Symbol:
Prkaca
Name:
protein kinase cAMP-activated catalytic subunit alpha
RGD ID:
3389
Description:
Enables cAMP-dependent protein kinase activity; protein kinase binding activity; and small GTPase binding activity. Involved in several processes, including peptidyl-serine phosphorylation; regulation of glutamatergic synaptic transmission; and spontaneous exocytosis of neurotransmitter. Located in perinuclear region of cytoplasm. Part of cAMP-dependent protein kinase complex. Is active in neuromuscular junction; postsynapse; and presynapse. Biomarker of amphetamine abuse and brain ischemia. Human ortholog(s) of this gene implicated in adrenal cortical adenoma; congestive heart failure; fibrolamellar carcinoma; and primary pigmented nodular adrenocortical disease 4. Orthologous to human PRKACA (protein kinase cAMP-activated catalytic subunit alpha); PARTICIPATES IN acebutolol pharmacodynamics pathway; adrenergic beta receptor agonist and beta-blocker pharmacodynamics pathway; amiodarone pharmacodynamics pathway; INTERACTS WITH (+)-schisandrin B; 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane; 1,2-dimethylhydrazine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
cAMP-dependent protein kinase catalytic subunit alpha; cAMP-dependent protein kinase catalytic subunit C alpha; Cs-PKA; PKA C-alpha; PKCA1; protein kinase A; protein kinase, cAMP-dependent, alpha catalytic subunit; protein kinase, cAMP-dependent, catalytic, alpha
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PRKACA (protein kinase cAMP-activated catalytic subunit alpha) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):
Prkaca (protein kinase, cAMP dependent, catalytic, alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Prkaca (protein kinase cAMP-activated catalytic subunit alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PRKACA (protein kinase cAMP-activated catalytic subunit alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PRKACA (protein kinase cAMP-activated catalytic subunit alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Prkaca (protein kinase cAMP-activated catalytic subunit alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PRKACA (protein kinase cAMP-activated catalytic subunit alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PRKACA (protein kinase cAMP-activated catalytic subunit alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Prkaca (protein kinase cAMP-activated catalytic subunit alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
PRKACG (protein kinase cAMP-activated catalytic subunit gamma) HGNC
EggNOG, Panther, Treefam
Homo sapiens (human):
PRKACB (protein kinase cAMP-activated catalytic subunit beta) HGNC
OrthoDB
Homo sapiens (human):
FLNB (filamin B) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
PRKACA (protein kinase cAMP-activated catalytic subunit alpha)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Prkaca (protein kinase, cAMP dependent, catalytic, alpha)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
prkacab (protein kinase, cAMP-dependent, catalytic, alpha, genome duplicate b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
prkacaa (protein kinase, cAMP-dependent, catalytic, alpha, genome duplicate a)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
TPK1
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
TPK2
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
TPK3
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
kin-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Pka-C1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
prkaca
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 41,059,843 - 41,083,189 (-) NCBI GRCr8 mRatBN7.2 19 24,155,081 - 24,178,430 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 24,155,090 - 24,178,430 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 30,976,206 - 30,999,561 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 31,630,613 - 31,653,968 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 33,853,335 - 33,876,684 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 25,095,089 - 25,118,869 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 25,095,089 - 25,118,860 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 36,073,104 - 36,096,884 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 25,840,795 - 25,864,786 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 19 25,845,620 - 25,861,927 (-) NCBI Celera 19 23,703,180 - 23,726,723 (-) NCBI Celera Cytogenetic Map 19 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Prkaca Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of PRKACA mRNA] CTD PMID:31150632 Prkaca Rat (1->4)-beta-D-glucan multiple interactions ISO Prkaca (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of PRKACA mRNA CTD PMID:36331819 Prkaca Rat 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane increases activity ISO PRKACA (Homo sapiens) 6480464 o and p'-DDT results in increased activity of PRKACA protein CTD PMID:19526567 Prkaca Rat 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane decreases activity EXP 6480464 o and p'-DDT results in decreased activity of PRKACA protein CTD PMID:23209616 Prkaca Rat 1,2-dimethylhydrazine increases expression EXP 6480464 1 and 2-Dimethylhydrazine results in increased expression of PRKACA mRNA CTD PMID:27840820 Prkaca Rat 14-Deoxy-11,12-didehydroandrographolide multiple interactions ISO Prkaca (Mus musculus) 6480464 14-deoxy-11 and 12-didehydroandrographolide inhibits the reaction [[1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS1 protein] results in increased phosphorylation of PRKACA protein] CTD PMID:30248417 Prkaca Rat 17alpha-ethynylestradiol increases expression ISO Prkaca (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of PRKACA mRNA CTD PMID:17942748 Prkaca Rat 17alpha-ethynylestradiol multiple interactions ISO PRKACA (Homo sapiens) 6480464 PRKACA protein affects the reaction [Ethinyl Estradiol results in decreased expression of ABCB11 mRNA] more ... CTD PMID:27743861 Prkaca Rat 17beta-estradiol increases expression ISO Prkaca (Mus musculus) 6480464 Estradiol results in increased expression of PRKACA mRNA CTD PMID:39298647 Prkaca Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression EXP 6480464 2 more ... CTD PMID:21394737 Prkaca Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Prkaca (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of PRKACA mRNA CTD PMID:15667827 and PMID:17407152 Prkaca Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PRKACA mRNA CTD PMID:33387578 Prkaca Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Prkaca (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PRKACA mRNA CTD PMID:21570461 Prkaca Rat 2-tert-butylhydroquinone increases expression ISO Prkaca (Mus musculus) 6480464 2-tert-butylhydroquinone results in increased expression of PRKACA mRNA CTD PMID:16014739 Prkaca Rat 3,4-methylenedioxymethamphetamine increases expression ISO Prkaca (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of PRKACA mRNA CTD PMID:20188158 Prkaca Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO Prkaca (Mus musculus) 6480464 14-deoxy-11 more ... CTD PMID:29288687 and PMID:30248417 Prkaca Rat 4,4'-diaminodiphenylmethane decreases expression ISO Prkaca (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of PRKACA mRNA CTD PMID:18648102 Prkaca Rat 4,4'-sulfonyldiphenol increases expression ISO Prkaca (Mus musculus) 6480464 bisphenol S results in increased expression of PRKACA mRNA CTD PMID:39298647 Prkaca Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of PRKACA mRNA CTD PMID:36041667 Prkaca Rat 4-aminopyridine increases phosphorylation EXP 6480464 4-Aminopyridine results in increased phosphorylation of PRKACA protein CTD PMID:35643327 Prkaca Rat 4-aminopyridine multiple interactions EXP 6480464 lappaconitine inhibits the reaction [4-Aminopyridine results in increased phosphorylation of PRKACA protein] CTD PMID:35643327 Prkaca Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of PRKACA mRNA CTD PMID:30047161 Prkaca Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of PRKACA mRNA CTD PMID:38685447 Prkaca Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of PRKACA mRNA CTD PMID:30047161 Prkaca Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PRKACA mRNA CTD PMID:16483693 Prkaca Rat antimycin A decreases expression ISO PRKACA (Homo sapiens) 6480464 Antimycin A results in decreased expression of PRKACA mRNA CTD PMID:33512557 Prkaca Rat aripiprazole increases expression EXP 6480464 Aripiprazole results in increased expression of PRKACA protein CTD PMID:26894264 Prkaca Rat aristolochic acid A increases expression ISO PRKACA (Homo sapiens) 6480464 aristolochic acid I results in increased expression of PRKACA mRNA CTD PMID:33212167 Prkaca Rat arsenite(3-) increases expression ISO Prkaca (Mus musculus) 6480464 arsenite results in increased expression of PRKACA mRNA CTD PMID:18191166 Prkaca Rat asbestos affects expression ISO PRKACA (Homo sapiens) 6480464 Asbestos affects the expression of PRKACA mRNA CTD PMID:17297452 Prkaca Rat atorvastatin calcium multiple interactions EXP 6480464 Atorvastatin results in increased phosphorylation of and results in increased activity of PRKACA protein and N-(2-(4-bromocinnamylamino)ethyl)-5-isoquinolinesulfonamide inhibits the reaction [Atorvastatin results in increased phosphorylation of and results in increased activity of PRKACA protein] CTD PMID:19053045 Prkaca Rat atrazine decreases expression EXP 6480464 Atrazine results in decreased expression of PRKACA mRNA and Atrazine results in decreased expression of PRKACA protein CTD PMID:30065202 Prkaca Rat BAPTA multiple interactions EXP 6480464 1 more ... CTD PMID:21863293 Prkaca Rat belinostat increases expression ISO PRKACA (Homo sapiens) 6480464 belinostat results in increased expression of PRKACA mRNA CTD PMID:26272509 Prkaca Rat belinostat multiple interactions ISO PRKACA (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PRKACA mRNA CTD PMID:27188386 Prkaca Rat benzo[a]pyrene affects methylation ISO PRKACA (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of PRKACA intron and Benzo(a)pyrene affects the methylation of PRKACA promoter CTD PMID:27901495 and PMID:30157460 Prkaca Rat Bifeprunox increases expression EXP 6480464 bifeprunox results in increased expression of PRKACA protein CTD PMID:26894264 Prkaca Rat bis(2-ethylhexyl) phthalate decreases phosphorylation ISO Prkaca (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased phosphorylation of PRKACA protein CTD PMID:32303808 Prkaca Rat bis(2-ethylhexyl) phthalate decreases expression ISO Prkaca (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of PRKACA protein CTD PMID:33234378 Prkaca Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Prkaca (Mus musculus) 6480464 Colforsin inhibits the reaction [Diethylhexyl Phthalate results in decreased expression of PRKACA protein] more ... CTD PMID:32303808 and PMID:33234378 Prkaca Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of PRKACA mRNA and [bisphenol A co-treated with Testosterone] results in increased expression of PRKACA mRNA CTD PMID:26496021 and PMID:36041667 Prkaca Rat bisphenol A affects expression ISO Prkaca (Mus musculus) 6480464 bisphenol A affects the expression of PRKACA mRNA CTD PMID:35341816 Prkaca Rat bisphenol A increases expression ISO PRKACA (Homo sapiens) 6480464 bisphenol A results in increased expression of PRKACA protein CTD PMID:34186270 Prkaca Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PRKACA mRNA CTD PMID:30816183 and PMID:32528016 Prkaca Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of PRKACA mRNA CTD PMID:25181051 Prkaca Rat bisphenol A decreases expression ISO Prkaca (Mus musculus) 6480464 bisphenol A results in decreased expression of PRKACA mRNA CTD PMID:26063408 Prkaca Rat bisphenol AF increases expression ISO PRKACA (Homo sapiens) 6480464 bisphenol AF results in increased expression of PRKACA protein CTD PMID:34186270 Prkaca Rat Bisphenol B increases expression ISO PRKACA (Homo sapiens) 6480464 bisphenol B results in increased expression of PRKACA protein CTD PMID:34186270 Prkaca Rat bisphenol F increases expression ISO PRKACA (Homo sapiens) 6480464 bisphenol F results in increased expression of PRKACA protein CTD PMID:34186270 Prkaca Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of PRKACA mRNA CTD PMID:36041667 Prkaca Rat bucladesine multiple interactions EXP 6480464 KT 5720 inhibits the reaction [Bucladesine results in increased activity of PRKACA protein] CTD PMID:31300867 Prkaca Rat bucladesine increases activity EXP 6480464 Bucladesine results in increased activity of PRKACA protein CTD PMID:31300867 Prkaca Rat buprenorphine decreases activity EXP 6480464 Buprenorphine results in decreased activity of PRKACA protein CTD PMID:24321744 Prkaca Rat buspirone decreases expression EXP 6480464 Buspirone results in decreased expression of PRKACA mRNA CTD PMID:24136188 Prkaca Rat cadmium atom decreases expression EXP 6480464 Cadmium results in decreased expression of PRKACA protein CTD PMID:25981801 Prkaca Rat cadmium atom multiple interactions ISO PRKACA (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of PRKACA mRNA CTD PMID:35301059 Prkaca Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of PRKACA protein CTD PMID:25981801 and PMID:29214744 Prkaca Rat cadmium dichloride multiple interactions ISO PRKACA (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of PRKACA mRNA CTD PMID:35301059 Prkaca Rat cadmium dichloride decreases expression ISO Prkaca (Mus musculus) 6480464 Cadmium Chloride results in decreased expression of PRKACA protein CTD PMID:31014900 Prkaca Rat cadmium dichloride multiple interactions ISO Prkaca (Mus musculus) 6480464 cyanidin-3-O-beta-glucopyranoside inhibits the reaction [Cadmium Chloride results in decreased expression of PRKACA protein] CTD PMID:31014900 Prkaca Rat caffeine decreases expression EXP 6480464 Caffeine results in decreased expression of PRKACA protein CTD PMID:30825513 Prkaca Rat caffeine decreases phosphorylation ISO PRKACA (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of PRKACA protein CTD PMID:35688186 Prkaca Rat caffeine decreases expression ISO PRKACA (Homo sapiens) 6480464 Caffeine results in decreased expression of PRKACA protein CTD PMID:30825513 Prkaca Rat cannabidiol affects methylation EXP 6480464 Cannabidiol affects the methylation of PRKACA gene CTD PMID:30521419 Prkaca Rat cannabidiol multiple interactions ISO PRKACA (Homo sapiens) 6480464 [Cannabidiol co-treated with moringin] results in decreased expression of PRKACA mRNA CTD PMID:30096889 Prkaca Rat capsaicin increases phosphorylation ISO Prkaca (Mus musculus) 6480464 Capsaicin results in increased phosphorylation of PRKACA protein CTD PMID:21908651 Prkaca Rat captopril multiple interactions EXP 6480464 Captopril inhibits the reaction [Pregabalin results in decreased expression of PRKACA protein] CTD PMID:31629013 Prkaca Rat CGP 52608 multiple interactions ISO PRKACA (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to PRKACA gene] CTD PMID:28238834 Prkaca Rat chaetocin multiple interactions EXP 6480464 chaetocin inhibits the reaction [Dronabinol results in decreased expression of PRKACA mRNA] CTD PMID:29022873 and PMID:29481316 Prkaca Rat chlormequat chloride affects expression EXP 6480464 Chlormequat affects the expression of PRKACA protein CTD PMID:38552810 Prkaca Rat chlorpyrifos decreases expression ISO Prkaca (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of PRKACA mRNA CTD PMID:32715474 Prkaca Rat cisplatin multiple interactions ISO PRKACA (Homo sapiens) 6480464 [PRKACA results in increased phosphorylation of BAD protein] which results in decreased susceptibility to Cisplatin CTD PMID:21849418 Prkaca Rat cisplatin increases expression ISO PRKACA (Homo sapiens) 6480464 Cisplatin results in increased expression of PRKACA mRNA CTD PMID:27392435 Prkaca Rat cisplatin decreases expression ISO PRKACA (Homo sapiens) 6480464 Cisplatin results in decreased expression of PRKACA mRNA CTD PMID:27594783 Prkaca Rat clenbuterol multiple interactions EXP 6480464 Clenbuterol inhibits the reaction [Oxidopamine results in decreased phosphorylation of PRKACA protein] CTD PMID:16339297 Prkaca Rat clozapine increases expression EXP 6480464 Clozapine results in increased expression of PRKACA mRNA CTD PMID:15860345 Prkaca Rat cobalt dichloride decreases expression ISO PRKACA (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of PRKACA mRNA CTD PMID:19320972 Prkaca Rat cocaine multiple interactions EXP 6480464 [Cocaine affects the activity of PRKACA protein] which affects the phosphorylation of DPYSL2 protein more ... CTD PMID:12595601 and PMID:19457111 Prkaca Rat cocaine affects expression EXP 6480464 Cocaine affects the expression of PRKACA protein CTD PMID:15659224 Prkaca Rat cocaine affects activity EXP 6480464 Cocaine affects the activity of PRKACA protein CTD PMID:19457111 Prkaca Rat colforsin daropate hydrochloride multiple interactions EXP 6480464 Colforsin inhibits the reaction [Oxidopamine results in decreased phosphorylation of PRKACA protein] CTD PMID:16339297 Prkaca Rat colforsin daropate hydrochloride multiple interactions ISO Prkaca (Mus musculus) 6480464 Colforsin inhibits the reaction [Diethylhexyl Phthalate results in decreased expression of PRKACA protein] CTD PMID:33234378 Prkaca Rat colforsin daropate hydrochloride increases activity ISO PRKACA (Homo sapiens) 6480464 Colforsin results in increased activity of PRKACA protein CTD PMID:28601556 Prkaca Rat copper(II) sulfate decreases expression ISO Prkaca (Mus musculus) 6480464 Copper Sulfate results in decreased expression of PRKACA mRNA and Copper Sulfate results in decreased expression of PRKACA protein CTD PMID:37353053 Prkaca Rat copper(II) sulfate multiple interactions ISO Prkaca (Mus musculus) 6480464 N-(2-(4-bromocinnamylamino)ethyl)-5-isoquinolinesulfonamide promotes the reaction [Copper Sulfate results in decreased expression of PRKACA mRNA] more ... CTD PMID:37353053 Prkaca Rat daidzein multiple interactions ISO PRKACA (Homo sapiens) 6480464 [daidzein co-treated with daidzin co-treated with genistin co-treated with Genistein co-treated with glycitin co-treated with glycitein] results in decreased expression of PRKACA mRNA CTD PMID:27424125 Prkaca Rat daidzein 7-O-beta-D-glucoside multiple interactions ISO PRKACA (Homo sapiens) 6480464 [daidzein co-treated with daidzin co-treated with genistin co-treated with Genistein co-treated with glycitin co-treated with glycitein] results in decreased expression of PRKACA mRNA CTD PMID:27424125 Prkaca Rat deguelin decreases expression ISO PRKACA (Homo sapiens) 6480464 deguelin results in decreased expression of PRKACA mRNA CTD PMID:33512557 Prkaca Rat dexamethasone multiple interactions ISO Prkaca (Mus musculus) 6480464 14-deoxy-11 more ... CTD PMID:29288687 and PMID:30248417 Prkaca Rat dibutyl phthalate decreases expression ISO Prkaca (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of PRKACA protein CTD PMID:36602389 Prkaca Rat dicrotophos increases expression ISO PRKACA (Homo sapiens) 6480464 dicrotophos results in increased expression of PRKACA mRNA CTD PMID:28302478 Prkaca Rat dobutamine multiple interactions EXP 6480464 Dobutamine inhibits the reaction [Oxidopamine results in decreased phosphorylation of PRKACA protein] CTD PMID:16339297 Prkaca Rat Doramectin decreases expression EXP 6480464 doramectin results in decreased expression of PRKACA mRNA CTD PMID:35137919 Prkaca Rat dorsomorphin multiple interactions ISO PRKACA (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Prkaca Rat doxorubicin increases expression ISO PRKACA (Homo sapiens) 6480464 Doxorubicin results in increased expression of PRKACA mRNA CTD PMID:16404146 Prkaca Rat epoxiconazole decreases expression ISO Prkaca (Mus musculus) 6480464 epoxiconazole results in decreased expression of PRKACA mRNA CTD PMID:35436446 Prkaca Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of PRKACA mRNA CTD PMID:20655511 Prkaca Rat ethanol multiple interactions ISO Prkaca (Mus musculus) 6480464 Ethanol affects the expression of and affects the splicing of PRKACA mRNA CTD PMID:30319688 Prkaca Rat ethyl methanesulfonate increases expression ISO PRKACA (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of PRKACA mRNA CTD PMID:23649840 Prkaca Rat fluoranthene multiple interactions ISO Prkaca (Mus musculus) 6480464 [1-methylanthracene co-treated with fluoranthene] results in decreased expression of PRKACA mRNA CTD PMID:28329830 Prkaca Rat formaldehyde increases expression ISO PRKACA (Homo sapiens) 6480464 Formaldehyde results in increased expression of PRKACA mRNA CTD PMID:23649840 Prkaca Rat FR900359 increases phosphorylation ISO PRKACA (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of PRKACA protein CTD PMID:37730182 Prkaca Rat Gastrodin multiple interactions EXP 6480464 gastrodin inhibits the reaction [Methamphetamine results in decreased expression of and results in decreased phosphorylation of PRKACA protein] CTD PMID:32162539 Prkaca Rat genistein multiple interactions ISO PRKACA (Homo sapiens) 6480464 [daidzein co-treated with daidzin co-treated with genistin co-treated with Genistein co-treated with glycitin co-treated with glycitein] results in decreased expression of PRKACA mRNA CTD PMID:27424125 Prkaca Rat genistein 7-O-beta-D-glucoside multiple interactions ISO PRKACA (Homo sapiens) 6480464 [daidzein co-treated with daidzin co-treated with genistin co-treated with Genistein co-treated with glycitin co-treated with glycitein] results in decreased expression of PRKACA mRNA CTD PMID:27424125 Prkaca Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of PRKACA mRNA CTD PMID:33387578 Prkaca Rat glycitein multiple interactions ISO PRKACA (Homo sapiens) 6480464 [daidzein co-treated with daidzin co-treated with genistin co-treated with Genistein co-treated with glycitin co-treated with glycitein] results in decreased expression of PRKACA mRNA CTD PMID:27424125 Prkaca Rat glycitin multiple interactions ISO PRKACA (Homo sapiens) 6480464 [daidzein co-treated with daidzin co-treated with genistin co-treated with Genistein co-treated with glycitin co-treated with glycitein] results in decreased expression of PRKACA mRNA CTD PMID:27424125 Prkaca Rat glyphosate decreases expression ISO PRKACA (Homo sapiens) 6480464 Glyphosate results in decreased expression of PRKACA mRNA CTD PMID:31295307 Prkaca Rat haloperidol increases expression EXP 6480464 Haloperidol results in increased expression of PRKACA mRNA and Haloperidol results in increased expression of PRKACA protein CTD PMID:15860345 and PMID:26894264 Prkaca Rat hydrogen peroxide multiple interactions ISO PRKACA (Homo sapiens) 6480464 [Hydrogen Peroxide co-treated with Theophylline] results in decreased expression of PRKACA protein CTD PMID:18951874 Prkaca Rat hydrogen sulfide increases phosphorylation ISO Prkaca (Mus musculus) 6480464 Hydrogen Sulfide results in increased phosphorylation of PRKACA protein CTD PMID:31843631 Prkaca Rat hydroxysafflor yellow A multiple interactions EXP 6480464 hydroxysafflor yellow A inhibits the reaction [2-chloro-5-nitrobenzanilide promotes the reaction [Particulate Matter results in decreased activity of PRKACA protein]] more ... CTD PMID:24192212 Prkaca Rat isoprenaline multiple interactions EXP 6480464 [Isoproterenol co-treated with POSTN protein] results in decreased expression of PRKACA mRNA CTD PMID:30303030 Prkaca Rat ivermectin decreases expression ISO PRKACA (Homo sapiens) 6480464 Ivermectin results in decreased expression of PRKACA protein CTD PMID:32959892 Prkaca Rat JTE-013 multiple interactions EXP 6480464 JTE 013 inhibits the reaction [Taurolithocholic Acid results in increased activity of PRKACA protein] CTD PMID:31300867 Prkaca Rat KT 5720 multiple interactions EXP 6480464 KT 5720 inhibits the reaction [Bucladesine results in increased activity of PRKACA protein] and KT 5720 inhibits the reaction [Taurolithocholic Acid results in increased activity of PRKACA protein] CTD PMID:31300867 Prkaca Rat Lappaconitine multiple interactions EXP 6480464 lappaconitine inhibits the reaction [4-Aminopyridine results in increased phosphorylation of PRKACA protein] CTD PMID:35643327 Prkaca Rat lead diacetate decreases expression EXP 6480464 lead acetate results in decreased expression of PRKACA protein CTD PMID:25981801 Prkaca Rat lead(0) decreases expression EXP 6480464 Lead results in decreased expression of PRKACA protein CTD PMID:25981801 Prkaca Rat Licarin A multiple interactions ISO Prkaca (Mus musculus) 6480464 PRKACA protein promotes the reaction [[licarin A affects the susceptibility to [INS protein co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone]] which results in increased expression of LIPE protein modified form] more ... CTD PMID:29288687 Prkaca Rat maneb multiple interactions EXP 6480464 [Paraquat co-treated with Maneb] results in decreased expression of PRKACA mRNA more ... CTD PMID:27460631 and PMID:33368748 Prkaca Rat manganese atom decreases expression EXP 6480464 Manganese results in decreased expression of PRKACA protein CTD PMID:25981801 Prkaca Rat manganese atom multiple interactions EXP 6480464 [manganese chloride results in increased abundance of Manganese] which results in increased activity of PRKACA protein CTD PMID:30951808 Prkaca Rat manganese(0) decreases expression EXP 6480464 Manganese results in decreased expression of PRKACA protein CTD PMID:25981801 Prkaca Rat manganese(0) multiple interactions EXP 6480464 [manganese chloride results in increased abundance of Manganese] which results in increased activity of PRKACA protein CTD PMID:30951808 Prkaca Rat manganese(II) chloride decreases expression EXP 6480464 manganese chloride results in decreased expression of PRKACA protein CTD PMID:25981801 Prkaca Rat manganese(II) chloride multiple interactions EXP 6480464 [manganese chloride results in increased abundance of Manganese] which results in increased activity of PRKACA protein CTD PMID:30951808 Prkaca Rat mercury dibromide increases expression ISO PRKACA (Homo sapiens) 6480464 mercuric bromide results in increased expression of PRKACA mRNA CTD PMID:26272509 Prkaca Rat mercury dibromide multiple interactions ISO PRKACA (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PRKACA mRNA CTD PMID:27188386 Prkaca Rat methamphetamine multiple interactions EXP 6480464 gastrodin inhibits the reaction [Methamphetamine results in decreased expression of and results in decreased phosphorylation of PRKACA protein] and Methamphetamine results in decreased expression of and results in decreased phosphorylation of PRKACA protein CTD PMID:32162539 Prkaca Rat methidathion decreases expression ISO Prkaca (Mus musculus) 6480464 methidathion results in decreased expression of PRKACA mRNA CTD PMID:34813904 Prkaca Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of PRKACA mRNA CTD PMID:38685447 Prkaca Rat methylmercury chloride increases expression EXP 6480464 methylmercuric chloride results in increased expression of PRKACA protein CTD PMID:29258870 Prkaca Rat mono(2-ethylhexyl) phthalate increases expression ISO Prkaca (Mus musculus) 6480464 mono-(2-ethylhexyl)phthalate results in increased expression of PRKACA mRNA CTD PMID:25543134 Prkaca Rat mono(2-ethylhexyl) phthalate multiple interactions EXP 6480464 PTGS2 protein inhibits the reaction [mono-(2-ethylhexyl)phthalate results in decreased expression of PRKACA mRNA] CTD PMID:36889213 Prkaca Rat mono(2-ethylhexyl) phthalate decreases expression EXP 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of PRKACA mRNA CTD PMID:36889213 Prkaca Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Pyridostigmine Bromide co-treated with DEET co-treated with Permethrin] results in increased expression of PRKACA mRNA CTD PMID:28659758 Prkaca Rat N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide multiple interactions EXP 6480464 N-(2-(4-bromocinnamylamino)ethyl)-5-isoquinolinesulfonamide inhibits the reaction [Atorvastatin results in increased phosphorylation of and results in increased activity of PRKACA protein] CTD PMID:19053045 Prkaca Rat N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide multiple interactions ISO Prkaca (Mus musculus) 6480464 N-(2-(4-bromocinnamylamino)ethyl)-5-isoquinolinesulfonamide promotes the reaction [Copper Sulfate results in decreased expression of PRKACA mRNA] and N-(2-(4-bromocinnamylamino)ethyl)-5-isoquinolinesulfonamide promotes the reaction [Copper Sulfate results in decreased expression of PRKACA protein] CTD PMID:37353053 Prkaca Rat N-methyl-4-phenylpyridinium affects expression ISO PRKACA (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium affects the expression of PRKACA mRNA CTD PMID:12710931 Prkaca Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in decreased expression of PRKACA mRNA CTD PMID:20360939 Prkaca Rat N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of PRKACA protein CTD PMID:29698782 Prkaca Rat nefazodone decreases expression EXP 6480464 nefazodone results in decreased expression of PRKACA mRNA CTD PMID:24136188 Prkaca Rat nitrates multiple interactions ISO Prkaca (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of PRKACA mRNA CTD PMID:35964746 Prkaca Rat Nor-9-carboxy-delta9-THC multiple interactions ISO PRKACA (Homo sapiens) 6480464 [Cannabinoids results in increased abundance of 11-nor-delta(9)-tetrahydrocannabinol-9-carboxylic acid] which affects the methylation of PRKACA gene CTD PMID:30521419 Prkaca Rat ochratoxin A increases acetylation ISO PRKACA (Homo sapiens) 6480464 ochratoxin A results in increased acetylation of PRKACA promoter CTD PMID:29098329 Prkaca Rat ochratoxin A multiple interactions ISO PRKACA (Homo sapiens) 6480464 [ochratoxin A results in increased acetylation of PRKACA promoter] which results in increased expression of PRKACA mRNA CTD PMID:29098329 Prkaca Rat ochratoxin A increases expression ISO PRKACA (Homo sapiens) 6480464 ochratoxin A results in increased expression of PRKACA mRNA CTD PMID:29098329 Prkaca Rat oxidopamine decreases phosphorylation EXP 6480464 Oxidopamine results in decreased phosphorylation of PRKACA protein CTD PMID:16339297 Prkaca Rat oxidopamine multiple interactions EXP 6480464 Clenbuterol inhibits the reaction [Oxidopamine results in decreased phosphorylation of PRKACA protein] more ... CTD PMID:16339297 Prkaca Rat oxycodone increases phosphorylation EXP 6480464 Oxycodone results in increased phosphorylation of PRKACA protein CTD PMID:26377394 Prkaca Rat ozone multiple interactions ISO PRKACA (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of PRKACA mRNA CTD PMID:35430440 Prkaca Rat panobinostat multiple interactions ISO PRKACA (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PRKACA mRNA CTD PMID:27188386 Prkaca Rat panobinostat increases expression ISO PRKACA (Homo sapiens) 6480464 panobinostat results in increased expression of PRKACA mRNA CTD PMID:26272509 Prkaca Rat paracetamol increases expression ISO PRKACA (Homo sapiens) 6480464 Acetaminophen results in increased expression of PRKACA mRNA CTD PMID:25704631 Prkaca Rat paraquat multiple interactions EXP 6480464 [Paraquat co-treated with Maneb] results in decreased expression of PRKACA mRNA more ... CTD PMID:27460631 and PMID:33368748 Prkaca Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Prkaca (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of PRKACA mRNA CTD PMID:36331819 Prkaca Rat perfluorooctanoic acid decreases expression EXP 6480464 perfluorooctanoic acid results in decreased expression of PRKACA mRNA CTD PMID:19162173 Prkaca Rat permethrin multiple interactions EXP 6480464 [Pyridostigmine Bromide co-treated with DEET co-treated with Permethrin] results in increased expression of PRKACA mRNA CTD PMID:28659758 Prkaca Rat phenethyl caffeate multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in decreased expression of PRKACA mRNA CTD PMID:20360939 Prkaca Rat phenobarbital affects expression ISO Prkaca (Mus musculus) 6480464 Phenobarbital affects the expression of PRKACA mRNA CTD PMID:23091169 Prkaca Rat phenylmercury acetate increases expression ISO PRKACA (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of PRKACA mRNA CTD PMID:26272509 Prkaca Rat phenylmercury acetate multiple interactions ISO PRKACA (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PRKACA mRNA CTD PMID:27188386 Prkaca Rat pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of PRKACA mRNA CTD PMID:19162173 Prkaca Rat pregabalin multiple interactions EXP 6480464 Captopril inhibits the reaction [Pregabalin results in decreased expression of PRKACA protein] and Telmisartan inhibits the reaction [Pregabalin results in decreased expression of PRKACA protein] CTD PMID:31629013 Prkaca Rat pregabalin decreases expression EXP 6480464 Pregabalin results in decreased expression of PRKACA protein CTD PMID:31629013 Prkaca Rat propiconazole increases expression EXP 6480464 propiconazole results in increased expression of PRKACA mRNA CTD PMID:30047161 Prkaca Rat prostaglandin E2 multiple interactions ISO PRKACA (Homo sapiens) 6480464 [Dinoprostone co-treated with PTGER1 protein] results in increased phosphorylation of PRKACA protein CTD PMID:22188298 Prkaca Rat Pyridostigmine bromide multiple interactions EXP 6480464 [Pyridostigmine Bromide co-treated with DEET co-treated with Permethrin] results in increased expression of PRKACA mRNA CTD PMID:28659758 Prkaca Rat pyrimidifen decreases expression ISO PRKACA (Homo sapiens) 6480464 pyrimidifen results in decreased expression of PRKACA mRNA CTD PMID:33512557 Prkaca Rat quercetin multiple interactions EXP 6480464 PRKACA protein affects the reaction [Quercetin results in increased expression of EGR1 mRNA] and PRKACA protein affects the reaction [Quercetin results in increased expression of EGR1 protein] CTD PMID:22174042 Prkaca Rat reserpine decreases expression ISO Prkaca (Mus musculus) 6480464 Reserpine results in decreased expression of PRKACA protein CTD PMID:26114099 Prkaca Rat resveratrol multiple interactions ISO PRKACA (Homo sapiens) 6480464 [TNF protein co-treated with Resveratrol] results in increased expression of PRKACA protein more ... CTD PMID:24145604 and PMID:25943029 Prkaca Rat roflumilast multiple interactions EXP 6480464 Roflumilast inhibits the reaction [Rotenone results in decreased expression of PRKACA protein] CTD PMID:36706892 Prkaca Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of PRKACA mRNA and Rotenone results in decreased expression of PRKACA protein CTD PMID:28374803 and PMID:36706892 Prkaca Rat rotenone multiple interactions EXP 6480464 Roflumilast inhibits the reaction [Rotenone results in decreased expression of PRKACA protein] CTD PMID:36706892 Prkaca Rat rotenone decreases expression ISO PRKACA (Homo sapiens) 6480464 Rotenone results in decreased expression of PRKACA mRNA CTD PMID:33512557 Prkaca Rat SB 431542 multiple interactions ISO PRKACA (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Prkaca Rat serpentine asbestos decreases methylation ISO PRKACA (Homo sapiens) 6480464 Asbestos and Serpentine results in decreased methylation of PRKACA 3' UTR CTD PMID:29523930 Prkaca Rat sodium arsenite decreases expression ISO PRKACA (Homo sapiens) 6480464 sodium arsenite results in decreased expression of PRKACA mRNA CTD PMID:12760830 Prkaca Rat sodium arsenite increases expression ISO PRKACA (Homo sapiens) 6480464 sodium arsenite results in increased expression of PRKACA mRNA CTD PMID:34032870 Prkaca Rat sodium arsenite increases expression ISO Prkaca (Mus musculus) 6480464 sodium arsenite results in increased expression of PRKACA mRNA CTD PMID:16014739 Prkaca Rat sodium fluoride increases expression ISO Prkaca (Mus musculus) 6480464 Sodium Fluoride results in increased expression of PRKACA protein CTD PMID:28918527 Prkaca Rat streptozocin multiple interactions ISO Prkaca (Mus musculus) 6480464 [Streptozocin co-treated with Dietary Fats co-treated with Dietary Sugars] results in decreased phosphorylation of PRKACA protein and Diethylhexyl Phthalate promotes the reaction [[Streptozocin co-treated with Dietary Fats co-treated with Dietary Sugars] results in decreased phosphorylation of PRKACA protein] CTD PMID:32303808 Prkaca Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of PRKACA mRNA CTD PMID:30047161 Prkaca Rat sulindac multiple interactions EXP 6480464 [Sulindac co-treated with lipopolysaccharide and E coli O55-B5] affects the expression of PRKACA mRNA CTD PMID:20371263 Prkaca Rat sulindac sulfide increases expression ISO PRKACA (Homo sapiens) 6480464 sulindac sulfide results in increased expression of PRKACA mRNA CTD PMID:16184548 Prkaca Rat sunitinib decreases expression ISO PRKACA (Homo sapiens) 6480464 Sunitinib results in decreased expression of PRKACA mRNA CTD PMID:31533062 Prkaca Rat tamibarotene increases expression ISO PRKACA (Homo sapiens) 6480464 tamibarotene results in increased expression of PRKACA mRNA CTD PMID:17229644 Prkaca Rat taurine multiple interactions EXP 6480464 Taurine inhibits the reaction [[Paraquat co-treated with Maneb] results in decreased expression of PRKACA mRNA] CTD PMID:33368748 Prkaca Rat taurolithocholic acid increases activity EXP 6480464 Taurolithocholic Acid results in increased activity of PRKACA protein CTD PMID:31300867 Prkaca Rat taurolithocholic acid multiple interactions EXP 6480464 JTE 013 inhibits the reaction [Taurolithocholic Acid results in increased activity of PRKACA protein] more ... CTD PMID:31300867 Prkaca Rat tebufenpyrad decreases expression ISO PRKACA (Homo sapiens) 6480464 4-chloro-N-((4-(1 and 1-dimethylethyl)phenyl)methyl)-3-ethyl-1-methyl-1H-pyrazole-5-carboxamide results in decreased expression of PRKACA mRNA CTD PMID:33512557 Prkaca Rat telmisartan multiple interactions EXP 6480464 Telmisartan inhibits the reaction [Pregabalin results in decreased expression of PRKACA protein] CTD PMID:31629013 Prkaca Rat testosterone multiple interactions EXP 6480464 [bisphenol A co-treated with Testosterone] results in increased expression of PRKACA mRNA CTD PMID:26496021 Prkaca Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of PRKACA mRNA CTD PMID:31150632 Prkaca Rat tetrachloromethane decreases expression ISO Prkaca (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of PRKACA mRNA CTD PMID:31919559 Prkaca Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of PRKACA mRNA] CTD PMID:31150632 Prkaca Rat thapsigargin decreases expression EXP 6480464 Thapsigargin results in decreased expression of PRKACA protein CTD PMID:35544339 Prkaca Rat theophylline multiple interactions ISO PRKACA (Homo sapiens) 6480464 [Hydrogen Peroxide co-treated with Theophylline] results in decreased expression of PRKACA protein CTD PMID:18951874 Prkaca Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of PRKACA mRNA CTD PMID:23411599 Prkaca Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of PRKACA mRNA CTD PMID:19448997 and PMID:33387578 Prkaca Rat triclosan increases expression EXP 6480464 Triclosan results in increased expression of PRKACA mRNA CTD PMID:30447264 Prkaca Rat triphenyl phosphate affects expression ISO PRKACA (Homo sapiens) 6480464 triphenyl phosphate affects the expression of PRKACA mRNA CTD PMID:37042841 Prkaca Rat Triptolide increases expression EXP 6480464 triptolide results in increased expression of PRKACA mRNA CTD PMID:23639586 Prkaca Rat Tylophorine increases expression ISO PRKACA (Homo sapiens) 6480464 tylophorine analog results in increased expression of PRKACA mRNA CTD PMID:19284764 Prkaca Rat urethane increases expression ISO PRKACA (Homo sapiens) 6480464 Urethane results in increased expression of PRKACA mRNA CTD PMID:28818685 Prkaca Rat valproic acid increases methylation ISO PRKACA (Homo sapiens) 6480464 Valproic Acid results in increased methylation of PRKACA gene CTD PMID:29154799 Prkaca Rat valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of PRKACA mRNA CTD PMID:32428529 Prkaca Rat valproic acid increases expression ISO PRKACA (Homo sapiens) 6480464 Valproic Acid results in increased expression of PRKACA mRNA CTD PMID:23179753 Prkaca Rat vanadium atom decreases expression ISO PRKACA (Homo sapiens) 6480464 Vanadium results in decreased expression of PRKACA mRNA CTD PMID:19000753 Prkaca Rat vanadium(0) decreases expression ISO PRKACA (Homo sapiens) 6480464 Vanadium results in decreased expression of PRKACA mRNA CTD PMID:19000753 Prkaca Rat vismodegib increases expression ISO PRKACA (Homo sapiens) 150573695 vismodegib increases protein kinase A protein expression in pituitary adenoma cells RGD
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(+)-schisandrin B (EXP) (1->4)-beta-D-glucan (ISO) 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP,ISO) 1,2-dimethylhydrazine (EXP) 14-Deoxy-11,12-didehydroandrographolide (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-tert-butylhydroquinone (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 4-aminopyridine (EXP) 6-propyl-2-thiouracil (EXP) amitrole (EXP) ammonium chloride (EXP) antimycin A (ISO) aripiprazole (EXP) aristolochic acid A (ISO) arsenite(3-) (ISO) asbestos (ISO) atorvastatin calcium (EXP) atrazine (EXP) BAPTA (EXP) belinostat (ISO) benzo[a]pyrene (ISO) Bifeprunox (EXP) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (EXP,ISO) bucladesine (EXP) buprenorphine (EXP) buspirone (EXP) cadmium atom (EXP,ISO) cadmium dichloride (EXP,ISO) caffeine (EXP,ISO) cannabidiol (EXP,ISO) capsaicin (ISO) captopril (EXP) CGP 52608 (ISO) chaetocin (EXP) chlormequat chloride (EXP) chlorpyrifos (ISO) cisplatin (ISO) clenbuterol (EXP) clozapine (EXP) cobalt dichloride (ISO) cocaine (EXP) colforsin daropate hydrochloride (EXP,ISO) copper(II) sulfate (ISO) daidzein (ISO) daidzein 7-O-beta-D-glucoside (ISO) deguelin (ISO) dexamethasone (ISO) dibutyl phthalate (ISO) dicrotophos (ISO) dobutamine (EXP) Doramectin (EXP) dorsomorphin (ISO) doxorubicin (ISO) epoxiconazole (ISO) ethanol (EXP,ISO) ethyl methanesulfonate (ISO) fluoranthene (ISO) formaldehyde (ISO) FR900359 (ISO) Gastrodin (EXP) genistein (ISO) genistein 7-O-beta-D-glucoside (ISO) gentamycin (EXP) glycitein (ISO) glycitin (ISO) glyphosate (ISO) haloperidol (EXP) hydrogen peroxide (ISO) hydrogen sulfide (ISO) hydroxysafflor yellow A (EXP) isoprenaline (EXP) ivermectin (ISO) JTE-013 (EXP) KT 5720 (EXP) Lappaconitine (EXP) lead diacetate (EXP) lead(0) (EXP) Licarin A (ISO) maneb (EXP) manganese atom (EXP) manganese(0) (EXP) manganese(II) chloride (EXP) mercury dibromide (ISO) methamphetamine (EXP) methidathion (ISO) methimazole (EXP) methylmercury chloride (EXP) mono(2-ethylhexyl) phthalate (EXP,ISO) N,N-diethyl-m-toluamide (EXP) N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide (EXP,ISO) N-methyl-4-phenylpyridinium (ISO) N-nitrosodiethylamine (EXP) nefazodone (EXP) nitrates (ISO) Nor-9-carboxy-delta9-THC (ISO) ochratoxin A (ISO) oxidopamine (EXP) oxycodone (EXP) ozone (ISO) panobinostat (ISO) paracetamol (ISO) paraquat (EXP) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP) permethrin (EXP) phenethyl caffeate (EXP) phenobarbital (ISO) phenylmercury acetate (ISO) pirinixic acid (EXP) pregabalin (EXP) propiconazole (EXP) prostaglandin E2 (ISO) Pyridostigmine bromide (EXP) pyrimidifen (ISO) quercetin (EXP) reserpine (ISO) resveratrol (ISO) roflumilast (EXP) rotenone (EXP,ISO) SB 431542 (ISO) serpentine asbestos (ISO) sodium arsenite (ISO) sodium fluoride (ISO) streptozocin (ISO) sulfadimethoxine (EXP) sulindac (EXP) sulindac sulfide (ISO) sunitinib (ISO) tamibarotene (ISO) taurine (EXP) taurolithocholic acid (EXP) tebufenpyrad (ISO) telmisartan (EXP) testosterone (EXP) tetrachloromethane (EXP,ISO) thapsigargin (EXP) theophylline (ISO) thioacetamide (EXP) trichloroethene (EXP) triclosan (EXP) triphenyl phosphate (ISO) Triptolide (EXP) Tylophorine (ISO) urethane (ISO) valproic acid (EXP,ISO) vanadium atom (ISO) vanadium(0) (ISO) vismodegib (ISO)
Biological Process
adenylate cyclase-activating G protein-coupled receptor signaling pathway (IEA,ISO) adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway (IEA,ISO) cAMP/PKA signal transduction (ISO) cellular response to cold (IEA,ISO) cellular response to glucagon stimulus (IEA,ISO) cellular response to glucose stimulus (IEA,ISO) cellular response to heat (IEA,ISO,ISS) cellular response to parathyroid hormone stimulus (IEA,ISO) dorsal/ventral neural tube patterning (ISO) intracellular potassium ion homeostasis (IEA,ISO) mesoderm formation (IEA,ISO) modulation of chemical synaptic transmission (IEA,ISO) mRNA processing (IEA,ISO) negative regulation of glycolytic process through fructose-6-phosphate (IEA,ISO) negative regulation of meiotic cell cycle (IDA) negative regulation of meiotic cell cycle process involved in oocyte maturation (ISO) negative regulation of smoothened signaling pathway (IEA,ISO) negative regulation of TORC1 signaling (IEA,ISO,ISS) neural tube closure (IEA,ISO) peptidyl-serine phosphorylation (IDA,IMP,ISO) peptidyl-threonine phosphorylation (ISO) positive regulation of cell population proliferation (IMP) positive regulation of cholesterol biosynthetic process (IEA,ISO) positive regulation of gluconeogenesis (IEA,ISO) positive regulation of insulin secretion (IEA,ISO) positive regulation of phagocytosis (IEA,ISO) positive regulation of protein export from nucleus (IEA,ISO) postsynaptic modulation of chemical synaptic transmission (IEA,ISO) protein autophosphorylation (ISO) protein export from nucleus (IEA,ISO) protein localization to lipid droplet (IEA,ISO) protein phosphorylation (IDA,ISO) regulation of bicellular tight junction assembly (IEA,ISO) regulation of cell cycle (IEA,ISO) regulation of cellular respiration (IDA) regulation of osteoblast differentiation (IEA,ISO) regulation of proteasomal protein catabolic process (IEA,ISO) regulation of protein processing (IEA,ISO) regulation of synaptic transmission, glutamatergic (IDA) signal transduction (IBA) sperm capacitation (IEA,ISO) spontaneous exocytosis of neurotransmitter (IMP)
Cellular Component
acrosomal vesicle (IEA,ISO,ISS) axoneme (IEA,ISO) cAMP-dependent protein kinase complex (IBA,IDA,IEA,ISO) cell projection (IEA) centrosome (IEA,ISO) ciliary base (IEA,ISO) cilium (IEA) cytoplasm (IEA,ISO) cytoplasmic vesicle (IEA) cytosol (IBA,IEA,ISO,TAS) germinal vesicle (ISO) glutamatergic synapse (IEA,ISO) membrane (IEA) mitochondrion (IEA,ISO) motile cilium (IEA) neuromuscular junction (IDA,IEA,ISO) nuclear speck (IEA,ISO) nucleoplasm (TAS) nucleotide-activated protein kinase complex (ISO) nucleus (IBA,IEA,ISO) perinuclear region of cytoplasm (IDA,IEA,ISO) plasma membrane (IEA,ISO) plasma membrane raft (IEA,ISO) postsynapse (IDA,IEA) presynapse (IDA,IMP) protein-containing complex (IDA) sperm flagellum (IEA,ISO,ISS) sperm midpiece (ISO,ISS)
Molecular Function
ATP binding (IEA,ISO) cAMP-dependent protein kinase activity (IBA,IDA,IEA,IMP,ISO,TAS) kinase activity (IEA) magnesium ion binding (IEA,ISO) manganese ion binding (IEA,ISO) nucleotide binding (IEA) protein binding (IPI,ISO) protein domain specific binding (IEA,ISO) protein kinase A regulatory subunit binding (IBA,IC,IEA,ISO) protein kinase activity (IEA,ISO) protein kinase binding (IEA,IPI,ISO) protein serine kinase activity (IEA,ISO) protein serine/threonine kinase activity (IEA,ISO,TAS) protein serine/threonine/tyrosine kinase activity (IEA,ISO) protein-containing complex binding (IPI) small GTPase binding (IPI) transferase activity (IEA) ubiquitin protein ligase binding (IEA,ISO)
1.
Cyclic AMP signaling and gene regulation.
Daniel PB, etal., Annu Rev Nutr 1998;18:353-83.
2.
Protein kinase A in the pedunculopontine tegmental nucleus of rat contributes to regulation of rapid eye movement sleep.
Datta S and Desarnaud F, J Neurosci. 2010 Sep 15;30(37):12263-73. doi: 10.1523/JNEUROSCI.1563-10.2010.
3.
SCP2-mediated cholesterol membrane trafficking promotes the growth of pituitary adenomas via Hedgehog signaling activation.
Ding X, etal., J Exp Clin Cancer Res. 2019 Sep 13;38(1):404. doi: 10.1186/s13046-019-1411-9.
4.
Differential effects of haloperidol and clozapine on cAMP binding, protein kinase A (PKA) activity, and mRNA and protein expression of selective regulatory and catalytic subunit isoforms of PKA in rat brain.
Dwivedi Y, etal., J Pharmacol Exp Ther. 2002 Apr;301(1):197-209.
5.
CRISPR/Cas9 Engineering of Adult Mouse Liver Demonstrates That the Dnajb1-Prkaca Gene Fusion Is Sufficient to Induce Tumors Resembling Fibrolamellar Hepatocellular Carcinoma.
Engelholm LH, etal., Gastroenterology. 2017 Dec;153(6):1662-1673.e10. doi: 10.1053/j.gastro.2017.09.008. Epub 2017 Sep 18.
6.
Phosphorylation and inactivation of glycogen synthase kinase 3 by protein kinase A.
Fang X, etal., Proc Natl Acad Sci U S A. 2000 Oct 24;97(22):11960-5.
7.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
8.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
9.
Regulation of cyclin D2 expression and degradation by follicle-stimulating hormone during rat granulosa cell proliferation in vitro.
Han Y, etal., Biol Reprod. 2013 Mar 7;88(3):57. doi: 10.1095/biolreprod.112.105106. Print 2013 Mar.
10.
A-kinase anchoring protein mediates TRPV1 thermal hyperalgesia through PKA phosphorylation of TRPV1.
Jeske NA, etal., Pain. 2008 Sep 15;138(3):604-16. Epub 2008 Apr 1.
11.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
12.
Regulation of mRNA expression involved in Ras and PKA signal pathways during rat hypoglossal nerve regeneration.
Kiryu S, etal., Brain Res Mol Brain Res. 1995 Mar;29(1):147-56.
13.
An active protein kinase A (PKA) is involved in meiotic arrest of rat growing oocytes.
Kovo M, etal., Reproduction. 2006 Jul;132(1):33-43.
14.
Phosphorylation of the cAMP-dependent protein kinase (PKA) regulatory subunit modulates PKA-AKAP interaction, substrate phosphorylation, and calcium signaling in cardiac cells.
Manni S, etal., J Biol Chem. 2008 Aug 29;283(35):24145-54. Epub 2008 Jun 12.
15.
PKA phosphorylation dissociates FKBP12.6 from the calcium release channel (ryanodine receptor): defective regulation in failing hearts.
Marx SO, etal., Cell. 2000 May 12;101(4):365-76.
16.
Synaptotagmin-12, a synaptic vesicle phosphoprotein that modulates spontaneous neurotransmitter release.
Maximov A, etal., J Cell Biol. 2007 Jan 1;176(1):113-24. Epub 2006 Dec 26.
17.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
18.
Impairment of cerebral cAMP-mediated signal transduction system and of spatial memory function after microsphere embolism in rats.
Nagakura A, etal., Neuroscience. 2002;113(3):519-28.
19.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
20.
PKA phosphorylation of Src mediates Rap1 activation in NGF and cAMP signaling in PC12 cells.
Obara Y, etal., J Cell Sci. 2004 Dec 1;117(Pt 25):6085-94. Epub 2004 Nov 16.
21.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
22.
PKA, PKC, and AKAP localization in and around the neuromuscular junction.
Perkins GA, etal., BMC Neurosci. 2001;2:17. Epub 2001 Oct 23.
23.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
24.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
25.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
26.
GOA pipeline
RGD automated data pipeline
27.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
28.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
29.
Enhanced cAMP-stimulated protein kinase A activity in human fibrolamellar hepatocellular carcinoma.
Riggle KM, etal., Pediatr Res. 2016 Jul;80(1):110-8. doi: 10.1038/pr.2016.36. Epub 2016 Mar 8.
30.
Recurrent somatic mutations underlie corticotropin-independent Cushing's syndrome.
Sato Y, etal., Science. 2014 May 23;344(6186):917-20. doi: 10.1126/science.1252328.
31.
Cardiac troponin C-L29Q, related to hypertrophic cardiomyopathy, hinders the transduction of the protein kinase A dependent phosphorylation signal from cardiac troponin I to C.
Schmidtmann A, etal., FEBS J. 2005 Dec;272(23):6087-97.
32.
Modulation of AMPA receptors by cAMP-dependent protein kinase in preBotzinger complex inspiratory neurons regulates respiratory rhythm in the rat.
Shao XM, etal., J Physiol. 2003 Mar 1;547(Pt 2):543-53. Epub 2003 Jan 24.
33.
RAB13 regulates Sertoli cell permeability barrier dynamics through protein kinase A.
Su W and Liu X, J Mol Endocrinol. 2013 Apr 12;50(3):305-18. doi: 10.1530/JME-13-0011. Print 2013 Jun.
34.
Localized effects of cAMP mediated by distinct routes of protein kinase A.
Tasken K and Aandahl EM, Physiol Rev. 2004 Jan;84(1):137-67.
35.
Cytosolic glucocorticoid receptor interaction with nuclear factor-kappa B proteins in rat liver cells.
Widen C, etal., Biochem J. 2003 Jul 1;373(Pt 1):211-20.
36.
Rat C alpha catalytic subunit of the cAMP-dependent protein kinase: cDNA sequence and evidence that it is the only isoform expressed in myoblasts.
Wiemann S, etal., Biochim Biophys Acta 1991 Jun 13;1089(2):254-6.
37.
The Potential Role of PKA/CREB Signaling Pathway Concerned with Gastrodin Administration on Methamphetamine-Induced Conditioned Place Preference Rats and SH-SY5Y Cell Line.
Yang GM, etal., Neurotox Res. 2020 Apr;37(4):926-935. doi: 10.1007/s12640-019-00150-7. Epub 2020 Jan 4.
38.
betagamma Dimers mediate synergy of dopamine D2 and adenosine A2 receptor-stimulated PKA signaling and regulate ethanol consumption.
Yao L, etal., Cell. 2002 Jun 14;109(6):733-43.
39.
Addicting drugs utilize a synergistic molecular mechanism in common requiring adenosine and Gi-beta gamma dimers.
Yao L, etal., Proc Natl Acad Sci U S A. 2003 Nov 25;100(24):14379-84. Epub 2003 Nov 6.
40.
A developmental switch in the signaling cascades for LTP induction.
Yasuda H, etal., Nat Neurosci. 2003 Jan;6(1):15-6.
41.
DARPP-32, Jack of All Trades... Master of Which?
Yger M and Girault JA, Front Behav Neurosci. 2011 Sep 8;5:56. doi: 10.3389/fnbeh.2011.00056. eCollection 2011.
Prkaca Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 41,059,843 - 41,083,189 (-) NCBI GRCr8 mRatBN7.2 19 24,155,081 - 24,178,430 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 24,155,090 - 24,178,430 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 30,976,206 - 30,999,561 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 31,630,613 - 31,653,968 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 33,853,335 - 33,876,684 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 25,095,089 - 25,118,869 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 25,095,089 - 25,118,860 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 36,073,104 - 36,096,884 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 25,840,795 - 25,864,786 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 19 25,845,620 - 25,861,927 (-) NCBI Celera 19 23,703,180 - 23,726,723 (-) NCBI Celera Cytogenetic Map 19 q11 NCBI
PRKACA Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 14,091,688 - 14,117,762 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 14,091,688 - 14,118,084 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 14,202,500 - 14,228,574 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 14,063,500 - 14,089,559 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 14,063,508 - 14,085,992 NCBI Celera 19 14,096,777 - 14,122,833 (-) NCBI Celera Cytogenetic Map 19 p13.12 NCBI HuRef 19 13,774,379 - 13,800,126 (-) NCBI HuRef CHM1_1 19 14,202,926 - 14,228,985 (-) NCBI CHM1_1 T2T-CHM13v2.0 19 14,218,299 - 14,244,374 (-) NCBI T2T-CHM13v2.0
Prkaca Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 84,699,607 - 84,723,073 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 84,699,622 - 84,723,072 (+) Ensembl GRCm39 Ensembl GRCm38 8 83,972,978 - 83,996,444 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 83,972,993 - 83,996,443 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 86,496,877 - 86,520,344 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 86,863,093 - 86,886,544 (+) NCBI MGSCv36 mm8 Celera 8 88,266,474 - 88,289,645 (+) NCBI Celera Cytogenetic Map 8 C2 NCBI cM Map 8 40.22 NCBI
Prkaca Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955415 32,793,718 - 32,812,930 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955415 32,794,172 - 32,807,944 (-) NCBI ChiLan1.0 ChiLan1.0
PRKACA Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 19,024,152 - 19,050,193 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 18,025,838 - 18,051,874 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 13,657,344 - 13,683,864 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 14,385,183 - 14,406,205 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 14,385,191 - 14,406,205 (-) Ensembl panpan1.1 panPan2
PRKACA Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 48,416,730 - 48,425,237 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 48,409,045 - 48,426,669 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 48,283,546 - 48,299,768 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 48,926,811 - 48,944,065 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 48,926,580 - 48,944,481 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 48,138,017 - 48,154,228 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 48,564,570 - 48,580,793 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 48,807,387 - 48,823,603 (+) NCBI UU_Cfam_GSD_1.0
Prkaca Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 207,588,938 - 207,605,559 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936659 2,750,537 - 2,765,753 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936659 2,750,015 - 2,765,914 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PRKACA Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 65,074,870 - 65,095,551 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 65,074,876 - 65,095,564 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 65,350,544 - 65,371,236 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PRKACA
Prkaca
.
Assembly: Rnor_6.0
Chromosome Start Pos End Pos Reference Nucleotide Variant Nucleotide Variant Type Strain Variant Page
19
25112642
25112643
G
A
snv
MR/N (MCW) View more Information
Predicted Target Of
Count of predictions: 590 Count of miRNA genes: 230 Interacting mature miRNAs: 278 Transcripts: ENSRNOT00000007281, ENSRNOT00000041717 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1549847 Bss8 Bone structure and strength QTL 8 4 lumbar vertebra strength trait (VT:0010574) vertebra ultimate force (CMO:0001678) 19 1 31963836 Rat 61447 Tcas1 Tongue tumor susceptibility QTL 1 6.08 tongue integrity trait (VT:0010553) squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875) 19 2316121 47316121 Rat 631681 Cm12 Cardiac mass QTL 12 3.33 0.00053 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 19 1 28982497 Rat 9590298 Uminl5 Urine mineral level QTL 5 3.59 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 19 1 36824771 Rat 1331737 Uae29 Urinary albumin excretion QTL 29 5.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 19 4096155 55283277 Rat 2298478 Eau8 Experimental allergic uveoretinitis QTL 8 0.0163 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 19 17154433 57337602 Rat 1578764 Stresp19 Stress response QTL 19 3.6 0.001 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 19 15630201 57337602 Rat 1558656 Prcs1 Prostate cancer susceptibility QTL 1 5 prostate integrity trait (VT:0010571) percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943) 19 15114598 34521833 Rat 9590090 Insglur8 Insulin/glucose ratio QTL 8 10.81 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 19 1 36824771 Rat 1331788 Rf45 Renal function QTL 45 2.818 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 19 15605023 46559041 Rat 724566 Uae12 Urinary albumin excretion QTL 12 5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 19 2187927 56457239 Rat 724565 Tcas5 Tongue tumor susceptibility QTL 5 10.04 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 19 9977753 39654489 Rat 61407 Scl12 Serum cholesterol level QTL 12 0.001 blood HDL cholesterol amount (VT:0000184) serum high density lipoprotein cholesterol level (CMO:0000361) 19 13926401 30303727 Rat 8552935 Pigfal10 Plasma insulin-like growth factor 1 level QTL 10 5.7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 19 1 36824771 Rat 61350 Bp32 Blood pressure QTL 32 0.012 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 19 20483575 57337602 Rat 7411549 Bw130 Body weight QTL 130 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 19 15455860 57337602 Rat 10054132 Srcrt9 Stress Responsive Cort QTL 9 2.87 0.0017 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 19 1 27355345 Rat 724518 Uae19 Urinary albumin excretion QTL 19 5.5 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 19 7457249 42983518 Rat 8694186 Bw152 Body weight QTL 152 3.34 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 19 569374 45569374 Rat 61423 Cia14 Collagen induced arthritis QTL 14 3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 19 10827970 43544039 Rat 7411590 Foco7 Food consumption QTL 7 6.8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 19 1 24688055 Rat 631678 Cm9 Cardiac mass QTL 9 4.27 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 19 1 28982497 Rat 9590250 Scort11 Serum corticosterone level QTL 11 23.45 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 19 1 36824771 Rat 2317848 Alcrsp21 Alcohol response QTL 21 1.899999976158142 0.05 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 19 3204777 48204777 Rat 9589102 Slep13 Serum leptin concentration QTL 13 4.63 0.001 blood leptin amount (VT:0005667) plasma leptin level (CMO:0000781) 19 569374 45569374 Rat 7247442 Uae39 Urinary albumin excretion QTL 39 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 19 2187927 46708701 Rat
RH128078
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 19 41,060,009 - 41,060,233 (+) Marker Load Pipeline mRatBN7.2 19 24,155,247 - 24,155,471 (-) MAPPER mRatBN7.2 Rnor_6.0 19 25,118,479 - 25,118,702 NCBI Rnor6.0 Rnor_5.0 19 36,096,494 - 36,096,717 UniSTS Rnor5.0 RGSC_v3.4 19 25,840,962 - 25,841,185 UniSTS RGSC3.4 Celera 19 23,703,347 - 23,703,570 UniSTS Cytogenetic Map 19 q11 UniSTS
RH94810
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 24,155,451 - 24,155,566 (-) MAPPER mRatBN7.2 Rnor_6.0 19 25,118,384 - 25,118,498 NCBI Rnor6.0 Rnor_5.0 19 36,096,399 - 36,096,513 UniSTS Rnor5.0 RGSC_v3.4 19 25,841,166 - 25,841,280 UniSTS RGSC3.4 Celera 19 23,703,551 - 23,703,665 UniSTS Cytogenetic Map 19 q11 UniSTS
PMC18620P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 24,174,399 - 24,174,661 (-) MAPPER mRatBN7.2 Rnor_6.0 19 25,098,864 - 25,099,125 NCBI Rnor6.0 Rnor_5.0 19 36,076,879 - 36,077,140 UniSTS Rnor5.0 RGSC_v3.4 19 25,860,749 - 25,861,010 UniSTS RGSC3.4 Celera 19 23,722,943 - 23,723,204 UniSTS Cytogenetic Map 19 q11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000041717 ⟹ ENSRNOP00000044732
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 24,155,090 - 24,178,430 (-) Ensembl Rnor_6.0 Ensembl 19 25,095,089 - 25,118,860 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000095425 ⟹ ENSRNOP00000082120
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 24,155,090 - 24,173,242 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000103388 ⟹ ENSRNOP00000076567
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 24,155,090 - 24,171,305 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000107553 ⟹ ENSRNOP00000079272
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 24,155,090 - 24,172,860 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000109274 ⟹ ENSRNOP00000086764
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 24,155,090 - 24,174,427 (-) Ensembl
RefSeq Acc Id:
NM_001100922 ⟹ NP_001094392
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 41,059,843 - 41,083,189 (-) NCBI mRatBN7.2 19 24,155,081 - 24,178,430 (-) NCBI Rnor_6.0 19 25,095,089 - 25,118,869 (+) NCBI Rnor_5.0 19 36,073,104 - 36,096,884 (+) NCBI RGSC_v3.4 19 25,840,795 - 25,864,786 (-) RGD Celera 19 23,703,180 - 23,726,723 (-) RGD
Sequence:
GTCGTGGCGCCGCAGCCAGCGCAGCCAGCCCCAGGGGCCGCCGCCTCCGCTGCCCAGCGCGCTCCGGGGCCGCCGGCCTCCTTAGCACCCGCCGCGTCGCAGCTCCGGGACTGGCCCCGGCCGCGACG
hide sequence
RefSeq Acc Id:
XM_006255219 ⟹ XP_006255281
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 41,059,843 - 41,079,297 (-) NCBI mRatBN7.2 19 24,155,081 - 24,174,663 (-) NCBI Rnor_6.0 19 25,099,001 - 25,117,832 (+) NCBI Rnor_5.0 19 36,073,104 - 36,096,884 (+) NCBI
Sequence:
CTACAGGCAGGGCACCCCCCAAGACTGGCAGCCACACTGGTGCAGCAGATCTTATGAGGCTTCCCAGCCACCGTAGTGCTAGTGCCCTGAGAAAGACTGAGTGATGGCTTCCAACTCCAACGATGTGA
hide sequence
RefSeq Acc Id:
NP_001094392 ⟸ NM_001100922
- UniProtKB:
Q6UA68 (UniProtKB/Swiss-Prot), P27791 (UniProtKB/Swiss-Prot), A1L1M0 (UniProtKB/TrEMBL), F7F4Z7 (UniProtKB/TrEMBL)
- Sequence:
MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWETPSQNTAQLDHFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGE
hide sequence
RefSeq Acc Id:
XP_006255281 ⟸ XM_006255219
- Peptide Label:
isoform X1
- UniProtKB:
Q6UA68 (UniProtKB/Swiss-Prot), P27791 (UniProtKB/Swiss-Prot), A0A8I6AD31 (UniProtKB/TrEMBL)
- Sequence:
MASNSNDVKEFLAKAKEDFLKKWETPSQNTAQLDHFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRI
hide sequence
Ensembl Acc Id:
ENSRNOP00000044732 ⟸ ENSRNOT00000041717
Ensembl Acc Id:
ENSRNOP00000082120 ⟸ ENSRNOT00000095425
Ensembl Acc Id:
ENSRNOP00000086764 ⟸ ENSRNOT00000109274
Ensembl Acc Id:
ENSRNOP00000076567 ⟸ ENSRNOT00000103388
Ensembl Acc Id:
ENSRNOP00000079272 ⟸ ENSRNOT00000107553
RGD ID: 13701007 Promoter ID: EPDNEW_R11531 Type: initiation region Name: Prkaca_1 Description: protein kinase cAMP-activated catalytic subunit alpha SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 19 25,095,020 - 25,095,080 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-03
Prkaca
protein kinase cAMP-activated catalytic subunit alpha
Prkaca
protein kinase, cAMP-dependent, alpha catalytic subunit
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2015-11-30
Prkaca
protein kinase, cAMP-dependent, alpha catalytic subunit
Prkaca
protein kinase, cAMP-dependent, catalytic, alpha
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Prkaca
protein kinase, cAMP-dependent, catalytic, alpha
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_function
phosphorylates serine and threonine contained within the motif RRX
724621
