Symbol:
Plcb1
Name:
phospholipase C beta 1
RGD ID:
3344
Description:
Enables calcium ion binding activity; identical protein binding activity; and phosphatidylinositol phospholipase C activity. Involved in several processes, including cellular response to glyceraldehyde; cellular response to ionomycin; and learning or memory. Predicted to be located in chromatin and nucleus. Predicted to be part of protein-containing complex. Predicted to be active in several cellular components, including GABA-ergic synapse; nuclear speck; and postsynaptic cytosol. Biomarker of myocardial infarction. Human ortholog(s) of this gene implicated in Alzheimer's disease; developmental and epileptic encephalopathy 12; and myelodysplastic syndrome. Orthologous to human PLCB1 (phospholipase C beta 1); PARTICIPATES IN acebutolol pharmacodynamics pathway; adrenergic beta receptor agonist and beta-blocker pharmacodynamics pathway; amiodarone pharmacodynamics pathway; INTERACTS WITH (+)-schisandrin B; (R)-noradrenaline; 1-(3-chlorophenyl)piperazine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1; 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-1; Phosphb; phosphoinositide phospholipase C; phosphoinositide phospholipase C-beta-1; phospholipase C, beta 1; phospholipase C, beta 1 (phosphoinositide-specific); phospholipase C-beta-1; Phospholipase C-beta1; phospholipase C-I; PLC'1; PLC-154; PLC-beta-1; PLC-I; PLCbeta1; RATPHOSPHB
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PLCB1 (phospholipase C beta 1) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Plcb1 (phospholipase C, beta 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Plcb1 (phospholipase C beta 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PLCB1 (phospholipase C beta 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PLCB1 (phospholipase C beta 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Plcb1 (phospholipase C beta 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PLCB1 (phospholipase C beta 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PLCB1 (phospholipase C beta 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Plcb1 (phospholipase C beta 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
PLCB1 (phospholipase C beta 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Plcb1 (phospholipase C, beta 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
PLC1
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER)
Drosophila melanogaster (fruit fly):
Plc21C
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
plcb1
Alliance
DIOPT (Ensembl Compara|OMA|PANTHER)
Allele / Splice:
Plcb1Tn(pb-Bhr2)1Wmukf
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 142,512,765 - 143,224,042 (+) NCBI GRCr8 mRatBN7.2 3 122,059,988 - 122,772,896 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 122,060,031 - 122,772,869 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 125,952,538 - 126,679,203 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 134,555,297 - 135,266,257 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 132,208,716 - 132,934,812 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 127,721,244 - 128,419,565 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 128,155,069 - 128,419,545 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 134,211,557 - 134,908,321 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 122,797,718 - 123,523,675 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 122,703,321 - 123,430,863 (+) NCBI Celera 3 120,808,920 - 121,513,252 (+) NCBI Celera Cytogenetic Map 3 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Plcb1 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of PLCB1 mRNA] CTD PMID:31150632 Plcb1 Rat (R)-noradrenaline increases activity EXP 6480464 Norepinephrine results in increased activity of PLCB1 protein CTD PMID:16714034 Plcb1 Rat (R)-noradrenaline multiple interactions EXP 6480464 1-(6-((3-methoxyestra-1 more ... CTD PMID:16714034 and PMID:19225867 Plcb1 Rat (R)-noradrenaline increases expression EXP 6480464 Norepinephrine results in increased expression of PLCB1 mRNA and Norepinephrine results in increased expression of PLCB1 protein CTD PMID:16714034 and PMID:19225867 Plcb1 Rat 1,2-dichloroethane decreases expression ISO Plcb1 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of PLCB1 mRNA CTD PMID:28960355 Plcb1 Rat 1-(3-chlorophenyl)piperazine increases expression EXP 6480464 1-(3-chlorophenyl)piperazine results in increased expression of PLCB1 mRNA and 1-(3-chlorophenyl)piperazine results in increased expression of PLCB1 protein CTD PMID:12527476 Plcb1 Rat 17beta-estradiol increases expression ISO PLCB1 (Homo sapiens) 6480464 Estradiol results in increased expression of PLCB1 mRNA CTD PMID:23019147 and PMID:36828454 Plcb1 Rat 17beta-estradiol decreases expression ISO Plcb1 (Mus musculus) 6480464 Estradiol results in decreased expression of PLCB1 mRNA CTD PMID:39298647 Plcb1 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression EXP 6480464 2 more ... CTD PMID:21394737 Plcb1 Rat 2,2',5,5'-tetrachlorobiphenyl increases expression ISO PLCB1 (Homo sapiens) 6480464 2 more ... CTD PMID:21703328 Plcb1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO PLCB1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of PLCB1 mRNA CTD PMID:17101203 Plcb1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PLCB1 mRNA CTD PMID:34747641 Plcb1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Plcb1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of PLCB1 mRNA CTD PMID:26290441 Plcb1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Plcb1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PLCB1 mRNA CTD PMID:21570461 and PMID:26377647 Plcb1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PLCB1 mRNA CTD PMID:21215274 Plcb1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of PLCB1 mRNA CTD PMID:22298810 and PMID:32109520 Plcb1 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of PLCB1 mRNA CTD PMID:21346803 Plcb1 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of PLCB1 mRNA CTD PMID:21346803 Plcb1 Rat 2-palmitoylglycerol increases expression ISO PLCB1 (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of PLCB1 mRNA CTD PMID:37199045 Plcb1 Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:32119087 Plcb1 Rat 3,4-dihydroxyphenylethyleneglycol increases activity EXP 6480464 3 and 4-dihydroxyphenylglycol results in increased activity of PLCB1 protein CTD PMID:15998294 Plcb1 Rat 3,4-dihydroxyphenylethyleneglycol multiple interactions EXP 6480464 [3 more ... CTD PMID:15998294 Plcb1 Rat 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione multiple interactions EXP 6480464 bisindolylmaleimide I inhibits the reaction [Norepinephrine results in increased expression of PLCB1 mRNA] and bisindolylmaleimide I inhibits the reaction [Norepinephrine results in increased expression of PLCB1 protein] CTD PMID:16714034 Plcb1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO PLCB1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of PLCB1 mRNA more ... CTD PMID:28628672 Plcb1 Rat 3H-1,2-dithiole-3-thione decreases expression EXP 6480464 1 and 2-dithiol-3-thione results in decreased expression of PLCB1 mRNA CTD PMID:19162173 Plcb1 Rat 4,4'-sulfonyldiphenol multiple interactions ISO PLCB1 (Homo sapiens) 6480464 [bisphenol S co-treated with Fulvestrant] results in increased methylation of PLCB1 gene and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of PLCB1 mRNA CTD PMID:28628672 and PMID:31601247 Plcb1 Rat 4,4'-sulfonyldiphenol increases methylation ISO PLCB1 (Homo sapiens) 6480464 bisphenol S results in increased methylation of PLCB1 gene CTD PMID:31601247 Plcb1 Rat 4,4'-sulfonyldiphenol decreases expression ISO Plcb1 (Mus musculus) 6480464 bisphenol S results in decreased expression of PLCB1 mRNA CTD PMID:39298647 Plcb1 Rat 4-hydroxyphenyl retinamide decreases expression ISO Plcb1 (Mus musculus) 6480464 Fenretinide results in decreased expression of PLCB1 mRNA CTD PMID:28973697 Plcb1 Rat 5-azacytidine decreases methylation ISO PLCB1 (Homo sapiens) 6480464 Azacitidine results in decreased methylation of PLCB1 promoter CTD PMID:19805378 Plcb1 Rat 5-azacytidine decreases response to substance ISO PLCB1 (Homo sapiens) 6480464 PLCB1 promoter modified form results in decreased susceptibility to Azacitidine CTD PMID:19805378 Plcb1 Rat 5-azacytidine increases response to substance ISO PLCB1 (Homo sapiens) 6480464 PLCB1 mRNA results in increased susceptibility to Azacitidine and PLCB1 protein results in increased susceptibility to Azacitidine CTD PMID:19805378 Plcb1 Rat 5-azacytidine increases expression ISO PLCB1 (Homo sapiens) 6480464 Azacitidine results in increased expression of PLCB1 mRNA and Azacitidine results in increased expression of PLCB1 protein CTD PMID:19805378 Plcb1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of PLCB1 mRNA CTD PMID:24780913 Plcb1 Rat 8-Br-cAMP increases expression ISO PLCB1 (Homo sapiens) 6480464 8-Bromo Cyclic Adenosine Monophosphate results in increased expression of PLCB1 mRNA CTD PMID:20147733 Plcb1 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of PLCB1 mRNA CTD PMID:31881176 Plcb1 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of PLCB1 mRNA CTD PMID:28959563 Plcb1 Rat acrylonitrile affects localization EXP 6480464 Acrylonitrile affects the localization of PLCB1 protein CTD PMID:12850505 Plcb1 Rat aflatoxin B1 affects expression ISO PLCB1 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of PLCB1 protein CTD PMID:20106945 Plcb1 Rat aflatoxin B1 affects methylation ISO PLCB1 (Homo sapiens) 6480464 Aflatoxin B1 affects the methylation of PLCB1 intron CTD PMID:30157460 Plcb1 Rat aflatoxin B1 decreases expression ISO PLCB1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of PLCB1 mRNA CTD PMID:21641981 and PMID:22100608 Plcb1 Rat aflatoxin B1 decreases expression ISO Plcb1 (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of PLCB1 mRNA CTD PMID:19770486 Plcb1 Rat Aflatoxin B2 alpha increases methylation ISO PLCB1 (Homo sapiens) 6480464 aflatoxin B2 results in increased methylation of PLCB1 intron CTD PMID:30157460 Plcb1 Rat aldehydo-D-glucose multiple interactions EXP 6480464 acetovanillone inhibits the reaction [Glucose results in increased expression of PLCB1 protein] and CAT protein inhibits the reaction [Glucose results in increased expression of PLCB1 protein] CTD PMID:20691780 Plcb1 Rat aldehydo-D-glucose increases expression EXP 6480464 Glucose results in increased expression of PLCB1 protein CTD PMID:20691780 Plcb1 Rat all-trans-retinoic acid increases expression ISO PLCB1 (Homo sapiens) 6480464 Tretinoin results in increased expression of PLCB1 mRNA CTD PMID:23724009 Plcb1 Rat all-trans-retinoic acid increases expression ISO Plcb1 (Mus musculus) 6480464 Tretinoin results in increased expression of PLCB1 mRNA CTD PMID:36189433 Plcb1 Rat all-trans-retinoic acid multiple interactions ISO Plcb1 (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of PLCB1 mRNA CTD PMID:36189433 Plcb1 Rat alprazolam decreases expression EXP 6480464 Alprazolam results in decreased expression of PLCB1 mRNA and Alprazolam results in decreased expression of PLCB1 protein CTD PMID:12527476 Plcb1 Rat aluminium trifluoride multiple interactions EXP 6480464 PLCB1 protein promotes the reaction [aluminum fluoride results in increased abundance of Inositol Phosphates] CTD PMID:11377826 Plcb1 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of PLCB1 mRNA CTD PMID:30779732 Plcb1 Rat amphotericin B increases expression ISO PLCB1 (Homo sapiens) 6480464 Amphotericin B analog results in increased expression of PLCB1 mRNA CTD PMID:28534445 Plcb1 Rat anthra[1,9-cd]pyrazol-6(2H)-one multiple interactions EXP 6480464 pyrazolanthrone inhibits the reaction [Norepinephrine results in increased expression of PLCB1 mRNA] CTD PMID:19225867 Plcb1 Rat antirheumatic drug decreases expression ISO PLCB1 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of PLCB1 mRNA CTD PMID:24449571 Plcb1 Rat apocynin multiple interactions EXP 6480464 acetovanillone inhibits the reaction [Glucose results in increased expression of PLCB1 protein] and acetovanillone inhibits the reaction [Streptozocin results in increased expression of PLCB1 protein] CTD PMID:20691780 Plcb1 Rat aristolochic acid A decreases expression ISO PLCB1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of PLCB1 mRNA CTD PMID:33212167 Plcb1 Rat arsane decreases expression ISO Plcb1 (Mus musculus) 6480464 Arsenic results in decreased expression of PLCB1 mRNA CTD PMID:19654921 Plcb1 Rat arsane multiple interactions ISO PLCB1 (Homo sapiens) 6480464 [Metals and Heavy results in increased abundance of Arsenic] which results in increased expression of PLCB1 mRNA CTD PMID:29111618 Plcb1 Rat arsenic atom decreases expression ISO Plcb1 (Mus musculus) 6480464 Arsenic results in decreased expression of PLCB1 mRNA CTD PMID:19654921 Plcb1 Rat arsenic atom multiple interactions ISO PLCB1 (Homo sapiens) 6480464 [Metals and Heavy results in increased abundance of Arsenic] which results in increased expression of PLCB1 mRNA CTD PMID:29111618 Plcb1 Rat arsenite(3-) multiple interactions ISO Plcb1 (Mus musculus) 6480464 [arsenite co-treated with Benzo(a)pyrene] results in decreased expression of PLCB1 mRNA CTD PMID:15894712 Plcb1 Rat arsenite(3-) multiple interactions ISO PLCB1 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to PLCB1 mRNA] CTD PMID:32406909 Plcb1 Rat arsenite(3-) increases expression ISO Plcb1 (Mus musculus) 6480464 arsenite results in increased expression of PLCB1 mRNA CTD PMID:15894712 and PMID:33053406 Plcb1 Rat arsenous acid decreases expression ISO Plcb1 (Mus musculus) 6480464 Arsenic Trioxide results in decreased expression of PLCB1 mRNA CTD PMID:24831965 Plcb1 Rat barium(0) multiple interactions EXP 6480464 [DRD2 protein results in increased activity of PLCB1 protein] which results in decreased transport of Barium CTD PMID:11124974 Plcb1 Rat benzo[a]pyrene decreases expression ISO Plcb1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of PLCB1 mRNA CTD PMID:15894712 and PMID:19770486 Plcb1 Rat benzo[a]pyrene increases methylation ISO PLCB1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of PLCB1 exon and Benzo(a)pyrene results in increased methylation of PLCB1 promoter CTD PMID:27901495 Plcb1 Rat benzo[a]pyrene increases expression ISO PLCB1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of PLCB1 mRNA CTD PMID:31255691 Plcb1 Rat benzo[a]pyrene decreases expression ISO PLCB1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of PLCB1 mRNA CTD PMID:20106945 more ... Plcb1 Rat benzo[a]pyrene multiple interactions ISO Plcb1 (Mus musculus) 6480464 [arsenite co-treated with Benzo(a)pyrene] results in decreased expression of PLCB1 mRNA and [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of PLCB1 mRNA CTD PMID:15894712 and PMID:27858113 Plcb1 Rat benzo[a]pyrene diol epoxide I decreases expression ISO PLCB1 (Homo sapiens) 6480464 7 more ... CTD PMID:20382639 and PMID:26238291 Plcb1 Rat benzo[b]fluoranthene increases expression ISO Plcb1 (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of PLCB1 mRNA CTD PMID:26377693 Plcb1 Rat benzo[b]fluoranthene multiple interactions ISO Plcb1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of PLCB1 mRNA CTD PMID:27858113 Plcb1 Rat benzo[e]pyrene increases methylation ISO PLCB1 (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of PLCB1 intron CTD PMID:30157460 Plcb1 Rat beta-lapachone decreases expression ISO PLCB1 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of PLCB1 mRNA CTD PMID:38218311 Plcb1 Rat bis(2-chloroethyl) sulfide affects expression EXP 6480464 Mustard Gas affects the expression of PLCB1 mRNA CTD PMID:15651846 Plcb1 Rat bis(2-ethylhexyl) phthalate decreases methylation ISO Plcb1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased methylation of PLCB1 intron CTD PMID:32864567 Plcb1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Plcb1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of PLCB1 mRNA CTD PMID:34319233 Plcb1 Rat bisphenol A decreases expression ISO Plcb1 (Mus musculus) 6480464 bisphenol A results in decreased expression of PLCB1 mRNA CTD PMID:26063408 Plcb1 Rat bisphenol A decreases methylation ISO PLCB1 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of PLCB1 gene CTD PMID:31601247 Plcb1 Rat bisphenol A increases expression ISO PLCB1 (Homo sapiens) 6480464 bisphenol A results in increased expression of PLCB1 mRNA CTD PMID:36828454 Plcb1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PLCB1 mRNA CTD PMID:32145629 Plcb1 Rat bisphenol A multiple interactions ISO PLCB1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] affects the methylation of PLCB1 gene and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of PLCB1 mRNA CTD PMID:28628672 and PMID:31601247 Plcb1 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of PLCB1 gene CTD PMID:28505145 Plcb1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PLCB1 mRNA CTD PMID:25181051 more ... Plcb1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Testosterone] results in increased expression of PLCB1 mRNA CTD PMID:26496021 Plcb1 Rat Bisphenol A diglycidyl ether affects splicing ISO Plcb1 (Mus musculus) 6480464 bisphenol A diglycidyl ether affects the splicing of PLCB1 mRNA CTD PMID:36464114 Plcb1 Rat bisphenol AF affects splicing ISO Plcb1 (Mus musculus) 6480464 bisphenol AF affects the splicing of PLCB1 mRNA CTD PMID:36464114 Plcb1 Rat bisphenol AF affects expression ISO Plcb1 (Mus musculus) 6480464 bisphenol AF affects the expression of PLCB1 mRNA and bisphenol AF affects the expression of PLCB1 protein CTD PMID:31981723 Plcb1 Rat bisphenol F multiple interactions ISO PLCB1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of PLCB1 mRNA CTD PMID:28628672 Plcb1 Rat buspirone decreases expression EXP 6480464 Buspirone results in decreased expression of PLCB1 mRNA and Buspirone results in decreased expression of PLCB1 protein CTD PMID:12527476 Plcb1 Rat butanal decreases expression ISO PLCB1 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of PLCB1 mRNA CTD PMID:26079696 Plcb1 Rat C60 fullerene increases expression EXP 6480464 fullerene C60 results in increased expression of PLCB1 mRNA CTD PMID:19167457 Plcb1 Rat cadmium dichloride decreases expression ISO PLCB1 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of PLCB1 mRNA CTD PMID:38382870 Plcb1 Rat cadmium dichloride increases expression ISO PLCB1 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of PLCB1 mRNA CTD PMID:38568856 Plcb1 Rat caffeine multiple interactions EXP 6480464 Caffeine inhibits the reaction [3 more ... CTD PMID:15998294 Plcb1 Rat caffeine decreases phosphorylation ISO PLCB1 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of PLCB1 protein CTD PMID:35688186 Plcb1 Rat caffeine decreases expression EXP 6480464 Caffeine results in decreased expression of PLCB1 protein CTD PMID:15998294 Plcb1 Rat calcitriol increases response to substance EXP 6480464 PLCB1 protein results in increased susceptibility to Calcitriol CTD PMID:12798493 Plcb1 Rat calcitriol increases activity EXP 6480464 Calcitriol results in increased activity of PLCB1 protein CTD PMID:12798493 Plcb1 Rat Candesartan cilexetil multiple interactions EXP 6480464 candesartan cilexetil inhibits the reaction [Methamphetamine results in increased expression of PLCB1 protein] CTD PMID:33421459 Plcb1 Rat carbachol multiple interactions EXP 6480464 PLCB1 protein inhibits the reaction [Carbachol results in increased abundance of Inositol Phosphates] CTD PMID:11377826 Plcb1 Rat carbon nanotube decreases expression ISO Plcb1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Plcb1 Rat choline multiple interactions ISO Plcb1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of PLCB1 mRNA CTD PMID:20938992 Plcb1 Rat chromium(6+) multiple interactions ISO PLCB1 (Homo sapiens) 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in decreased expression of PLCB1 mRNA CTD PMID:38479592 Plcb1 Rat chrysene multiple interactions ISO Plcb1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of PLCB1 mRNA CTD PMID:27858113 Plcb1 Rat cisplatin decreases expression EXP 6480464 Cisplatin results in decreased expression of PLCB1 mRNA CTD PMID:22023808 Plcb1 Rat clofibrate increases expression ISO Plcb1 (Mus musculus) 6480464 Clofibrate results in increased expression of PLCB1 mRNA CTD PMID:17585979 Plcb1 Rat clozapine increases expression ISO Plcb1 (Mus musculus) 6480464 Clozapine results in increased expression of PLCB1 mRNA CTD PMID:16465460 Plcb1 Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of PLCB1 mRNA CTD PMID:24386269 Plcb1 Rat cobalt dichloride decreases expression ISO PLCB1 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of PLCB1 mRNA CTD PMID:19320972 Plcb1 Rat cocaine increases expression ISO Plcb1 (Mus musculus) 6480464 Cocaine results in increased expression of PLCB1 mRNA CTD PMID:18355967 Plcb1 Rat copper atom decreases expression EXP 6480464 Copper results in decreased expression of PLCB1 mRNA CTD PMID:22465980 Plcb1 Rat copper(0) decreases expression EXP 6480464 Copper results in decreased expression of PLCB1 mRNA CTD PMID:22465980 Plcb1 Rat copper(II) sulfate increases expression ISO PLCB1 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of PLCB1 mRNA CTD PMID:19549813 Plcb1 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of PLCB1 mRNA CTD PMID:26577399 Plcb1 Rat cyclosporin A decreases expression ISO Plcb1 (Mus musculus) 6480464 Cyclosporine results in decreased expression of PLCB1 mRNA CTD PMID:19770486 Plcb1 Rat D-glucose multiple interactions EXP 6480464 acetovanillone inhibits the reaction [Glucose results in increased expression of PLCB1 protein] and CAT protein inhibits the reaction [Glucose results in increased expression of PLCB1 protein] CTD PMID:20691780 Plcb1 Rat D-glucose increases expression EXP 6480464 Glucose results in increased expression of PLCB1 protein CTD PMID:20691780 Plcb1 Rat D-glyceraldehyde multiple interactions EXP 6480464 PLCB1 protein promotes the reaction [Glyceraldehyde results in increased abundance of Inositol Phosphates] CTD PMID:11377826 Plcb1 Rat desipramine decreases expression EXP 6480464 Desipramine results in decreased expression of PLCB1 mRNA and Desipramine results in decreased expression of PLCB1 protein CTD PMID:12527476 Plcb1 Rat dexamethasone multiple interactions ISO PLCB1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of PLCB1 mRNA more ... CTD PMID:28628672 Plcb1 Rat diarsenic trioxide decreases expression ISO Plcb1 (Mus musculus) 6480464 Arsenic Trioxide results in decreased expression of PLCB1 mRNA CTD PMID:24831965 Plcb1 Rat diazinon affects expression EXP 6480464 Diazinon affects the expression of PLCB1 mRNA CTD PMID:22546817 Plcb1 Rat diazinon increases methylation ISO PLCB1 (Homo sapiens) 6480464 Diazinon results in increased methylation of PLCB1 gene CTD PMID:22964155 Plcb1 Rat dibenzo[a,l]pyrene decreases expression ISO PLCB1 (Homo sapiens) 6480464 dibenzo(a and l)pyrene results in decreased expression of PLCB1 mRNA CTD PMID:31255691 Plcb1 Rat Dibutyl phosphate affects expression ISO PLCB1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of PLCB1 mRNA CTD PMID:37042841 Plcb1 Rat dibutyl phthalate increases expression ISO Plcb1 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of PLCB1 mRNA CTD PMID:21266533 Plcb1 Rat dieldrin affects expression EXP 6480464 Dieldrin affects the expression of PLCB1 mRNA CTD PMID:22546817 Plcb1 Rat diethylstilbestrol increases expression ISO PLCB1 (Homo sapiens) 6480464 Diethylstilbestrol results in increased expression of PLCB1 mRNA CTD PMID:19371625 Plcb1 Rat dioxygen increases expression ISO Plcb1 (Mus musculus) 6480464 Oxygen deficiency results in increased expression of PLCB1 mRNA CTD PMID:24205000 Plcb1 Rat dioxygen multiple interactions ISO Plcb1 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of PLCB1 mRNA CTD PMID:30529165 Plcb1 Rat dioxygen affects methylation ISO Plcb1 (Mus musculus) 6480464 Oxygen deficiency affects the methylation of PLCB1 promoter CTD PMID:24205000 Plcb1 Rat doxorubicin decreases expression ISO PLCB1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of PLCB1 mRNA CTD PMID:29803840 Plcb1 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of PLCB1 mRNA CTD PMID:29391264 Plcb1 Rat endosulfan affects expression EXP 6480464 Endosulfan affects the expression of PLCB1 mRNA CTD PMID:31464424 Plcb1 Rat epoxiconazole decreases expression ISO Plcb1 (Mus musculus) 6480464 epoxiconazole results in decreased expression of PLCB1 mRNA CTD PMID:35436446 Plcb1 Rat ethanol affects splicing ISO Plcb1 (Mus musculus) 6480464 Ethanol affects the splicing of PLCB1 mRNA CTD PMID:30319688 Plcb1 Rat ethyl methanesulfonate decreases expression ISO PLCB1 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in decreased expression of PLCB1 mRNA CTD PMID:23649840 Plcb1 Rat fipronil increases expression EXP 6480464 fipronil results in increased expression of PLCB1 mRNA CTD PMID:31881178 Plcb1 Rat fluoxetine decreases expression EXP 6480464 Fluoxetine results in decreased expression of PLCB1 mRNA and Fluoxetine results in decreased expression of PLCB1 protein CTD PMID:12527476 Plcb1 Rat folic acid multiple interactions ISO Plcb1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of PLCB1 mRNA CTD PMID:20938992 Plcb1 Rat formaldehyde decreases expression ISO PLCB1 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of PLCB1 mRNA CTD PMID:23649840 Plcb1 Rat fulvestrant multiple interactions ISO PLCB1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] affects the methylation of PLCB1 gene and [bisphenol S co-treated with Fulvestrant] results in increased methylation of PLCB1 gene CTD PMID:31601247 Plcb1 Rat genistein increases expression ISO PLCB1 (Homo sapiens) 6480464 Genistein results in increased expression of PLCB1 mRNA CTD PMID:19371625 and PMID:23019147 Plcb1 Rat genistein increases expression ISO Plcb1 (Mus musculus) 6480464 Genistein results in increased expression of PLCB1 mRNA CTD PMID:32186404 Plcb1 Rat glucose increases expression EXP 6480464 Glucose results in increased expression of PLCB1 protein CTD PMID:20691780 Plcb1 Rat glucose multiple interactions EXP 6480464 acetovanillone inhibits the reaction [Glucose results in increased expression of PLCB1 protein] and CAT protein inhibits the reaction [Glucose results in increased expression of PLCB1 protein] CTD PMID:20691780 Plcb1 Rat glyceraldehyde multiple interactions EXP 6480464 PLCB1 protein promotes the reaction [Glyceraldehyde results in increased abundance of Inositol Phosphates] CTD PMID:11377826 Plcb1 Rat glyphosate decreases expression ISO PLCB1 (Homo sapiens) 6480464 Glyphosate results in decreased expression of PLCB1 mRNA CTD PMID:31295307 Plcb1 Rat guanosine 5'-[gamma-thio]triphosphate multiple interactions EXP 6480464 [3 more ... CTD PMID:15998294 Plcb1 Rat guanosine 5'-[gamma-thio]triphosphate increases activity EXP 6480464 Guanosine 5'-O-(3-Thiotriphosphate) results in increased activity of PLCB1 protein CTD PMID:15998294 Plcb1 Rat indometacin multiple interactions ISO PLCB1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of PLCB1 mRNA more ... CTD PMID:28628672 Plcb1 Rat ionomycin multiple interactions EXP 6480464 PLCB1 protein promotes the reaction [Ionomycin results in increased abundance of Inositol Phosphates] CTD PMID:11377826 Plcb1 Rat irinotecan decreases expression EXP 6480464 Irinotecan results in decreased expression of PLCB1 mRNA CTD PMID:20097248 Plcb1 Rat L-methionine multiple interactions ISO Plcb1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of PLCB1 mRNA CTD PMID:20938992 Plcb1 Rat lead(0) affects expression ISO PLCB1 (Homo sapiens) 6480464 Lead affects the expression of PLCB1 mRNA CTD PMID:28903495 Plcb1 Rat methamphetamine increases expression ISO PLCB1 (Homo sapiens) 6480464 Methamphetamine results in increased expression of PLCB1 mRNA and Methamphetamine results in increased expression of PLCB1 protein CTD PMID:33421459 Plcb1 Rat methamphetamine increases expression EXP 6480464 Methamphetamine results in increased expression of PLCB1 protein CTD PMID:33421459 Plcb1 Rat methamphetamine multiple interactions EXP 6480464 candesartan cilexetil inhibits the reaction [Methamphetamine results in increased expression of PLCB1 protein] CTD PMID:33421459 Plcb1 Rat methamphetamine multiple interactions ISO PLCB1 (Homo sapiens) 6480464 1-(6-((3-methoxyestra-1 more ... CTD PMID:33421459 Plcb1 Rat methapyrilene increases methylation ISO PLCB1 (Homo sapiens) 6480464 Methapyrilene results in increased methylation of PLCB1 intron CTD PMID:30157460 Plcb1 Rat methidathion decreases expression ISO Plcb1 (Mus musculus) 6480464 methidathion results in decreased expression of PLCB1 mRNA CTD PMID:34813904 Plcb1 Rat methyl methanesulfonate decreases expression ISO PLCB1 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of PLCB1 mRNA CTD PMID:23649840 Plcb1 Rat methylmercury chloride decreases expression ISO PLCB1 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of PLCB1 mRNA CTD PMID:28001369 Plcb1 Rat mono(2-ethylhexyl) phthalate multiple interactions ISO Plcb1 (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of PLCB1 mRNA CTD PMID:36189433 Plcb1 Rat morphine affects response to substance ISO Plcb1 (Mus musculus) 6480464 PLCB1 protein affects the susceptibility to Morphine CTD PMID:16405873 Plcb1 Rat N-nitrosodiethylamine decreases expression ISO PLCB1 (Homo sapiens) 6480464 Diethylnitrosamine results in decreased expression of PLCB1 mRNA CTD PMID:21527772 Plcb1 Rat N-nitrosomorpholine decreases expression EXP 6480464 N-nitrosomorpholine results in decreased expression of PLCB1 mRNA CTD PMID:19716841 Plcb1 Rat N-Nitrosopyrrolidine decreases expression ISO PLCB1 (Homo sapiens) 6480464 N-Nitrosopyrrolidine results in decreased expression of PLCB1 mRNA CTD PMID:32234424 Plcb1 Rat nickel atom increases expression ISO Plcb1 (Mus musculus) 6480464 Nickel results in increased expression of PLCB1 mRNA CTD PMID:18922574 Plcb1 Rat nickel atom decreases expression ISO PLCB1 (Homo sapiens) 6480464 Nickel results in decreased expression of PLCB1 mRNA CTD PMID:25583101 Plcb1 Rat nickel dichloride affects expression EXP 6480464 nickel chloride affects the expression of PLCB1 mRNA CTD PMID:22546817 Plcb1 Rat O-methyleugenol decreases expression ISO PLCB1 (Homo sapiens) 6480464 methyleugenol results in decreased expression of PLCB1 mRNA CTD PMID:32234424 Plcb1 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of PLCB1 mRNA CTD PMID:25729387 Plcb1 Rat oxytocin affects localization ISO Plcb1 (Mus musculus) 6480464 Oxytocin affects the localization of PLCB1 protein CTD PMID:11579162 Plcb1 Rat ozone multiple interactions ISO Plcb1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of PLCB1 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of PLCB1 mRNA CTD PMID:34911549 Plcb1 Rat paracetamol decreases expression ISO PLCB1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of PLCB1 mRNA CTD PMID:29067470 Plcb1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of PLCB1 mRNA CTD PMID:33387578 Plcb1 Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of PLCB1 mRNA CTD PMID:32680482 Plcb1 Rat perfluorooctanoic acid increases expression ISO Plcb1 (Mus musculus) 6480464 perfluorooctanoic acid results in increased expression of PLCB1 mRNA CTD PMID:17681415 Plcb1 Rat Phenelzine decreases expression EXP 6480464 Phenelzine results in decreased expression of PLCB1 mRNA and Phenelzine results in decreased expression of PLCB1 protein CTD PMID:12527476 Plcb1 Rat phenylephrine increases expression EXP 6480464 Phenylephrine results in increased expression of PLCB1 mRNA CTD PMID:16714034 Plcb1 Rat phenylpropanolamine increases expression ISO Plcb1 (Mus musculus) 6480464 Phenylpropanolamine results in increased expression of PLCB1 mRNA CTD PMID:16465460 Plcb1 Rat PhIP decreases expression EXP 6480464 2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in decreased expression of PLCB1 mRNA CTD PMID:15059925 Plcb1 Rat pirinixic acid increases expression ISO Plcb1 (Mus musculus) 6480464 pirinixic acid results in increased expression of PLCB1 mRNA CTD PMID:18301758 Plcb1 Rat poly(I:C) increases expression ISO Plcb1 (Mus musculus) 6480464 Poly I-C results in increased expression of PLCB1 mRNA CTD PMID:24889602 Plcb1 Rat prazosin multiple interactions EXP 6480464 Prazosin inhibits the reaction [Norepinephrine results in increased expression of and results in increased activity of PLCB1 protein] more ... CTD PMID:16714034 and PMID:19225867 Plcb1 Rat progesterone decreases expression ISO PLCB1 (Homo sapiens) 6480464 Progesterone results in decreased expression of PLCB1 mRNA CTD PMID:20864642 Plcb1 Rat quercetin decreases expression ISO PLCB1 (Homo sapiens) 6480464 Quercetin results in decreased expression of PLCB1 mRNA CTD PMID:21632981 Plcb1 Rat silicon dioxide decreases expression ISO PLCB1 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of PLCB1 mRNA CTD PMID:25895662 Plcb1 Rat silicon dioxide decreases expression EXP 6480464 Silicon Dioxide results in decreased expression of PLCB1 mRNA CTD PMID:22431001 and PMID:32721576 Plcb1 Rat sodium arsenite increases expression ISO PLCB1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of PLCB1 mRNA CTD PMID:38568856 Plcb1 Rat sodium dichromate affects expression EXP 6480464 sodium bichromate affects the expression of PLCB1 mRNA CTD PMID:22110744 Plcb1 Rat sodium dichromate decreases expression EXP 6480464 sodium bichromate results in decreased expression of PLCB1 mRNA CTD PMID:25993096 Plcb1 Rat streptozocin multiple interactions EXP 6480464 acetovanillone inhibits the reaction [Streptozocin results in increased expression of PLCB1 protein] and CAT protein inhibits the reaction [Streptozocin results in increased expression of PLCB1 protein] CTD PMID:20691780 Plcb1 Rat streptozocin increases expression EXP 6480464 Streptozocin results in increased expression of PLCB1 protein CTD PMID:20691780 Plcb1 Rat temozolomide increases expression ISO PLCB1 (Homo sapiens) 6480464 Temozolomide results in increased expression of PLCB1 mRNA CTD PMID:31758290 Plcb1 Rat testosterone multiple interactions EXP 6480464 [bisphenol A co-treated with Testosterone] results in increased expression of PLCB1 mRNA CTD PMID:26496021 Plcb1 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of PLCB1 mRNA] CTD PMID:31150632 Plcb1 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of PLCB1 mRNA CTD PMID:31150632 Plcb1 Rat tetraphene decreases expression ISO Plcb1 (Mus musculus) 6480464 benz(a)anthracene results in decreased expression of PLCB1 mRNA CTD PMID:26377693 Plcb1 Rat tetraphene multiple interactions ISO Plcb1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of PLCB1 mRNA CTD PMID:27858113 Plcb1 Rat theophylline multiple interactions EXP 6480464 Theophylline inhibits the reaction [3 more ... CTD PMID:15998294 Plcb1 Rat theophylline decreases expression EXP 6480464 Theophylline results in decreased expression of PLCB1 protein CTD PMID:15998294 Plcb1 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of PLCB1 mRNA CTD PMID:23411599 and PMID:34492290 Plcb1 Rat titanium dioxide decreases expression ISO Plcb1 (Mus musculus) 6480464 titanium dioxide results in decreased expression of PLCB1 mRNA CTD PMID:23557971 Plcb1 Rat titanium dioxide decreases methylation ISO Plcb1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of PLCB1 gene CTD PMID:35295148 Plcb1 Rat toluene affects expression EXP 6480464 Toluene affects the expression of PLCB1 mRNA CTD PMID:21827849 Plcb1 Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of PLCB1 mRNA CTD PMID:25729387 Plcb1 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of PLCB1 mRNA CTD PMID:25729387 Plcb1 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of PLCB1 mRNA CTD PMID:33387578 Plcb1 Rat trichostatin A increases expression ISO PLCB1 (Homo sapiens) 6480464 trichostatin A results in increased expression of PLCB1 mRNA CTD PMID:24935251 Plcb1 Rat trichostatin A decreases expression ISO PLCB1 (Homo sapiens) 6480464 trichostatin A results in decreased expression of PLCB1 mRNA CTD PMID:28542535 Plcb1 Rat U-73122 multiple interactions EXP 6480464 1-(6-((3-methoxyestra-1 more ... CTD PMID:16714034 Plcb1 Rat U-73122 multiple interactions ISO PLCB1 (Homo sapiens) 6480464 1-(6-((3-methoxyestra-1 more ... CTD PMID:33421459 Plcb1 Rat valproic acid increases methylation ISO PLCB1 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of PLCB1 gene CTD PMID:29154799 Plcb1 Rat valproic acid decreases expression ISO PLCB1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of PLCB1 mRNA CTD PMID:28001369 Plcb1 Rat valproic acid increases expression ISO PLCB1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of PLCB1 mRNA CTD PMID:23179753 more ... Plcb1 Rat valproic acid affects expression ISO PLCB1 (Homo sapiens) 6480464 Valproic Acid affects the expression of PLCB1 mRNA CTD PMID:25979313 Plcb1 Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of PLCB1 gene CTD PMID:31682807 Plcb1 Rat zearalenone increases expression ISO PLCB1 (Homo sapiens) 6480464 Zearalenone results in increased expression of PLCB1 mRNA CTD PMID:19371625 and PMID:36828454 Plcb1 Rat zoledronic acid decreases expression ISO PLCB1 (Homo sapiens) 6480464 zoledronic acid results in decreased expression of PLCB1 mRNA CTD PMID:24714768
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
Plcb1 Rat calcium ion binding enables IEA InterPro:IPR014815 and InterPro:IPR016280 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Plcb1 Rat calcium ion binding enables IDA 8554253 PMID:11377826 BHF-UCL Plcb1 Rat calcium ion binding enables IEA UniRule:UR000954762 1600115 GO_REF:0000104 UniProt GO_REF:0000104 Plcb1 Rat calmodulin binding enables IEA UniProtKB:Q9NQ66 and ensembl:ENSP000003381851600115 GO_REF:0000107 Ensembl GO_REF:0000107 Plcb1 Rat calmodulin binding enables IBA PANTHER:PTN002569936 and UniProtKB:Q9NQ66 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Plcb1 Rat calmodulin binding enables ISO PLCB1 (Homo sapiens) 1624291 PMID:12821674 RGD PMID:12821674 Plcb1 Rat enzyme binding enables ISO PLCB1 (Homo sapiens) 1624291 UniProtKB:P52824 and PMID:12799190 RGD PMID:12799190 Plcb1 Rat enzyme binding enables IEA UniProtKB:Q9NQ66 and ensembl:ENSP000003381851600115 GO_REF:0000107 Ensembl GO_REF:0000107 Plcb1 Rat GTPase activator activity enables IEA UniProtKB:Q9NQ66 and ensembl:ENSP000003381851600115 GO_REF:0000107 Ensembl GO_REF:0000107 Plcb1 Rat GTPase activator activity enables ISO PLCB1 (Homo sapiens) 1624291 PMID:1322796 RGD PMID:1322796 Plcb1 Rat hydrolase activity enables IEA UniProtKB-KW:KW-0378 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Plcb1 Rat identical protein binding IPI Plcb1 (Rattus norvegicus) 2314506 homodimerization RGD Plcb1 Rat identical protein binding enables IPI UniProtKB:P10687 2314506 PMID:16763092 BHF-UCL Plcb1 Rat lamin binding enables ISO Plcb1 (Mus musculus) 1624291 UniProtKB:P14733 and PMID:19028838 RGD PMID:19028838 Plcb1 Rat lamin binding enables IEA UniProtKB:Q9Z1B3 and ensembl:ENSMUSP00000105743 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Plcb1 Rat metal ion binding enables IEA UniProtKB-KW:KW-0479 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Plcb1 Rat phosphatidylinositol-4,5-bisphosphate binding enables ISO PLCB1 (Homo sapiens) 1624291 PMID:12799190 RGD PMID:12799190 Plcb1 Rat phosphatidylinositol-4,5-bisphosphate binding enables IEA UniProtKB:Q9NQ66 and ensembl:ENSP000003381851600115 GO_REF:0000107 Ensembl GO_REF:0000107 Plcb1 Rat phosphatidylinositol-4,5-bisphosphate phospholipase C activity IDA 1582559 RGD Plcb1 Rat phosphatidylinositol-4,5-bisphosphate phospholipase C activity enables IEA UniProtKB:Q9Z1B3 and ensembl:ENSMUSP00000105743 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Plcb1 Rat phosphatidylinositol-4,5-bisphosphate phospholipase C activity enables ISO Plcb1 (Mus musculus) 1624291 PMID:9762362 RGD PMID:9762362 Plcb1 Rat phosphatidylinositol-4,5-bisphosphate phospholipase C activity enables IBA FB:FBgn0262738 more ... 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Plcb1 Rat phosphatidylinositol-4,5-bisphosphate phospholipase C activity enables IEA InterPro:IPR001711 more ... 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Plcb1 Rat phosphatidylinositol-4,5-bisphosphate phospholipase C activity enables IEA UniProtKB:Q9NQ66 and ensembl:ENSP000003381851600115 GO_REF:0000107 Ensembl GO_REF:0000107 Plcb1 Rat phosphatidylinositol-4,5-bisphosphate phospholipase C activity enables ISO PLCB1 (Homo sapiens) 1624291 PMID:9188725 RGD PMID:9188725 Plcb1 Rat phosphatidylinositol-4,5-bisphosphate phospholipase C activity enables IEA UniRule:UR000954762 1600115 GO_REF:0000104 UniProt GO_REF:0000104 Plcb1 Rat phosphatidylinositol-4,5-bisphosphate phospholipase C activity enables IEA EC:3.1.4.11 1600115 GO_REF:0000003 UniProt GO_REF:0000003 Plcb1 Rat phosphatidylinositol-4,5-bisphosphate phospholipase C activity enables IEA RHEA:33179 1600115 GO_REF:0000116 RHEA GO_REF:0000116 Plcb1 Rat phosphoric diester hydrolase activity enables IEA InterPro:IPR017946 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Plcb1 Rat protein binding enables ISO PLCB1 (Homo sapiens) 1624291 UniProtKB:P56545 more ... RGD PMID:25416956 Plcb1 Rat protein binding enables ISO Plcb1 (Mus musculus) 1624291 UniProtKB:P84104 and PMID:17022104 RGD PMID:17022104 Plcb1 Rat protein binding enables IPI UniProtKB:Q925B3 632429 PMID:11161216 UniProt
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(+)-schisandrin B (EXP) (R)-noradrenaline (EXP) 1,2-dichloroethane (ISO) 1-(3-chlorophenyl)piperazine (EXP) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 2-palmitoylglycerol (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3,4-dihydroxyphenylethyleneglycol (EXP) 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3H-1,2-dithiole-3-thione (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 5-azacytidine (ISO) 6-propyl-2-thiouracil (EXP) 8-Br-cAMP (ISO) acetamide (EXP) acrylamide (EXP) acrylonitrile (EXP) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) aldehydo-D-glucose (EXP) all-trans-retinoic acid (ISO) alprazolam (EXP) aluminium trifluoride (EXP) amphetamine (EXP) amphotericin B (ISO) anthra[1,9-cd]pyrazol-6(2H)-one (EXP) antirheumatic drug (ISO) apocynin (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) barium(0) (EXP) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) benzo[b]fluoranthene (ISO) benzo[e]pyrene (ISO) beta-lapachone (ISO) bis(2-chloroethyl) sulfide (EXP) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) Bisphenol A diglycidyl ether (ISO) bisphenol AF (ISO) bisphenol F (ISO) buspirone (EXP) butanal (ISO) C60 fullerene (EXP) cadmium dichloride (ISO) caffeine (EXP,ISO) calcitriol (EXP) Candesartan cilexetil (EXP) carbachol (EXP) carbon nanotube (ISO) choline (ISO) chromium(6+) (ISO) chrysene (ISO) cisplatin (EXP) clofibrate (ISO) clozapine (ISO) cobalt dichloride (EXP,ISO) cocaine (ISO) copper atom (EXP) copper(0) (EXP) copper(II) sulfate (ISO) Cuprizon (EXP) cyclosporin A (ISO) D-glucose (EXP) D-glyceraldehyde (EXP) desipramine (EXP) dexamethasone (ISO) diarsenic trioxide (ISO) diazinon (EXP,ISO) dibenzo[a,l]pyrene (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) dieldrin (EXP) diethylstilbestrol (ISO) dioxygen (ISO) doxorubicin (ISO) endosulfan (EXP) epoxiconazole (ISO) ethanol (ISO) ethyl methanesulfonate (ISO) fipronil (EXP) fluoxetine (EXP) folic acid (ISO) formaldehyde (ISO) fulvestrant (ISO) genistein (ISO) glucose (EXP) glyceraldehyde (EXP) glyphosate (ISO) guanosine 5'-[gamma-thio]triphosphate (EXP) indometacin (ISO) ionomycin (EXP) irinotecan (EXP) L-methionine (ISO) lead(0) (ISO) methamphetamine (EXP,ISO) methapyrilene (ISO) methidathion (ISO) methyl methanesulfonate (ISO) methylmercury chloride (ISO) mono(2-ethylhexyl) phthalate (ISO) morphine (ISO) N-nitrosodiethylamine (ISO) N-nitrosomorpholine (EXP) N-Nitrosopyrrolidine (ISO) nickel atom (ISO) nickel dichloride (EXP) O-methyleugenol (ISO) oxaliplatin (EXP) oxytocin (ISO) ozone (ISO) paracetamol (EXP,ISO) paraquat (EXP) perfluorooctanoic acid (ISO) Phenelzine (EXP) phenylephrine (EXP) phenylpropanolamine (ISO) PhIP (EXP) pirinixic acid (ISO) poly(I:C) (ISO) prazosin (EXP) progesterone (ISO) quercetin (ISO) silicon dioxide (EXP,ISO) sodium arsenite (ISO) sodium dichromate (EXP) streptozocin (EXP) temozolomide (ISO) testosterone (EXP) tetrachloromethane (EXP) tetraphene (ISO) theophylline (EXP) thioacetamide (EXP) titanium dioxide (ISO) toluene (EXP) topotecan (EXP) trichloroethene (EXP) trichostatin A (ISO) U-73122 (EXP,ISO) valproic acid (ISO) vinclozolin (EXP) zearalenone (ISO) zoledronic acid (ISO)
Biological Process
activation of meiosis involved in egg activation (IEA,ISO,ISS) cellular response to fluoride (IDA) cellular response to glyceraldehyde (IDA) cellular response to ionomycin (IDA) cellular response to vasopressin (IDA) cerebral cortex development (IEA,ISO,ISS) fat cell differentiation (IEA,ISO) G protein-coupled acetylcholine receptor signaling pathway (IEA,ISO) G protein-coupled receptor signaling pathway (IBA) G2/M transition of mitotic cell cycle (IEA,ISO) glutamate receptor signaling pathway (IEA,ISO,ISS) inositol trisphosphate metabolic process (IDA) insulin-like growth factor receptor signaling pathway (IEA,ISO,ISS) interleukin-1-mediated signaling pathway (IEA,ISO) interleukin-12-mediated signaling pathway (IEA,ISO) interleukin-15-mediated signaling pathway (IEA,ISO) intracellular signal transduction (IEA) learning (IEP) ligand-gated ion channel signaling pathway (IEA,ISO) lipid catabolic process (IEA) lipid metabolic process (IEA) memory (IBA,IEA,IEP,ISO) negative regulation of DNA-templated transcription (IEA,ISO,ISS) negative regulation of monocyte extravasation (IEA,ISO,ISS) phosphatidylinositol catabolic process (IDA) phosphatidylinositol metabolic process (IBA,IEA,IEP,ISO) phosphatidylinositol-mediated signaling (IBA) phospholipase C-activating G protein-coupled acetylcholine receptor signaling pathway (IEA,ISO) phospholipase C-activating G protein-coupled receptor signaling pathway (IEA,ISO) positive regulation of acrosome reaction (IEA,ISO) positive regulation of developmental growth (IEA,ISO,ISS) positive regulation of DNA-templated transcription (IEA,ISO,ISS) positive regulation of embryonic development (IEA,ISO) positive regulation of G1/S transition of mitotic cell cycle (IEA,ISO,ISS) positive regulation of glycoprotein biosynthetic process (ISO,ISS) positive regulation of insulin secretion (IEA,ISO) positive regulation of interleukin-12 production (IEA,ISO,ISS) positive regulation of JNK cascade (IEA,ISO) positive regulation of myoblast differentiation (IEA,ISO,ISS) postsynaptic modulation of chemical synaptic transmission (IEA,ISO) regulation of establishment of endothelial barrier (IEA,ISO) regulation of fertilization (IEA,ISO) regulation of G protein-coupled receptor signaling pathway (IEA,ISO,ISS) regulation of retrograde trans-synaptic signaling by endocanabinoid (IEA,ISO) release of sequestered calcium ion into cytosol (IBA) response to monosaccharide (IDA) response to peptide hormone (IDA) signal transduction (IEA)
Cellular Component
chromatin (IEA,ISO) cytoplasm (IBA,IEA,ISO,ISS) GABA-ergic synapse (IEA,ISO) glutamatergic synapse (IEA,ISO) membrane (IEA) nuclear membrane (IEA) nuclear speck (IBA,IEA,ISO,ISS) nucleus (IEA,ISO,ISS) postsynaptic cytosol (IEA,ISO) protein-containing complex (IEA,ISO)
Molecular Function
calcium ion binding (IDA,IEA) calmodulin binding (IBA,IEA,ISO) enzyme binding (IEA,ISO) GTPase activator activity (IEA,ISO) hydrolase activity (IEA) identical protein binding (IPI) lamin binding (IEA,ISO) metal ion binding (IEA) phosphatidylinositol-4,5-bisphosphate binding (IEA,ISO) phosphatidylinositol-4,5-bisphosphate phospholipase C activity (IBA,IDA,IEA,ISO) phosphoric diester hydrolase activity (IEA) protein binding (IPI,ISO)
1.
Two forms of phospholipase C-beta 1 generated by alternative splicing.
Bahk YY, etal., J Biol Chem 1994 Mar 18;269(11):8240-5.
2.
G-protein-activated phospholipase C-beta, new partners for cell polarity proteins Par3 and Par6.
Cai Y, etal., Oncogene. 2005 Jun 16;24(26):4293-300.
3.
Phosphoinositide phospholipase Cbeta1 (PI-PLCbeta1) gene in myelodysplastic syndromes and cytogenetically normal acute myeloid leukemia: not a deletion, but increased PI-PLCbeta1 expression is an independent prognostic factor.
Damm F, etal., J Clin Oncol. 2010 Aug 1;28(22):e384-7; author reply e388-9. doi: 10.1200/JCO.2010.28.6971. Epub 2010 Jun 1.
4.
Stimulation of 5-HT(2) receptors in prefrontal pyramidal neurons inhibits Ca(v)1.2 L type Ca(2+) currents via a PLCbeta/IP3/calcineurin signaling cascade.
Day M, etal., J Neurophysiol 2002 May;87(5):2490-504.
5.
Metabotropic glutamate receptor 5 (mGluR5)-mediated phosphoinositide hydrolysis and NMDA-potentiating effects are blunted in the striatum of aged rats: a possible additional mechanism in striatal senescence.
Domenici MR, etal., Eur J Neurosci 2003 May;17(10):2047-55.
6.
Stimulation of phospholipase Cbeta by membrane interactions, interdomain movement, and G protein binding--how many ways can you activate an enzyme?
Drin G and Scarlata S, Cell Signal. 2007 Jul;19(7):1383-92. Epub 2007 Apr 29.
7.
Single and repeated stress-induced modulation of phospholipase C catalytic activity and expression: role in LH behavior.
Dwivedi Y, etal., Neuropsychopharmacology. 2005 Mar;30(3):473-83.
8.
Real-time PCR as a tool for quantitative analysis of PI-PLCbeta1 gene expression in myelodysplastic syndrome.
Follo MY, etal., Int J Mol Med. 2006 Aug;18(2):267-71.
9.
Synergistic induction of PI-PLCbeta1 signaling by azacitidine and valproic acid in high-risk myelodysplastic syndromes.
Follo MY, etal., Leukemia. 2011 Feb;25(2):271-80. doi: 10.1038/leu.2010.266. Epub 2010 Nov 26.
10.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
11.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
12.
Phospholipase C-beta1 expression correlates with neuronal differentiation and synaptic plasticity in rat somatosensory cortex.
Hannan AJ, etal., Neuropharmacology. 1998 Apr-May;37(4-5):593-605.
13.
Expression of Gq alpha and PLC-beta in scar and border tissue in heart failure due to myocardial infarction.
Ju H, etal., Circulation. 1998 Mar 10;97(9):892-9.
14.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
15.
Fuel and hormone regulation of phospholipase C beta 1 and delta 1 overexpressed in RINm5F pancreatic beta cells.
Kelley GG, etal., Mol Cell Endocrinol. 2001 May 25;177(1-2):107-15.
16.
Discrete subcellular localization of phosphoinositidase C beta, gamma and delta in PC12 rat pheochromocytoma cells.
Mazzoni M, etal., Biochem Biophys Res Commun. 1992 Aug 31;187(1):114-20.
17.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
18.
Effects of hyperoxia and acrylonitrile on the phospholipase C isozyme protein levels in rat heart and brain.
Nagasawa K, etal., Life Sci 2003 Aug 1;73(11):1453-62.
19.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
20.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
21.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
22.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
23.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
24.
GOA pipeline
RGD automated data pipeline
25.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
26.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
27.
Regulation of phosphoinositide-specific phospholipase C.
Rhee SG Annu Rev Biochem. 2001;70:281-312.
28.
TRP-PLIK, a bifunctional protein with kinase and ion channel activities.
Runnels LW, etal., Science 2001 Feb 9;291(5506):1043-7.
29.
Signal transduction mechanisms in Alzheimer disease.
Shimohama S and Matsushima H, Alzheimer Dis Assoc Disord. 1995;9 Suppl 2:15-22.
30.
Phospholipase C may be involved in norepinephrine-induced cardiac hypertrophy.
Singal T, etal., Biochem Biophys Res Commun. 2004 Jul 30;320(3):1015-9.
31.
Regulation of purified subtypes of phosphatidylinositol-specific phospholipase C beta by G protein alpha and beta gamma subunits.
Smrcka AV and Sternweis PC, J Biol Chem. 1993 May 5;268(13):9667-74.
32.
Phospholipase-C beta1 is predominantely expressed in the granular layer of rat cerebellar cortex.
Vitale M, etal., Int J Mol Med. 2004 Aug;14(2):161-4.
33.
Delay fear conditioning modifies phospholipase C-beta 1a signaling in the hippocampus and frontal cortex.
Weeber EJ and Caldwell KK, Pharmacol Biochem Behav. 2004 May;78(1):155-64.
34.
Phospholipase C-beta3 and -beta1 form homodimers, but not heterodimers, through catalytic and carboxyl-terminal domains.
Zhang Y, etal., Mol Pharmacol. 2006 Sep;70(3):860-8. Epub 2006 Jun 8.
Plcb1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 142,512,765 - 143,224,042 (+) NCBI GRCr8 mRatBN7.2 3 122,059,988 - 122,772,896 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 122,060,031 - 122,772,869 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 125,952,538 - 126,679,203 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 134,555,297 - 135,266,257 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 132,208,716 - 132,934,812 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 127,721,244 - 128,419,565 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 128,155,069 - 128,419,545 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 134,211,557 - 134,908,321 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 122,797,718 - 123,523,675 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 122,703,321 - 123,430,863 (+) NCBI Celera 3 120,808,920 - 121,513,252 (+) NCBI Celera Cytogenetic Map 3 q36 NCBI
PLCB1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 20 8,132,266 - 8,884,900 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 20 8,077,251 - 8,968,360 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 20 8,112,913 - 8,865,547 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 20 8,061,296 - 8,813,547 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 20 8,061,295 - 8,813,547 NCBI Celera 20 8,182,881 - 8,935,778 (+) NCBI Celera Cytogenetic Map 20 p12.3 NCBI HuRef 20 8,064,325 - 8,817,514 (+) NCBI HuRef CHM1_1 20 8,113,481 - 8,866,748 (+) NCBI CHM1_1 T2T-CHM13v2.0 20 8,174,228 - 8,928,072 (+) NCBI T2T-CHM13v2.0
Plcb1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 134,628,084 - 135,317,178 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 134,627,987 - 135,317,178 (+) Ensembl GRCm39 Ensembl GRCm38 2 134,786,164 - 135,475,258 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 134,786,067 - 135,475,258 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 134,611,900 - 135,300,994 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 134,477,971 - 135,163,863 (+) NCBI MGSCv36 mm8 Celera 2 135,990,426 - 136,678,579 (+) NCBI Celera Cytogenetic Map 2 F3 NCBI cM Map 2 65.66 NCBI
Plcb1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955415 18,210,662 - 18,915,158 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955415 18,210,608 - 18,915,099 (+) NCBI ChiLan1.0 ChiLan1.0
PLCB1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 21 9,032,494 - 9,784,094 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 20 9,029,321 - 9,780,921 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 20 8,106,665 - 8,858,572 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 20 7,887,773 - 8,636,019 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 20 7,887,960 - 8,636,019 (+) Ensembl panpan1.1 panPan2
PLCB1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 24 13,337,285 - 13,996,218 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 24 13,322,296 - 13,995,539 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 24 13,161,289 - 13,837,418 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 24 13,744,297 - 14,413,598 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 24 13,745,444 - 14,413,611 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 24 13,354,731 - 14,024,546 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 24 13,455,648 - 14,132,727 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 24 13,793,592 - 14,463,037 (-) NCBI UU_Cfam_GSD_1.0
Plcb1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 162,117,602 - 162,822,762 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936485 10,548,966 - 11,253,761 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936485 10,548,966 - 11,254,139 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PLCB1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 17 17,007,261 - 17,745,313 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 17 17,007,197 - 17,745,314 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 17 19,691,473 - 19,950,043 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PLCB1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 2 29,242,601 - 29,994,238 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 2 29,242,425 - 29,496,793 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666071 14,560,873 - 15,334,958 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Plcb1
.
Predicted Target Of
Count of predictions: 98 Count of miRNA genes: 60 Interacting mature miRNAs: 66 Transcripts: ENSRNOT00000006389, ENSRNOT00000051184 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2312673 Scl63 Serum cholesterol level QTL 63 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 3 98535255 168026850 Rat 1598877 Bp285 Blood pressure QTL 285 1.5 0.03 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 120538241 165538241 Rat 2302373 Gluco39 Glucose level QTL 39 5.01 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 3 98535386 161695835 Rat 70216 Cm14 Cardiac mass QTL 14 2.1 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 31172320 163586636 Rat 2292591 Esta4 Estrogen-induced thymic atrophy QTL 4 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 3 47233211 147415807 Rat 1358362 Srcrt2 Stress Responsive Cort QTL 2 2.78 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 3 38192233 133483320 Rat 1581568 Rf53 Renal function QTL 53 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 3 56395968 161299569 Rat 7387306 Bw124 Body weight QTL 124 3.2 0.0003 body mass (VT:0001259) body weight (CMO:0000012) 3 84091273 129091273 Rat 1578754 Stresp16 Stress response QTL 16 4 0.001 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 3 112681431 157681431 Rat 1300173 Rf11 Renal function QTL 11 3.38 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 3 121056165 145956249 Rat 8694437 Bw167 Body weight QTL 167 22.46 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 3 91797474 136797474 Rat 10755461 Coatc16 Coat color QTL 16 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 3 122438700 167438700 Rat 8662816 Vetf4 Vascular elastic tissue fragility QTL 4 4 renal artery integrity trait (VT:0010642) number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563) 3 59242096 157323038 Rat 1559282 Emca5 Estrogen-induced mammary cancer QTL 5 3.9 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 3 43827364 169034231 Rat 1354611 Despr2 Despair related QTL 2 3.03 0.0028 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 3 97084464 142084464 Rat 631649 Bp123 Blood pressure QTL 123 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 89772419 134772419 Rat 631841 Niddm39 Non-insulin dependent diabetes mellitus QTL 39 3.36 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 94856903 159898684 Rat 1358204 Insglur1 Insulin/glucose ratio QTL 1 3.8 blood glucose amount (VT:0000188) serum glucose level (CMO:0000543) 3 115638168 135181505 Rat 1576306 Schws3 Schwannoma susceptibility QTL 3 0.001 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 3 118839124 163839124 Rat 619618 Rf3 Renal disease susceptibility QTL 3 6.5 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate to body weight ratio (CMO:0001270) 3 107693393 152693393 Rat 1300159 Kidm4 Kidney mass QTL 4 3.83 kidney mass (VT:0002707) right kidney wet weight to body weight ratio (CMO:0001953) 3 121056165 157309487 Rat 2301971 Cm71 Cardiac mass QTL 71 4.63 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 3 41874578 155617519 Rat 2312659 Slep7 Serum leptin concentration QTL 7 0.001 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 3 98535255 168026850 Rat 2301970 Bw81 Body weight QTL 81 5.19 body mass (VT:0001259) body weight (CMO:0000012) 3 41874578 155617519 Rat 1581546 Pur13 Proteinuria QTL 13 2.93 0.0335 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 3 78196190 146592722 Rat 1331758 Bp207 Blood pressure QTL 207 2.848 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 112287552 135181505 Rat 2293087 Iddm27 Insulin dependent diabetes mellitus QTL 27 2.68 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 97551417 147415807 Rat 2312670 Bw94 Body weight QTL 94 0.01 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 3 98535255 168026850 Rat 724532 Cm17 Cardiac mass QTL 17 2 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 3 95735366 140735366 Rat
D3Wox22
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 3 143,224,340 - 143,224,552 (+) Marker Load Pipeline mRatBN7.2 3 122,771,586 - 122,771,840 (+) MAPPER mRatBN7.2 mRatBN7.2 3 122,771,586 - 122,771,798 (+) MAPPER mRatBN7.2 Rnor_6.0 3 128,419,864 - 128,420,193 NCBI Rnor6.0 Rnor_6.0 3 128,419,864 - 128,420,075 NCBI Rnor6.0 Rnor_5.0 3 134,908,640 - 134,908,969 UniSTS Rnor5.0 Rnor_5.0 3 134,908,640 - 134,908,851 UniSTS Rnor5.0 RGSC_v3.4 3 123,523,994 - 123,524,205 UniSTS RGSC3.4 Celera 3 121,513,571 - 121,513,784 UniSTS Cytogenetic Map 3 q36 UniSTS
D3Rat158
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 3 142,910,625 - 142,910,779 (+) Marker Load Pipeline mRatBN7.2 3 122,457,858 - 122,458,012 (+) MAPPER mRatBN7.2 Rnor_6.0 3 128,120,751 - 128,120,904 NCBI Rnor6.0 Rnor_5.0 3 134,608,322 - 134,608,475 UniSTS Rnor5.0 RGSC_v3.4 3 123,202,756 - 123,203,100 RGD RGSC3.4 RGSC_v3.4 3 123,202,807 - 123,202,960 UniSTS RGSC3.4 RGSC_v3.1 3 123,108,380 - 123,108,533 RGD Celera 3 121,205,948 - 121,206,101 UniSTS RH 3.4 Map 3 1069.6 UniSTS RH 3.4 Map 3 1069.6 RGD RH 2.0 Map 3 718.3 RGD SHRSP x BN Map 3 59.6699 RGD Cytogenetic Map 3 q36 UniSTS
D3Mco10
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 3 142,864,478 - 142,864,803 (+) Marker Load Pipeline mRatBN7.2 3 122,411,707 - 122,412,032 (+) MAPPER mRatBN7.2 Rnor_6.0 3 128,074,425 - 128,074,746 NCBI Rnor6.0 Rnor_5.0 3 134,561,996 - 134,562,317 UniSTS Rnor5.0 RGSC_v3.4 3 123,156,618 - 123,156,941 RGD RGSC3.4 RGSC_v3.4 3 123,156,620 - 123,156,941 UniSTS RGSC3.4 RGSC_v3.1 3 123,062,191 - 123,062,514 RGD Celera 3 121,159,818 - 121,160,139 UniSTS Cytogenetic Map 3 q36 UniSTS
A007B46
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 122,769,721 - 122,769,918 (+) MAPPER mRatBN7.2 Rnor_6.0 3 128,417,999 - 128,418,195 NCBI Rnor6.0 Rnor_5.0 3 134,906,775 - 134,906,971 UniSTS Rnor5.0 RGSC_v3.4 3 123,522,129 - 123,522,325 UniSTS RGSC3.4 Celera 3 121,511,706 - 121,511,902 UniSTS Cytogenetic Map 3 q36 UniSTS
AI132408
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 122,772,417 - 122,772,691 (+) MAPPER mRatBN7.2 Rnor_6.0 3 128,420,813 - 128,421,086 NCBI Rnor6.0 Rnor_5.0 3 134,909,589 - 134,909,862 UniSTS Rnor5.0 RGSC_v3.4 3 123,524,825 - 123,525,098 UniSTS RGSC3.4 Celera 3 121,514,404 - 121,514,677 UniSTS Cytogenetic Map 3 q36 UniSTS
RH143123
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 122,301,585 - 122,301,695 (+) MAPPER mRatBN7.2 Rnor_6.0 3 127,963,136 - 127,963,245 NCBI Rnor6.0 Rnor_5.0 3 134,451,872 - 134,451,981 UniSTS Rnor5.0 RGSC_v3.4 3 123,042,363 - 123,042,472 UniSTS RGSC3.4 Celera 3 121,050,653 - 121,050,762 UniSTS RH 3.4 Map 3 1074.6 UniSTS Cytogenetic Map 3 q36 UniSTS
BE107717
Rat Assembly Chr Position (strand) Source JBrowse Celera 3 121,070,507 - 121,070,663 UniSTS RH 3.4 Map 3 1077.7 UniSTS Cytogenetic Map 3 q36 UniSTS
RH135213
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 122,431,214 - 122,431,409 (+) MAPPER mRatBN7.2 Rnor_6.0 3 128,093,928 - 128,094,122 NCBI Rnor6.0 Rnor_5.0 3 134,581,499 - 134,581,693 UniSTS Rnor5.0 RGSC_v3.4 3 123,175,965 - 123,176,159 UniSTS RGSC3.4 Celera 3 121,179,319 - 121,179,513 UniSTS RH 3.4 Map 3 1069.6 UniSTS Cytogenetic Map 3 q36 UniSTS
RH138108
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 122,266,922 - 122,267,059 (+) MAPPER mRatBN7.2 Rnor_6.0 3 127,928,459 - 127,928,595 NCBI Rnor6.0 Rnor_5.0 3 134,417,629 - 134,417,765 UniSTS Rnor5.0 RGSC_v3.4 3 123,004,632 - 123,004,768 UniSTS RGSC3.4 Celera 3 121,015,901 - 121,016,037 UniSTS RH 3.4 Map 3 1074.7 UniSTS Cytogenetic Map 3 q36 UniSTS
RH138884
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 122,269,326 - 122,269,498 (+) MAPPER mRatBN7.2 Rnor_6.0 3 127,930,863 - 127,931,034 NCBI Rnor6.0 Rnor_5.0 3 134,420,033 - 134,420,204 UniSTS Rnor5.0 RGSC_v3.4 3 123,007,036 - 123,007,207 UniSTS RGSC3.4 Celera 3 121,018,305 - 121,018,476 UniSTS RH 3.4 Map 3 1074.7 UniSTS Cytogenetic Map 3 q36 UniSTS
AU048499
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 122,681,618 - 122,681,812 (+) MAPPER mRatBN7.2 Rnor_6.0 3 128,333,610 - 128,333,805 NCBI Rnor6.0 Rnor_5.0 3 134,820,853 - 134,821,048 UniSTS Rnor5.0 RGSC_v3.4 3 123,432,866 - 123,433,061 UniSTS RGSC3.4 Celera 3 121,424,544 - 121,424,739 UniSTS Cytogenetic Map 3 q36 UniSTS
AU048959
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 122,685,104 - 122,685,277 (+) MAPPER mRatBN7.2 Rnor_6.0 3 128,337,098 - 128,337,270 NCBI Rnor6.0 Rnor_5.0 3 134,824,341 - 134,824,513 UniSTS Rnor5.0 RGSC_v3.4 3 123,436,354 - 123,436,526 UniSTS RGSC3.4 Celera 3 121,428,032 - 121,428,204 UniSTS Cytogenetic Map 3 q36 UniSTS
D8S1807
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 122,135,471 - 122,136,109 (+) MAPPER mRatBN7.2 mRatBN7.2 15 73,241,271 - 73,242,912 (+) MAPPER mRatBN7.2 Rnor_6.0 15 80,810,982 - 80,812,622 NCBI Rnor6.0 Rnor_6.0 3 127,796,967 - 127,797,604 NCBI Rnor6.0 Rnor_5.0 15 84,349,172 - 84,350,812 UniSTS Rnor5.0 Rnor_5.0 3 134,287,614 - 134,288,251 UniSTS Rnor5.0 RGSC_v3.4 3 122,874,247 - 122,874,884 UniSTS RGSC3.4 RGSC_v3.4 15 79,872,788 - 79,874,428 UniSTS RGSC3.4 Celera 15 72,522,594 - 72,524,234 UniSTS Celera 3 120,884,308 - 120,884,945 UniSTS Cytogenetic Map 3 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000006389 ⟹ ENSRNOP00000006389
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 122,060,031 - 122,771,268 (+) Ensembl Rnor_6.0 Ensembl 3 128,155,117 - 128,419,545 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000051184 ⟹ ENSRNOP00000042533
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 122,060,031 - 122,772,869 (+) Ensembl Rnor_6.0 Ensembl 3 128,155,069 - 128,349,864 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000098292 ⟹ ENSRNOP00000085919
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 122,111,601 - 122,689,381 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000113879 ⟹ ENSRNOP00000078760
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 122,491,581 - 122,772,869 (+) Ensembl
RefSeq Acc Id:
NM_001077641 ⟹ NP_001071109
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 142,512,765 - 143,224,042 (+) NCBI mRatBN7.2 3 122,059,999 - 122,771,288 (+) NCBI Rnor_6.0 3 127,721,244 - 128,419,545 (+) NCBI Rnor_5.0 3 134,211,557 - 134,908,321 (+) NCBI RGSC_v3.4 3 122,797,718 - 123,523,675 (+) RGD Celera 3 120,808,920 - 121,513,252 (+) RGD
Sequence:
TGCGTTCCCGCTTGTGTCGCTGACCCAGCGCGCAAAGTTGGGCAGGGAGCTGGGGGAGGAGGACCGCGAGCGAGGGTGGCGGAGCAGGGGCGGGAGGAGCGGAGGGAGGAGGGGACCGGAGCGTGTCA
hide sequence
RefSeq Acc Id:
XM_017591467 ⟹ XP_017446956
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 142,513,191 - 143,222,468 (+) NCBI mRatBN7.2 3 122,059,988 - 122,772,896 (+) NCBI Rnor_6.0 3 127,721,389 - 128,419,565 (+) NCBI
Sequence:
CTGTGCACAGAGGAATGTGCTGAATGGTGCGCTTCCAGGCGGCGGCCCGAGCAGGATCAGGCGGCGGGCGGCTCGCACTGGCCGGGCTCTGCTCCTTCTTGTCTCCCGAGGCTCTACAATCACCGCGG
hide sequence
RefSeq Acc Id:
NP_001071109 ⟸ NM_001077641
- UniProtKB:
P10687 (UniProtKB/Swiss-Prot), A6HQI6 (UniProtKB/TrEMBL)
- Sequence:
MAGAQPGVHALQLKPVCVSDSLKKGTKFVKWDDDSTIVTPIILRTDPQGFFFYWTDQNKETELLDLSLVKDARCGKHAKAPKDPKLRELLDVGNIGHLEQRMITVVYGPDLVNISHLNLVAFQEEVAK
hide sequence
RefSeq Acc Id:
XP_017446956 ⟸ XM_017591467
- Peptide Label:
isoform X1
- UniProtKB:
R9PXY3 (UniProtKB/TrEMBL), A0A8I6A2P4 (UniProtKB/TrEMBL)
- Sequence:
MAGAQPGVHALQLKPVCVSDSLKKGTKFVKWDDDSTIVTPIILRTDPQGFFFYWTDQNKETELL
hide sequence
Ensembl Acc Id:
ENSRNOP00000006389 ⟸ ENSRNOT00000006389
Ensembl Acc Id:
ENSRNOP00000042533 ⟸ ENSRNOT00000051184
Ensembl Acc Id:
ENSRNOP00000085919 ⟸ ENSRNOT00000098292
Ensembl Acc Id:
ENSRNOP00000078760 ⟸ ENSRNOT00000113879
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-11-30
Plcb1
phospholipase C beta 1
Plcb1
phospholipase C, beta 1 (phosphoinositide-specific)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-09-09
Plcb1
phospholipase C, beta 1 (phosphoinositide-specific)
Plcb1
phospholipase C, beta 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-01-09
Plcb1
phospholipase C, beta 1
LOC688139
similar to 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta 1 (Phosphoinositide phospholipase C) (Phospholipase C-beta-1) (PLC-beta-1) (PLC-I) (PLC-154)
Data merged from RGD:1592421
1643240 APPROVED
2006-11-20
LOC688139
similar to 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta 1 (Phosphoinositide phospholipase C) (Phospholipase C-beta-1) (PLC-beta-1) (PLC-I) (PLC-154)
Symbol and Name status set to provisional
70820 PROVISIONAL
2002-06-10
Plcb1
Phospholipase C-beta1
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_disease
inhibition of pathway modulated by 5-HT(2) receptor activation via atypical neuroleptics may lead to alterations in serotonergic signaling and schizophrenia
633577
gene_expression
expression levels significantly reduced in old neuronal striata
1299009
gene_expression
expressed in brain
1299007
gene_pathway
mediates intracellular Ca(2+), activation of calcineurin and inhibition of Ca(v)1.2 L-type Ca(2+) currents via upstream stimulation of 5-HT(2) receptors in prefrontal neurons
633577
gene_pathway
may be involved in oxidative stress pathways
1299008
gene_process
may play a role in myoblast differentiation
1299010
gene_transcript
produced by alternative splicing of 5.4 kb transcript precursor
1299007
