeting of protein kinase Calpha to caveolae.
Mineo C, etal., J Cell Biol. 1998 May 4;141(3):601-10.
45.
Role of protein kinase C in the signal pathways that link Na+/K+-ATPase to ERK1/2.
Mohammadi K, etal., J Biol Chem 2001 Nov 9;276(45):42050-6.
46.
Platelet-activating factor-induced synaptic facilitation is associated with increased calcium/calmodulin-dependent protein kinase II, protein kinase C and extracellular signal-regulated kinase activities in the rat hippocampal CA1 region.
Moriguchi S, etal., Neuroscience. 2010 Apr 14;166(4):1158-66. Epub 2010 Jan 13.
47.
Regulation of insulin receptor substrate 1 pleckstrin homology domain by protein kinase C: role of serine 24 phosphorylation.
Nawaratne R, etal., Mol Endocrinol. 2006 Aug;20(8):1838-52. Epub 2006 Mar 30.
48.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
49.
Protein kinase C: poised to signal.
Newton AC Am J Physiol Endocrinol Metab. 2010 Mar;298(3):E395-402. Epub 2009 Nov 24.
50.
Minocycline down-regulates MHC II expression in microglia and macrophages through inhibition of IRF-1 and protein kinase C (PKC)alpha/betaII.
Nikodemova M, etal., J Biol Chem. 2007 May 18;282(20):15208-16. Epub 2007 Mar 29.
51.
Nucleotide sequences of cDNAs for alpha and gamma subspecies of rat brain protein kinase C.
Ono Y, etal., Nucleic Acids Res 1988 Jun 10;16(11):5199-200.
52.
Papillary glioneuronal tumors: histological and molecular characteristics and diagnostic value of SLC44A1-PRKCA fusion.
Pages M, etal., Acta Neuropathol Commun. 2015 Dec 15;3:85. doi: 10.1186/s40478-015-0264-5.
53.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
54.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
55.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
56.
Antigen-stimulated activation of phospholipase D1b by Rac1, ARF6, and PKCalpha in RBL-2H3 cells.
Powner DJ, etal., Mol Biol Cell 2002 Apr;13(4):1252-62.
57.
Serine and threonine phosphorylation of the low density lipoprotein receptor-related protein by protein kinase Calpha regulates endocytosis and association with adaptor molecules.
Ranganathan S, etal., J Biol Chem. 2004 Sep 24;279(39):40536-44. Epub 2004 Jul 22.
58.
A genome scan localizes five non-MHC loci controlling collagen-induced arthritis in rats.
Remmers EF, etal., Nat Genet 1996 Sep;14(1):82-5
59.
GOA pipeline
RGD automated data pipeline
60.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
61.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
62.
Ectopic expression of caveolin-1 restores physiological contractile response of aged colonic smooth muscle.
Somara S, etal., Am J Physiol Gastrointest Liver Physiol. 2007 Jul;293(1):G240-9. Epub 2007 Apr 12.
63.
Identification of genomic regions controlling experimental autoimmune uveoretinitis in rats.
Sun SH, etal., Int Immunol 1999 Apr;11(4):529-34
64.
Prolactin stimulates the proliferation of normal female cholangiocytes by differential regulation of Ca2+-dependent PKC isoforms.
Taffetani S, etal., BMC Physiol. 2007 Jul 19;7:6.
65.
Molecular cloning and characterization of a novel protein kinase C-interacting protein with structural motifs related to RBCC family proteins.
Tokunaga C, etal., Biochem Biophys Res Commun 1998 Mar 17;244(2):353-9.
66.
Mitochondrial protein phosphatase 2A regulates cell death induced by simulated ischemia in kidney NRK-52E cells.
Tsao CC, etal., Cell Cycle. 2007 Aug;6(19):2377-85. Epub 2007 Jul 12.
67.
Signaling mechanisms of daidzein-induced axonal outgrowth in hippocampal neurons.
Wang P, etal., Biochem Biophys Res Commun. 2008 Feb 8;366(2):393-400. Epub 2007 Dec 4.
68.
Protein kinase C isoform expression in ovarian carcinoma correlates with indicators of poor prognosis.
Weichert W, etal., Int J Oncol. 2003 Sep;23(3):633-9.
69.
Characterization of calcium-dependent forms of protein kinase C in adult rat ventricular myocytes.
Wientzek M, etal., Mol Cell Biochem 1997 Jan;166(1-2):11-23.
70.
Regulation of insulin receptor function.
Youngren JF Cell Mol Life Sci. 2007 Apr;64(7-8):873-91.
71.
Phase I study of an antisense oligonucleotide to protein kinase C-alpha (ISIS 3521/CGP 64128A) in patients with cancer.
Yuen AR, etal., Clin Cancer Res. 1999 Nov;5(11):3357-63.
72.
Effects of blocking the renin-angiotensin system on expression and translocation of protein kinase C isoforms in the kidney of diabetic rats.
Zhang L, etal., Nephron Exp Nephrol. 2006;104(3):e103-11. Epub 2006 Jul 12.
73.
Aconitine alters connexin43 phosphorylation status and [Ca2+] oscillation patterns in cultured ventricular myocytes of neonatal rats.
Zhang SW, etal., Toxicol In Vitro. 2007 Dec;21(8):1476-85. Epub 2007 Jul 7.
74.
Role of glucocorticoids and glucocorticoid receptor in priming of macrophages caused by glucocorticoid receptor blockade.
Zhu XY, etal., Endocrine. 2007 Apr;31(2):130-7.
75.
Zhonghua wai ke za zhi [Chinese journal of surgery]
Zhu YY, etal., Zhonghua Wai Ke Za Zhi. 2005 May 15;43(10):662-6.
76.
Effects of puerarin on pulmonary vascular remodeling and protein kinase C-alpha in chronic cigarette smoke exposure smoke-exposed rats.
Zhu Z, etal., J Huazhong Univ Sci Technolog Med Sci. 2008 Feb;28(1):27-32.
Prkca (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 93,388,991 - 93,787,617 (-) NCBI GRCr8 mRatBN7.2 10 92,889,390 - 93,288,013 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 92,894,012 - 93,288,012 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 97,947,717 - 98,345,380 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 97,410,758 - 97,808,441 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 92,819,189 - 93,215,677 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 96,186,509 - 96,585,168 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 96,191,133 - 96,584,947 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 95,919,013 - 96,311,328 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 97,367,196 - 97,638,910 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 97,382,023 - 97,632,491 (-) NCBI Celera 10 91,557,626 - 91,951,823 (-) NCBI Celera RH 3.4 Map 10 1035.79 RGD Cytogenetic Map 10 q32.1 NCBI
PRKCA (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 66,302,613 - 66,810,743 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 66,302,613 - 66,810,743 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 64,298,731 - 64,806,861 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 61,729,388 - 62,237,324 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 61,729,387 - 62,237,324 NCBI Celera 17 60,870,958 - 61,379,534 (+) NCBI Celera Cytogenetic Map 17 q24.2 NCBI HuRef 17 59,689,927 - 60,196,110 (+) NCBI HuRef CHM1_1 17 64,362,982 - 64,870,449 (+) NCBI CHM1_1 T2T-CHM13v2.0 17 67,172,339 - 67,686,559 (+) NCBI T2T-CHM13v2.0
Prkca (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 107,824,213 - 108,237,360 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 107,824,213 - 108,234,754 (-) Ensembl GRCm39 Ensembl GRCm38 11 107,933,387 - 108,343,888 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 107,933,387 - 108,343,928 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 107,794,701 - 108,205,202 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 107,754,338 - 108,160,018 (-) NCBI MGSCv36 mm8 Celera 11 119,670,475 - 120,082,817 (-) NCBI Celera Cytogenetic Map 11 E1 NCBI cM Map 11 70.8 NCBI
Prkca (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955478 5,686,640 - 6,083,967 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955478 5,686,639 - 6,090,356 (+) NCBI ChiLan1.0 ChiLan1.0
PRKCA (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 82,339,665 - 82,840,386 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 87,159,077 - 87,659,700 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 60,246,485 - 60,747,158 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 65,454,911 - 65,954,610 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 65,454,907 - 65,947,903 (+) Ensembl panpan1.1 panPan2
PRKCA (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 13,638,106 - 13,879,571 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 13,644,010 - 13,967,630 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 14,532,025 - 14,927,673 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 15,300,837 - 15,695,928 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 15,305,948 - 15,696,186 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 14,247,910 - 14,642,594 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 12,891,369 - 13,286,136 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 12,891,959 - 13,287,663 (+) NCBI UU_Cfam_GSD_1.0
Prkca (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 12,615,841 - 12,962,986 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936541 6,233,110 - 6,488,052 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936541 6,231,604 - 6,488,201 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PRKCA (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 12 12,882,064 - 13,263,554 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 12 12,882,287 - 13,268,647 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 12 13,197,691 - 13,602,529 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PRKCA (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 54,638,548 - 55,144,372 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 54,642,729 - 54,948,256 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666077 25,683,064 - 26,190,115 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Prkca (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 822 Count of miRNA genes: 230 Interacting mature miRNAs: 255 Transcripts: ENSRNOT00000004699, ENSRNOT00000055073 Prediction methods: Microtar, Miranda Result types: miRGate_prediction
1549846 Scl47 Serum cholesterol level QTL 47 3.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 50574707 95574707 Rat 1354641 Bvd2 Brain ventricular dilatation QTL 2 6.36 0.001 brain ventricle morphology trait (VT:0000822) hydrocephalus severity score (CMO:0001881) 10 93223816 107057807 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 61449 Ciaa2 CIA Autoantibody QTL 2 7.1 blood autoantibody amount (VT:0003725) calculated serum anti-type 2 collagen antibody titer (CMO:0001279) 10 63221094 107211142 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1298078 Stresp5 Stress response QTL 5 2.99 0.00025 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 42045676 104670812 Rat 1549831 Bss6 Bone structure and strength QTL 6 4 lumbar vertebra strength trait (VT:0010574) vertebra ultimate force (CMO:0001678) 10 57576521 102576521 Rat 1579915 Bp280 Blood pressure QTL 280 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 90404397 107211142 Rat 70164 Bw21 Body weight QTL 21 4.36 0.00005 body mass (VT:0001259) body weight (CMO:0000012) 10 53797494 98952626 Rat 2298548 Neuinf7 Neuroinflammation QTL 7 3.4 nervous system integrity trait (VT:0010566) spinal cord RT1-B protein level (CMO:0002132) 10 72224939 107211142 Rat 1579919 Bp281 Blood pressure QTL 281 0.01 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 74372084 94965338 Rat 1302404 Cia27 Collagen induced arthritis QTL 27 2.6 0.0045 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 10 76452683 107211142 Rat 1300107 Rf18 Renal function QTL 18 3.41 urine output (VT:0003620) timed urine volume (CMO:0000260) 10 78775516 98279596 Rat 2300218 Hpcl2 Hepatic cholesterol level QTL 2 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 45029650 95600334 Rat 2317754 Glom25 Glomerulus QTL 25 3.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 82685200 107211142 Rat 70168 Eae12 Experimental allergic encephalomyelitis QTL 12 0.0009 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 10 92238497 101012337 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 70171 Cari1 Carrageenan-induced inflammation QTL 1 4.9 0.0005 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 10 53797385 107211142 Rat 10450495 Bp383 Blood pressure QTL 383 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 76246085 94965338 Rat 2313856 Bp342 Blood pressure QTL 342 4.4 0.0001 life span trait (VT:0005372) age at time of death (CMO:0001193) 10 87307617 96121100 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2292617 Ept18 Estrogen-induced pituitary tumorigenesis QTL 18 3.9 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 10 73453136 96120911 Rat 2313103 Bss80 Bone structure and strength QTL 80 2 0.0001 tibia strength trait (VT:1000284) tibia midshaft endosteal cross-sectional area (CMO:0001716) 10 62057807 107057807 Rat 2293646 Bss25 Bone structure and strength QTL 25 10.96 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 10 69738412 107211142 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 2300172 Bmd57 Bone mineral density QTL 57 9.8 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 10 69738412 107211142 Rat 70193 Mcs7 Mammary carcinoma susceptibility QTL 7 2.38 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 10 72224939 107211142 Rat 2313105 Bss79 Bone structure and strength QTL 79 1.8 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 62057807 107057807 Rat 61363 Oia3 Oil induced arthritis QTL 3 0.001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 87307617 107211142 Rat 1357344 Bp249 Blood pressure QTL 249 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 66743655 98003205 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 2306970 Anxrr22 Anxiety related response QTL 22 5.95 fear/anxiety-related behavior trait (VT:1000241) number of periods of voluntary immobility (CMO:0001045) 10 61345276 98211570 Rat 724530 Bp149 Blood pressure QTL 149 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 90627439 107211142 Rat 1300137 Bp186 Blood pressure QTL 186 3.57 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 10 90627439 107057807 Rat 1359017 Hrtrt21 Heart rate QTL 21 2.4 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 10 51772940 96772940 Rat 2293663 Bss33 Bone structure and strength QTL 33 9.34 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 10 69738412 107211142 Rat 7387312 Bw125 Body weight QTL 125 3 0.0047 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight (CMO:0000356) 10 64890616 107211142 Rat 2312672 Insul15 Insulin level QTL 15 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 10 57134272 102134272 Rat 6893357 Bw102 Body weight QTL 102 0.5 0.36 body mass (VT:0001259) body weight (CMO:0000012) 10 80515287 101325465 Rat 12880384 Cm107 Cardiac mass QTL 107 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 90404397 107211142 Rat 12880385 Cm108 Cardiac mass QTL 108 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 90404397 107211142 Rat 2317029 Aia19 Adjuvant induced arthritis QTL 19 2.98 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 66978955 107211142 Rat 2303589 Bw87 Body weight QTL 87 2 body mass (VT:0001259) body weight (CMO:0000012) 10 81285008 107211142 Rat 12880396 Am13 Aortic mass QTL 13 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 10 90404397 107211142 Rat 2306793 Ean5 Experimental allergic neuritis QTL 5 4.7 nervous system integrity trait (VT:0010566) IFNG-secreting splenocyte count (CMO:0002122) 10 72552416 93995749 Rat 12880398 Kidm67 Kidney mass QTL 67 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 10 90404397 107211142 Rat 61387 Bp1 Blood pressure QTL 1 5.1 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 51770177 107211142 Rat 2306792 Ean4 Experimental allergic neuritis QTL 4 4 nervous system integrity trait (VT:0010566) IFNG-secreting splenocyte count (CMO:0002122) 10 84022321 93995963 Rat 2317039 Aia6 Adjuvant induced arthritis QTL 6 4.31 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 66978955 107211142 Rat 12880395 Cm109 Cardiac mass QTL 109 0.001 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 10 90404397 107211142 Rat 61396 Bp9 Blood pressure QTL 9 4.8 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 68420376 107211142 Rat 634320 Niddm49 Non-insulin dependent diabetes mellitus QTL 49 4.41 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 10 88539139 107211142 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 70364 Bp72 Blood pressure QTL 72 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 51121100 96121100 Rat 10450498 Bp384 Blood pressure QTL 384 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 67750049 107211142 Rat 4889492 Pancm2 Pancreatic morphology QTL 2 3.2 pancreatic beta cell morphology trait (VT:0005217) ratio of insulin-positive cell area to total area of splenic region of pancreas (CMO:0001814) 10 76748906 107211142 Rat 6893366 Bw106 Body weight QTL 106 0.3 0.47 body mass (VT:0001259) body weight (CMO:0000012) 10 70199100 107211142 Rat 2293698 Bss43 Bone structure and strength QTL 43 5.33 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 10 59209888 104209888 Rat 631530 Tls3 T-lymphoma susceptibility QTL 3 0 0.0001 thymus integrity trait (VT:0010555) percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911) 10 51774612 95600334 Rat 1354608 Cm33 Cardiac mass QTL 33 2.8 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 10 54809292 99809292 Rat 1558643 Cm44 Cardiac mass QTL 44 4.8 0.0000368 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 61345276 99703528 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1576308 Schws1 Schwannoma susceptibility QTL 1 0.0041 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 40035094 102359817 Rat 631269 Cia22 Collagen induced arthritis QTL 22 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 631270 Cia23 Collagen induced arthritis QTL 23 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 6893336 Cm75 Cardiac mass QTL 75 0.1 0.87 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 61345276 99703528 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 12880055 Am11 Aortic mass QTL 11 0.004 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 10 84007272 95933025 Rat 2292438 Bp311 Blood pressure QTL 311 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 76246085 107211142 Rat 2312662 Slep8 Serum leptin concentration QTL 8 0.05 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 10 57134272 102134272 Rat 2301398 Kidm38 Kidney mass QTL 38 0.002 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 10 84007272 95933025 Rat 1600367 Mcs15 Mammary carcinoma susceptibility QTL 15 4.5 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 10 85565469 103884409 Rat 1358188 Ept9 Estrogen-induced pituitary tumorigenesis QTL 9 3.9 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 10 73453136 96120911 Rat 631538 Oia5 Oil induced arthritis QTL 5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 87055121 107211142 Rat 61436 Cia5 Collagen induced arthritis QTL 5 4.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 91228102 104060283 Rat 1642980 Bp300 Blood pressure QTL 300 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 68383129 107211142 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat 2312668 Scl65 Serum cholesterol level QTL 65 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 57134272 102134272 Rat
D10Rat53
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 93,184,764 - 93,184,904 (+) MAPPER mRatBN7.2 Rnor_6.0 10 96,482,302 - 96,482,441 NCBI Rnor6.0 Rnor_5.0 10 96,209,202 - 96,209,341 UniSTS Rnor5.0 Celera 10 91,849,622 - 91,849,761 UniSTS RH 3.4 Map 10 1036.2 RGD RH 3.4 Map 10 1036.2 UniSTS RH 2.0 Map 10 1145.8 RGD FHH x ACI Map 10 76.87 RGD Cytogenetic Map 10 q32.1 UniSTS
D10Rat189
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 10 93,723,381 - 93,723,576 (+) Marker Load Pipeline mRatBN7.2 10 93,223,816 - 93,224,011 (+) MAPPER mRatBN7.2 Rnor_6.0 10 96,520,816 - 96,521,010 NCBI Rnor6.0 Rnor_5.0 10 96,247,437 - 96,247,631 UniSTS Rnor5.0 Celera 10 91,888,082 - 91,888,276 UniSTS RH 2.0 Map 10 1138.3 RGD FHH x ACI Map 10 76.87 RGD Cytogenetic Map 10 q32.1 UniSTS
D10Rat139
Rat Assembly Chr Position (strand) Source JBrowse Celera 10 91,706,718 - 91,707,295 UniSTS RH 2.0 Map 10 1130.4 RGD SHRSP x BN Map 10 73.35 RGD Cytogenetic Map 10 q32.1 UniSTS
D10Chm19
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 92,997,482 - 92,997,642 (+) MAPPER mRatBN7.2 Rnor_6.0 10 96,295,049 - 96,295,208 NCBI Rnor6.0 Rnor_5.0 10 96,022,399 - 96,022,558 UniSTS Rnor5.0 RGSC_v3.4 10 97,470,298 - 97,470,457 UniSTS RGSC3.4 Celera 10 91,660,804 - 91,660,963 UniSTS Cytogenetic Map 10 q32.1 UniSTS
D10Chm12
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 10 93,481,120 - 93,481,325 (+) Marker Load Pipeline mRatBN7.2 10 92,981,530 - 92,981,737 (+) MAPPER mRatBN7.2 Rnor_6.0 10 96,279,083 - 96,279,287 NCBI Rnor6.0 Rnor_5.0 10 96,006,498 - 96,006,702 UniSTS Rnor5.0 RGSC_v3.4 10 97,454,479 - 97,454,683 UniSTS RGSC3.4 Celera 10 91,644,856 - 91,645,060 UniSTS Cytogenetic Map 10 q32.1 UniSTS
RH94851
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 10 93,394,110 - 93,394,350 (+) Marker Load Pipeline mRatBN7.2 10 92,894,507 - 92,894,747 (+) MAPPER mRatBN7.2 Rnor_6.0 10 96,191,629 - 96,191,868 NCBI Rnor6.0 Rnor_5.0 10 95,919,509 - 95,919,748 UniSTS Rnor5.0 RGSC_v3.4 10 97,367,692 - 97,367,931 UniSTS RGSC3.4 Celera 10 91,558,122 - 91,558,361 UniSTS RH 3.4 Map 10 1035.79 UniSTS Cytogenetic Map 10 q32.1 UniSTS
Prkca
Rat Assembly Chr Position (strand) Source JBrowse RGSC_v3.4 10 97,368,649 - 97,368,778 UniSTS RGSC3.4 RGSC_v3.4 10 97,368,649 - 97,368,881 UniSTS RGSC3.4 Celera 10 91,559,079 - 91,559,208 UniSTS Celera 10 91,559,079 - 91,559,311 UniSTS
RH94850
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 92,894,869 - 92,895,073 (+) MAPPER mRatBN7.2 Rnor_6.0 10 96,191,991 - 96,192,194 NCBI Rnor6.0 Rnor_5.0 10 95,919,871 - 95,920,074 UniSTS Rnor5.0 RGSC_v3.4 10 97,368,054 - 97,368,257 UniSTS RGSC3.4 Celera 10 91,558,484 - 91,558,687 UniSTS Cytogenetic Map 10 q32.1 UniSTS
RH137792
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 93,238,639 - 93,238,779 (+) MAPPER mRatBN7.2 Rnor_6.0 10 96,535,775 - 96,535,914 NCBI Rnor6.0 Rnor_5.0 10 96,261,992 - 96,262,131 UniSTS Rnor5.0 Celera 10 91,902,756 - 91,902,895 UniSTS Cytogenetic Map 10 q32.1 UniSTS
fk85g05.x1
Rat Assembly Chr Position (strand) Source JBrowse Rnor_5.0 16 57,183,630 - 57,183,785 UniSTS Rnor5.0 Rnor_5.0 10 96,021,469 - 96,022,449 UniSTS Rnor5.0 RGSC_v3.4 16 57,645,822 - 57,645,977 UniSTS RGSC3.4 RGSC_v3.4 10 97,469,368 - 97,470,348 UniSTS RGSC3.4 Celera 16 51,895,620 - 51,895,775 UniSTS Celera 10 91,659,874 - 91,660,854 UniSTS Cytogenetic Map 16 q12.1 UniSTS Cytogenetic Map 10 q32.1 UniSTS
Prkca
Rat Assembly Chr Position (strand) Source JBrowse Rnor_5.0 10 95,920,466 - 95,920,698 UniSTS Rnor5.0 RGSC_v3.4 10 97,368,649 - 97,368,881 UniSTS RGSC3.4 Celera 10 91,559,079 - 91,559,311 UniSTS Cytogenetic Map 10 q32.1 UniSTS
Prkca
Rat Assembly Chr Position (strand) Source JBrowse Rnor_5.0 10 95,920,466 - 95,920,595 UniSTS Rnor5.0 RGSC_v3.4 10 97,368,649 - 97,368,778 UniSTS RGSC3.4 Celera 10 91,559,079 - 91,559,208 UniSTS Cytogenetic Map 10 q32.1 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000004699 ⟹ ENSRNOP00000004699
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 92,894,264 - 93,287,756 (-) Ensembl Rnor_6.0 Ensembl 10 96,191,385 - 96,584,896 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000055073 ⟹ ENSRNOP00000051949
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 92,894,012 - 93,287,807 (-) Ensembl Rnor_6.0 Ensembl 10 96,191,133 - 96,584,947 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000100596 ⟹ ENSRNOP00000079110
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 92,895,139 - 93,287,807 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000112512 ⟹ ENSRNOP00000083509
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 92,894,264 - 93,135,944 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000115522 ⟹ ENSRNOP00000091320
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 92,894,264 - 93,288,012 (-) Ensembl
RefSeq Acc Id:
NM_001399299 ⟹ NP_001386228
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 93,388,991 - 93,787,327 (-) NCBI mRatBN7.2 10 92,889,390 - 93,287,767 (-) NCBI
RefSeq Acc Id:
XM_017597006 ⟹ XP_017452495
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 93,388,991 - 93,787,617 (-) NCBI mRatBN7.2 10 92,889,390 - 93,287,801 (-) NCBI Rnor_6.0 10 96,186,509 - 96,585,168 (-) NCBI
Sequence:
ACCGCCGCCCTCCGCTGTTGGCCCGGCTCACAAGGGCCCCCCACCCAGTACGCGTGTCCAGCTCGGTGCAGAGCAGCGCAGCTCAGAGGCCCTAGGCTCGCCCCGCGCGCGTCCCCGCCCCGCGCGCT CCTACTCCAGTCCGCGCGCGCGCGTGCACACATACACACGCTAGCTCTCCGGGCATGCGCAGTGGGCGGCGCCGCTCCGGGCCGCCTCTTGCTGCCGCGAGTAGGAAGCGCGAGCGCCAGGCGCCGGG CTGTCAGTGAGCGTGGGGCCAGCCAGAGAGCGAGAGAGCCGGAGAGAGCCAGAGAGAGCCAGAGAGAGCGGCTCAGCTCCCAGCTCCAAGCAGCGCAGCGCCCGCCCGGCTCTCCCCGGCCACCGCCG CCACCACCGCACCTCAGCACCGCCACCTCGGCCGCCGCCCCCGCCCACCCCGGCCCTCCCCGGCTGCTGCTCCCCGGCGGAGGCAAGAGGTGGTTGGGGGGGACCATGGCTGACGTTTACCCGGCCAA CGACTCCACGGCGTCTCAGGACGTGGCCAACCGCTTCGCCCGCAAAGGGGCGCTGAGGCAGAAGAACGTGCATGAGGTGAAAGACCACAAATTCATCGCCCGCTTCTTCAAGCAACCCACCTTCTGCA GCCACTGCACCGACTTCATCTGGGGGTTTGGAAAACAAGGCTTCCAGTGCCAAGTTTGCTGTTTTGTGGTTCACAAGAGGTGCCATGAGTTTGTTACTTTCTCTTGTCCGGGTGCGGATAAGGGACCT GACACTGATGACCCCAGAAGCAAGCACAAGTTCAAAATCCACACCTATGGAAGCCCTACCTTCTGTGATCACTGTGGGTCCCTGCTCTACGGACTTATCCACCAAGGGATGAAATGCGACACCTGCGA CATGAATGTTCACAAGCAGTGCGTGATCAATGTCCCCAGCCTCTGCGGAATGGATCACACAGAGAAGAGGGGGCGGATTTACCTGAAGGCAGAGGTCACAGATGAAAAGCTGCACGTCACCGTACGAG ATGCAAAAAATCTAATCCCTATGGATCCAAATGGGCTTTCGGATCCTTACGTGAAGCTGAAACTTATTCCTGACCCCAAGAATGAGAGCAAACAGAAAACCAAAACCATCCGATCCACACTGAACCCT CAGTGGAATGAGTCCTTCACGTTCAAATTAAAACCTTCAGACAAAGACCGGCGACTGTCCGTAGAAATCTGGGACTGGGATCGGACGACACGGAATGACTTCATGGGCTCCCTTTCCTTCGGCGTCTC AGAGCTGATGAAGATGCCAGCCAGTGGATGGTACAAGTTGCTCAACCAAGAGGAGGGTGAATACTACAATGTGCCCATTCCAGAAGGAGATGAAGAAGGCAACGTGGAACTCAGGCAGAAGTTCGAGA AAGCCAAGCTGGGCCCCGCTGGAAACAAAGTCATCAGCCCTTCAGAAGACAGGAAGCAGCCATCTAACAACCTGGACAGGGTGAAACTCACAGACTTCAACTTCCTCATGGTGCTGGGGAAGGGGAGT TTTGGAAAGGTGATGCTTGCTGACAGGAAGGGAACAGAGGAACTGTACGCCATCAAAATCCTGAAGAAGGACGTGGTGATCCAGGATGACGACGTGGAGTGCACCATGGTGGAGAAGCGGGTTCTGGC CCTGCTCGACAAGCCCCCGTTCCTGACACAGCTGCACTCCTGCTTCCAGACAGTGGACCGGCTGTACTTCGTCATGGAATACGTCAACGGTGGGGACCTCATGTACCACATTCAGCAAGTCGGAAAAT TTAAGGAGCCACAAGCAGTATTCTATGCAGCCGAGATCTCCATCGACTGTTCGTTCCTTCACAAAAGAGGAATCATTTACAGGGATCTGAAGCTGGACAACGTCATGCTGGACTCAGAAGGGCATATC AAAATCGCCGACTTCGGGATGTGCAAGGAACACATGATGGACGGGGTCACGACCAGGACCTTCTGTGGGACTCCGGATTACATTGCCCCAGAGATAATCGCTTACCAGCCATATGGAAAGTCTGTGGA CTGGTGGGCGTACGGCGTGCTCCTGTATGAGATGCTAGCTGGGCAGCCTCCGTTCGATGGCGAAGACGAAGATGAACTGTTTCAGTCTATAATGGAGCACAATGTGTCCTACCCCAAATCCTTGTCCA AGGAAGCTGTCTCCATCTGCAAAGGGCTTATGACCAAACACCCTGCCAAGCGGCTGGGCTGCGGGCCCGAGGGGGAAAGGGATGTCAGAGAGCATGCCTTCTTTAGGAGGATCGACTGGGAGAAGTTG GAGAACAGGGAGATCCAACCGCCATTCAAGCCCAAAGTGAATTTCTGTACCAAAATGCACTGGCTTCAGTGGGCATCCAGGCCTTCGTGCGGCAAAGGAGCAGAAAACTTTGACAAGTTCTTCACACG AGGGCAGCCTGTCTTAACACCACCAGATCAGCTGGTCATCGCTAACATAGACCAGTCTGATTTTGAAGGGTTCTCGTATGTCAACCCCCAGTTTGTGCACCCAATCTTGCAAAGTGCAGTATGAAACT CAGAAACAAAAGATCTAATGCCTCCCTAGCCCCCAATCTCCCCAGCAGTGGGAAGTGATTCTTAACCATAAAATTTTAAGGCTATAGCCTTGTATTTTGTTCCACACAGAGGCCTGAAAATTCTGGGG ATATTAGTCCATAAGTGATCAACTTTCTTCCCCCACCCAATCCCAAACCAAAAAACATTATCTTAGTGGATGATGACATAATATACAGAGTATAGTTTAATTATGTAGAAGTCACATCTGGCTTCAAG TTAATTCTTTCTAGGAAACAAAGAGACTTGGACCCTATTTTTTGGTACGATTTAATATATTCTCCATACCTTTCATATTTTGGATTTTCACTATCCAAATCAACCAGAGATAATAAAGTGAACCCACC TGAACTCAAGGGATGGAAACATTTCTGCCCAAGATATCTTTGGAATTAAAGAACAGGAAGCCCAAACAGAAAACAAAGAGAGGCAGAGTCTCATATATTCAAGACCTCGTTGCTTCTATTTTCTGCTT CAATGGAAACAGTCCCTAGAGTCTGAGAGGGCAGGATGAACCTGATCACTGTTCCCAATCATCATAGCACAACCATAGTGCATAGTTTGAAAATGAAAGAAAACTTCAGACAGATGTTCGTTGAATCT ATCATATGTACTCCCCTGCTCGGTTGATAACTATCTCGATAACTCATTCTTTTTAAGAGGCCAAAATCATCTAAGGACTTTGCTAAACAAACATGTGAAATCATTTCAGATCAAGGATAAACCATGTG TATGTTCATTTTAATCTCTGGGAGATGACTCTTCAATCCAGGGTGCCATCAGTAATCATGCCACTGTTCACGAGTGTTGTTAGCCAACCCCCCGCCACATAATAATATTTTGCTACCTTTGTGGGTAC CCTTCCTAGGAAGCTAAAATGTATGCCCCATCCCCTTTTGTACTATTTATTTAATAAGCCGCAGTGTCGTTTATGAAAGTACAATGTATAGTAACTTAATCAAAGTACTGACTAGCATCAGTCCCTAT AGGTTGATTTTCCTCCTTTCTCTAGCCCCACATCCACTTAGAGATGAGAAAAAAAAGAGTATATTTTGGGTTCCAATTCCCAGTTCTAATTGAATGGCACACATGGAGCTGTAGGATCAAGACACTTT ATGCTTATATCAACTCAAAGATGTTTTCTTGCTAGAAGGATTTTAATATGTTTTGCGAGTGCATCATGCAATGGATTTTGCATGTTTATAATAAACCTTAATAACAAGTTAATCTATATTATTGATAT AATTGTATCAAGTATAAAGAGTATTATGATAATTTTATAAGACACAATTGTGCTATATTTGTGATGCTCATGTTTCCAGTCTGCTTTAAGATTAAGTGTTAGCTTTATTCATTGCTGCTGGGGCCTCT ATTACCCGCTACCCCACACACTGGCACTCTATCAGATATATTAATTTTTTAATGTAGATGTAATTTTAAAATGAATGGCTACTTTACACGTTTAACTAGGCTTTTACTATATATGTGTACATATGTAT ATATATATATTTGATTCTACCTGCAAACCCCGGTTTTGTTTGTGGGGATTATTTTTGAGATGAGACTCTGTTAACTTCTTCATGTTATCCTCCGTTCAGGTTCCTCTACCATCCCTCCCCTTGGGGAC AGCTGGAAATGTTTAATTCCAGTATTCCTGATATGTTCATATATATGTGGCATTGTTACAGCACCTGGGCTGAATTCCGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGT GTCTGTGTGTCTGTCTGTCTGTTTCTGTCTGTTTCTGTCTGTTTCTGTCTGTCTGTCTGATTCTTTTCAGCCTATGTCTTTGGGGTCTCTACTGATGAAAGGGTGGGAGGATTCCTTTCTGAGTGTGC ATATGGACACAACAAAAATATGTAGTCTGTCTTTCTGCCCCAGAATAACTCACTGTATACTCCAGAAGACACAAAATCCTTGAGACAAACTTTATTCCCAGCCTGTGTAGAGCCATCTCTGAAGCTGT TATCAACAGACTCTTTTCAGAGGCACGTACTGTCTTAAAGTTGTTCCTAGAACATTCCGGTCTTTGAAGAGCATGTCTTTGGCCAAATGCCTCCCAATACAAGGTGTTTAGAAGAGGCAGGCTTCTGC AGTATAAAGGACAAGTGAAAATGGAAGTTCCCACAGTCCTTAAAGAAGGCACCTCTCCCGAAAGTATCTAACAGCTAAGCTCTCCTCTTTGTTGTTCTCCACCTATCTGCTTGACAGTCACATACCCT GCAACCCACCAAGAGTCTTTGAGATACGGAGCATAGGCCATTCTGAGAACCCCTAATCAGAAGGAGATATGGAGTGGAGAGTGGGCCAAATCAGAAAAGAGCAGTCTCTTCTGCAATAGTTCATGAAT TCTGGATGTCAGACCTCAAAAAGCAGGGGAGGGCGTCATGTATCAATCCTAGAAGTCAAGCCATCATTTTGGCAACCCAGCCTTATCACAAACACTATACTTGGTCAGCAGTAAAGGAACTGACTTAT AGATGAGACTTGGAAGTAAAAGTCTTGCTCTTCCCAGGTGGGGCAGCAACAGGAAGCAGAAACTCTCAAAGAGAGGGAAGCCACAGAGAAGGAGCACAGGGTTTGTAGACAATCCATCCTGAGGTTTC TAGCTGCCTGATTGTCTCACACCATTAGCAGGCTTGAGTTCTTCCTTAAACCGCCAGCATACAGCTCCAAGTGATTCAACTTCTCTAGAAAATATGTGTGATCCCTTGATTGGCTTGTACGCTTAGAG AATATCAACCAACATTCTCAACGGGAGGAGGGAAATAACAGAGCCACAGACCAGAATTTGCCTAAGGAACAGAACACTGGAGAACAAACTTAAGAGAAGTGACAAAAATTTAAGCAAGTGTTCACGAT GCCGCCTATGCTGTACACTTTAAAGAGCTGAGAAGCAGAGACAATTTTTGCTACAAAACTCTTGTGGATAACCATTAGCAGCTGTTAGGCAGGATCAATTGATAATATTCTACATCATTGTCCCATTT CACAGACATTGTGTGAAATGGTGCTACAGGGAAACGAATGCCATTTGAACTGAAGCACCCAGAGGCCAGAATGAGGAGGATGCCTTGAAGGGTTTAATCCCAGGATGGGGGCTGGGGGGTGGACTATT TAGAAAGCATCTGCTCTCAGACTCTGCCTGCATTGGCAGGGCCTGGGGAGGAGAACCTAGCACAATCCAAGTCTCCACAGGACCCATCTGGCTGTGACCCAGAAAATCCACTGAAATTGCTTCGTATT ATATTCCCCTGGAAGGTGGCCATTGCTCAGTGGCAGCTCTTCCCTCTTCCACCACAGGCCAGTGGGCTGCCAGCTTTACCTTCGGCGTGGCATCTAAAGTCACCTGGTGCTTGGGTTGAATGGAAAGA GCTGGAGTATGCTGCCAGGTGCAGCCCTGGGAGTTAATGGGAGGCTCACCTACAGGCAGGAGCTAATTCAGAAGGTAGATGAGCCCCAGGAGCTAAACTAATTGCCCCTCACCCTCTCACCACTGTGG CCTAGTTTGAGCTGGTAGCCTTTTCTTTAGTCCTTTTTATTAGCAATTTGAGAAACTGAGGAGGCCAAGAGTTTTCTGGAAGCTTGGTTCATGTGAAAGATTACCAGAGGCCAGTATTAACCCTCAAG CGCTGTTGCTCACAAGCTCTAGTTCTTAGCAAAACAAGGTGGCGCGCTAACCCCAAAAGAGCCGCCCATTTATGTATTACAAAGAGGAGGAAGCAGAAGTCAACACCATTAAAGAGCAGGGTTTGAGT GCACCCAGAAAGACACAGAAGGTTGGCAGAGAGGCTGTGGTATCTGCATGGGCTTTCCACTGGGGGTCATTGGTGCAAGTGTAAGTTACTGTCAGCCTTCAAATGTGTGGGTTCTTTGTCAGATACAA TCTGTTGTTCCTTCTCAGACCCTCCCAACTGTAAGAAGTTCTTTGCCCTGTACAGAGCCAGGCCATCCAGCAGACCCTGGGAGCACTAAGTTCCATCTATATCCCTCTGATAATTACAGTTGCTGAGA ATAGGTCCAGACGTCATAAAAACAACCAACAGTGACCTGCCAGCTTTTGCTTAGCAGAAAAAAAAATAGGAAGGGTTTGTGCAGAGCTTTATTTTCTCAAATACCTCTGCAAGGCAACACCACCTGAC AGTCATTTTCTCACCTTGGTCTCATGAAATCACCTACTTCTCTTGTGTACATGTCACACTGTTTCCTGTTTGTTTACAACCCCAGAAGCGCAGGGGTACCTGTCCCCACACCACGTCTGAGCACATCA AACAACCATGCTCAGGAGATACGTGCTGAGCCAGGGACCTGAAAGGATGCTAACCATGAAAGAGAGGGGACAATAGCAAGAAAGGAGATGGATCCTCTGATTAGCAATGGGTCCACACTGATATGACA GAGTGTTAGGAGACTGGTTTTAAAATTGTTTTTCCATGAACTGCTGTTAACAAACTATGCTGGACAGTCAACACCCCTGCCACATCTCATTGGGCCAGTGCAGCAAATCTAGAAAAAGCTGTTACTTT CTCCTGTCAGAGTAATCCAGAGAATCAGGGAAGGATGCTTGAGGCATGCACAGATGCAGTGTTCTAGAAACGGTGTCTACCACTGCCCCAGTGACACTACAGTAATGATTAAAAAGCGTGGATGGCTC AGCATTCTGTACCCCTCATTCATGTGGTCAGGTGTCAGTCAATAAACACAAAAGACACACCAAGTCATTAAACAGCCTTACTGTGACCCTCCCCCGGAAGCCCACAAGTTCCAAAGACTTTTTTTTAA CCTAAAACAAGTAATTATTAACTCCATTAGAAGACCTGAGTATCCTGGGCTATTTGTACTTTTTTATAGAGGACTTTAATAACAATTCTTTTCAAGTGAGTTTTTAAAATAGTAAAAATTTCATAAAA TTCCAATACCATGGAGCCTATAGGAGGTTTTCACCCAGGTTGGATAGAGTACCCATGATCTGAATCCCCACGGCAGGATTTTTCCATGCCAGTGAGGTCTGGAGTCCACATTGGATTGGCTGCCGGAC GGTATTCTCTTTCTTAGTAGATGCTAAAGATAGCTGCCTAAGGTTTAGCTCTCTTTCAACTGTAGGGATGATGGCTTTATACCCCCCATTCCTGACACAGCCCTAGGAAAGCATTCTTGGGGAGCTAG AGGAGCCCACTCTATACTGTAAGAGTCAGAGCAAGAAGGGGGTGCTTCTTCAACTCTGTCTCAAGTTGCTTCTGGCCCCTCAGTCTCTCACACTGGATAAACATTGAGAGATGCTCTGTAAGGATTAT GCCCATTGGGCAAATTAAAACCTACTCTCCCAAGAAGAGGCAGCATCAAGTATGCCGGAGGCATCAGCTTCCATTTCCATGGATGTGCGTAGACAGAACCCTACTTTTGAGAAAACACCCATCCAGCC CACTTTGTAAGAACCCCTTTTTTCTAAACTATGACAAAAGGTGGCTTTGCACTTTCTGATTAAACAACACTGTCTTTTGTCTCCTGCTTAATTTTAAGACTATTCTGTGATCAATGTTTGTAGATTTT TGTTAATATTTTGCCTGGAAAAATGTGACTCTCTCCTTGGGAGGTTTAGTAAACTATTAAAAGTTATACATGAAGGTGGTTACTATTTTGAGGCTAAAGGTTTTTCTAAGAATCAACCTCCTATCCTG ACTATGACGGTTTTTCAGAATACCTTTTATAGATGATCAGATGCGTTTGGAGTTGCGTTTCCTACATGAATTCTGTTTTGTTTTATGAAGGACACGCCGTGTTTAAATCTCTTATTGAAAAAAAAATC ATGCAAAACCCCAAATTGGTTTGGAGGAAGGAGTGAAGGTTGAAGCTGTTGCCTGAACAGGCCTTTACTGATAAGCCAGGGGCTGTTCCGCTGCTTGTTTGGTTACCTAGCAGGTGAGGTAGATATGT AAATTAGCGCCTAGCTTTTTTGGATTTGTGTAACCTCTACTCTTCGTTTGCATGATTCGCTCTGTTAGATGCATTCATTGTAGTTCGGAAGCAAGCGTGTATGAATAAAGATACTGATCACTGCTGA
hide sequence
RefSeq Acc Id:
XM_039085211 ⟹ XP_038941139
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 93,388,991 - 93,787,617 (-) NCBI mRatBN7.2 10 92,889,390 - 93,288,013 (-) NCBI
RefSeq Acc Id:
XP_017452495 ⟸ XM_017597006
- Peptide Label:
isoform X2
- Sequence:
MADVYPANDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGSLLYGLIHQ GMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVTDEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRLSVEIWDWDRTTRNDFM GSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNVELRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKGTEELYAIKILKKDVVIQDDDVECT MVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEISIDCSFLHKRGIIYRDLKLDNVMLDSEGHIKIADFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAY QPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVNFCTKMHWLQWASRPSCGKGAE NFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFVHPILQSAV
hide sequence
Ensembl Acc Id:
ENSRNOP00000051949 ⟸ ENSRNOT00000055073
Ensembl Acc Id:
ENSRNOP00000004699 ⟸ ENSRNOT00000004699
RefSeq Acc Id:
XP_038941139 ⟸ XM_039085211
- Peptide Label:
isoform X1
- UniProtKB:
F1LS98 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000091320 ⟸ ENSRNOT00000115522
Ensembl Acc Id:
ENSRNOP00000083509 ⟸ ENSRNOT00000112512
Ensembl Acc Id:
ENSRNOP00000079110 ⟸ ENSRNOT00000100596
RefSeq Acc Id:
NP_001386228 ⟸ NM_001399299
- UniProtKB:
P05696 (UniProtKB/Swiss-Prot), B5DFC4 (UniProtKB/TrEMBL), F1LS98 (UniProtKB/TrEMBL)
RGD ID: 13697861
Promoter ID: EPDNEW_R8378
Type: initiation region
Name: Prkca_1
Description: protein kinase C, alpha
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 96,584,907 - 96,584,967 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-06-10
Prkca
Protein kinase C, alpha
Symbol and Name status set to approved
70586
APPROVED
Note Type
Note
Reference
gene_expression
expressed in adult ventricular myocytes
731217
gene_pathway
activation by the digitalis drug ouabain is linked to Na+/K+-ATPase through Src/EGFR, and is required for the activation of ERK1/2
628493
gene_regulation
administration of the digitalis drug ouabain with intact cardiac myocytes causes rapid translocation/activation from the soluble to the particulate pools of enzymes
628493