Symbol:
Pkm (Ensembl: Pkml1)
Name:
pyruvate kinase M1/2 (Ensembl:pyruvate kinase M1/2 like 1)
RGD ID:
3337
Description:
Enables several functions, including ADP binding activity; pyruvate kinase activity; and thyroid hormone binding activity. Involved in several processes, including protein homotetramerization; pyruvate metabolic process; and response to insulin. Part of pyruvate kinase complex. Biomarker of hypertension. Orthologous to human PKM (pyruvate kinase M1/2); PARTICIPATES IN glycolysis pathway; pyruvate metabolic pathway; hypoxia inducible factor pathway; INTERACTS WITH (R)-adrenaline; 1,2,4-trimethylbenzene; 17alpha-ethynylestradiol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
M2 pyruvate kinase; PK; Pk3; PKM12; Pkm2; pyruvate kinase isozymes M1/M2; Pyruvate kinase muscle; pyruvate kinase muscle isozyme; pyruvate kinase PKM; pyruvate kinase, muscle; threonine-protein kinase PKM2; tyrosine-protein kinase PKM2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PKM (pyruvate kinase M1/2) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB
Mus musculus (house mouse):
Pkm (pyruvate kinase, muscle) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Pkm (pyruvate kinase M1/2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PKM (pyruvate kinase M1/2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PKM (pyruvate kinase M1/2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Pkm (pyruvate kinase M1/2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PKM (pyruvate kinase M1/2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PKM (pyruvate kinase M1/2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Pkm (pyruvate kinase M1/2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
TPPP (tubulin polymerization promoting protein) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
PKM (pyruvate kinase M1/2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|SonicParanoid)
Mus musculus (house mouse):
Pkm (pyruvate kinase, muscle)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoInspector|SonicParanoid)
Danio rerio (zebrafish):
pkmb (pyruvate kinase M1/2b)
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
pkma (pyruvate kinase M1/2a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
pyk-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG2964
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):
CDC19
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
PYK2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
pyk-2
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
CG7362
Alliance
DIOPT (OrthoFinder|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
PyK
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
pkm
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Related Pseudogenes:
Pkm-ps20
Allele / Splice:
Pkm_v2
Pkm_v1
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 68,949,731 - 68,975,394 (+) NCBI GRCr8 mRatBN7.2 8 60,057,629 - 60,079,600 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 60,057,402 - 60,079,599 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 65,580,124 - 65,601,628 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 63,853,049 - 63,874,553 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 61,722,501 - 61,744,005 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 64,480,963 - 64,502,957 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 64,481,172 - 64,502,722 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 64,243,957 - 64,265,970 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 63,486,492 - 63,508,016 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 63,505,545 - 63,527,070 (+) NCBI Celera 8 59,500,837 - 59,522,361 (+) NCBI Celera RH 3.4 Map 8 703.1 RGD Cytogenetic Map 8 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pkm Rat (1->4)-beta-D-glucan multiple interactions ISO Pkm (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PKM mRNA CTD PMID:36331819 Pkm Rat (R)-adrenaline multiple interactions EXP 6480464 [Epinephrine co-treated with Xanthine co-treated with XDH] results in decreased expression of PKM protein CTD PMID:19464573 Pkm Rat (R)-adrenaline increases expression ISO PKM (Homo sapiens) 6480464 Epinephrine results in increased expression of PKM protein CTD PMID:36423730 Pkm Rat (R)-adrenaline increases expression ISO Pkm (Mus musculus) 6480464 Epinephrine results in increased expression of PKM protein CTD PMID:36423730 Pkm Rat 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane increases expression ISO PKM (Homo sapiens) 6480464 o and p'-DDT results in increased expression of PKM mRNA CTD PMID:19371625 Pkm Rat 1,2,4-trimethylbenzene decreases expression EXP 6480464 pseudocumene results in decreased expression of PKM protein CTD PMID:17337753 Pkm Rat 1,4-benzoquinone multiple interactions ISO Pkm (Mus musculus) 6480464 Acetylcysteine inhibits the reaction [quinone results in increased degradation of PKM protein] more ... CTD PMID:25437431 Pkm Rat 1,4-benzoquinone increases expression ISO PKM (Homo sapiens) 6480464 quinone results in increased expression of PKM protein CTD PMID:30448556 Pkm Rat 1,4-benzoquinone multiple interactions ISO PKM (Homo sapiens) 6480464 [HIF1A protein co-treated with quinone] results in increased expression of PKM protein CTD PMID:30448556 Pkm Rat 1-chloro-2,4-dinitrobenzene increases metabolic processing ISO PKM (Homo sapiens) 6480464 Dinitrochlorobenzene results in increased metabolism of PKM protein CTD PMID:29267982 Pkm Rat 14-Deoxy-11,12-didehydroandrographolide decreases expression ISO PKM (Homo sapiens) 6480464 14-deoxy-11 and 12-didehydroandrographolide results in decreased expression of PKM mRNA CTD PMID:22101062 Pkm Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of PKM mRNA CTD PMID:12075121 Pkm Rat 17beta-estradiol decreases expression ISO Pkm (Mus musculus) 6480464 Estradiol results in decreased expression of PKM mRNA CTD PMID:19484750 and PMID:39298647 Pkm Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of PKM mRNA CTD PMID:32145629 Pkm Rat 17beta-estradiol multiple interactions ISO PKM (Homo sapiens) 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [Estradiol results in increased phosphorylation of and affects the localization of PKM protein] more ... CTD PMID:32078667 Pkm Rat 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one multiple interactions ISO PKM (Homo sapiens) 6480464 Metribolone promotes the reaction [NDRG1 protein binds to PKM protein] CTD PMID:17220478 Pkm Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO PKM (Homo sapiens) 6480464 2 more ... CTD PMID:30821169 Pkm Rat 2,2',4,4',5,5'-hexachlorobiphenyl increases expression ISO PKM (Homo sapiens) 6480464 2 more ... CTD PMID:30821169 Pkm Rat 2,3',4,4',5-Pentachlorobiphenyl multiple interactions ISO PKM (Homo sapiens) 6480464 2 more ... CTD PMID:30821169 and PMID:31251971 Pkm Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO PKM (Homo sapiens) 6480464 2 more ... CTD PMID:30821169 and PMID:31251971 Pkm Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PKM protein CTD PMID:16548065 Pkm Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PKM mRNA CTD PMID:33387578 Pkm Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Pkm (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of PKM mRNA more ... CTD PMID:19770486 more ... Pkm Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Pkm (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PKM mRNA CTD PMID:21570461 and PMID:26377647 Pkm Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO PKM (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of PKM mRNA CTD PMID:23152189 Pkm Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO PKM (Homo sapiens) 6480464 2-methyl-2H-pyrazole-3-carboxylic acid (2-methyl-4-o-tolylazophenyl)amide inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of PKM mRNA] and alpha-naphthoflavone inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of PKM mRNA] CTD PMID:23152189 Pkm Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether increases expression EXP 6480464 2 more ... CTD PMID:19954255 Pkm Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether decreases expression EXP 6480464 2 more ... CTD PMID:19954255 Pkm Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of PKM mRNA CTD PMID:21346803 Pkm Rat 2,5-hexanedione increases expression EXP 6480464 2 and 5-hexanedione results in increased expression of PKM protein CTD PMID:15928459 and PMID:19033394 Pkm Rat 2,6-dimethoxyphenol multiple interactions ISO PKM (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1 and 3-dimethyl ether] results in decreased expression of and affects the localization of PKM protein CTD PMID:38598786 Pkm Rat 2-acetamidofluorene increases expression EXP 6480464 2-Acetylaminofluorene results in increased expression of PKM mRNA and 2-Acetylaminofluorene results in increased expression of PKM protein CTD PMID:17538966 Pkm Rat 2-deoxy-D-glucose multiple interactions ISO PKM (Homo sapiens) 6480464 Deoxyglucose inhibits the reaction [G3BP1 protein results in increased expression of PKM protein] CTD PMID:35945655 Pkm Rat 2-hydroxypropanoic acid increases abundance ISO PKM (Homo sapiens) 6480464 PKM protein results in increased abundance of Lactic Acid CTD PMID:22574221 Pkm Rat 2-hydroxypropanoic acid increases expression ISO PKM (Homo sapiens) 6480464 Lactic Acid results in increased expression of PKM protein CTD PMID:36336208 Pkm Rat 2-hydroxypropanoic acid multiple interactions ISO PKM (Homo sapiens) 6480464 Lactic Acid promotes the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PKM protein] more ... CTD PMID:36336208 Pkm Rat 2-methoxyethanol decreases expression EXP 6480464 methyl cellosolve results in decreased expression of PKM protein CTD PMID:15928459 Pkm Rat 3,3',4,4',5-pentachlorobiphenyl multiple interactions ISO PKM (Homo sapiens) 6480464 3 more ... CTD PMID:28284859 and PMID:30821169 Pkm Rat 3,3',4,4',5-pentachlorobiphenyl increases expression ISO PKM (Homo sapiens) 6480464 3 more ... CTD PMID:28284859 and PMID:30821169 Pkm Rat 3,5-diethoxycarbonyl-1,4-dihydrocollidine multiple interactions ISO Pkm (Mus musculus) 6480464 GW 3965 inhibits the reaction [3 more ... CTD PMID:27052460 Pkm Rat 3,5-diethoxycarbonyl-1,4-dihydrocollidine increases expression ISO Pkm (Mus musculus) 6480464 3 more ... CTD PMID:27052460 Pkm Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of PKM protein CTD PMID:26072098 Pkm Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO PKM (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of PKM mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of PKM mRNA CTD PMID:28628672 Pkm Rat 3-methyladenine multiple interactions ISO PKM (Homo sapiens) 6480464 3-methyladenine inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PKM protein] and 3-methyladenine inhibits the reaction [Potassium Dichromate results in increased expression of PKM protein] CTD PMID:32569804 more ... Pkm Rat 3-phenylprop-2-enal increases metabolic processing ISO PKM (Homo sapiens) 6480464 cinnamaldehyde results in increased metabolism of PKM protein CTD PMID:29267982 Pkm Rat 4,4'-diaminodiphenylmethane increases expression ISO Pkm (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of PKM mRNA CTD PMID:18648102 Pkm Rat 4,4'-sulfonyldiphenol increases expression ISO PKM (Homo sapiens) 6480464 bisphenol S results in increased expression of PKM protein CTD PMID:34186270 Pkm Rat 4-chlorobiphenyl increases expression ISO PKM (Homo sapiens) 6480464 4-chlorobiphenyl metabolite results in increased expression of PKM mRNA CTD PMID:25417049 Pkm Rat 4-hydroxynon-2-enal multiple interactions ISO PKM (Homo sapiens) 6480464 4-hydroxy-2-nonenal binds to and results in decreased activity of PKM protein and 4-hydroxy-2-nonenal promotes the reaction [PKM protein binds to PKM protein] CTD PMID:27978618 Pkm Rat 4-hydroxynon-2-enal affects binding ISO PKM (Homo sapiens) 6480464 4-hydroxy-2-nonenal analog binds to PKM protein CTD PMID:27978618 Pkm Rat 4-phenylbutyric acid multiple interactions ISO PKM (Homo sapiens) 6480464 4-phenylbutyric acid inhibits the reaction [Potassium Dichromate results in increased expression of PKM protein] CTD PMID:32569804 and PMID:36473502 Pkm Rat 5-aza-2'-deoxycytidine affects methylation ISO PKM (Homo sapiens) 6480464 Decitabine affects the methylation of PKM gene CTD PMID:17630775 Pkm Rat 5-azacytidine increases expression ISO PKM (Homo sapiens) 6480464 Azacitidine results in increased expression of PKM mRNA CTD PMID:20823114 Pkm Rat 5-Hydroxyflavone multiple interactions ISO PKM (Homo sapiens) 6480464 5-hydroxyflavone inhibits the reaction [PKM protein results in increased metabolism of Phosphoenolpyruvate] CTD PMID:25388478 Pkm Rat 6-Hydroxyflavone multiple interactions ISO PKM (Homo sapiens) 6480464 6-hydroxyflavone inhibits the reaction [PKM protein results in increased metabolism of Phosphoenolpyruvate] CTD PMID:25388478 Pkm Rat 7-hydroxyflavone multiple interactions ISO PKM (Homo sapiens) 6480464 7-hydroxyflavone inhibits the reaction [PKM protein results in increased metabolism of Phosphoenolpyruvate] CTD PMID:25388478 Pkm Rat 7H-xanthine multiple interactions EXP 6480464 [Epinephrine co-treated with Xanthine co-treated with XDH] results in decreased expression of PKM protein and [Xanthine co-treated with XDH protein] results in decreased expression of PKM protein CTD PMID:19464573 Pkm Rat 9-cis-retinoic acid decreases expression ISO PKM (Homo sapiens) 6480464 Alitretinoin results in decreased expression of PKM protein CTD PMID:28886987 Pkm Rat 9H-xanthine multiple interactions EXP 6480464 [Epinephrine co-treated with Xanthine co-treated with XDH] results in decreased expression of PKM protein and [Xanthine co-treated with XDH protein] results in decreased expression of PKM protein CTD PMID:19464573 Pkm Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of PKM mRNA CTD PMID:31881176 Pkm Rat acrolein multiple interactions ISO PKM (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of PKM mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased expression of PKM mRNA CTD PMID:32699268 Pkm Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of PKM mRNA CTD PMID:28959563 Pkm Rat actinomycin D multiple interactions ISO PKM (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of PKM protein CTD PMID:38460933 Pkm Rat aflatoxin B1 decreases expression ISO PKM (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of PKM mRNA CTD PMID:22100608 Pkm Rat aflatoxin B1 increases expression ISO PKM (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of PKM mRNA CTD PMID:27153756 Pkm Rat aflatoxin B1 increases methylation ISO PKM (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of PKM gene CTD PMID:27153756 Pkm Rat aldehydo-D-glucose multiple interactions ISO PKM (Homo sapiens) 6480464 Fulvestrant inhibits the reaction [Glucose promotes the reaction [Estradiol results in increased phosphorylation of PKM protein]] more ... CTD PMID:23086999 more ... Pkm Rat aldehydo-D-glucose increases uptake ISO PKM (Homo sapiens) 6480464 PKM protein results in increased uptake of Glucose CTD PMID:22574221 Pkm Rat all-trans-retinoic acid increases expression ISO PKM (Homo sapiens) 6480464 Tretinoin results in increased expression of PKM mRNA CTD PMID:15894607 more ... Pkm Rat all-trans-retinoic acid decreases expression ISO PKM (Homo sapiens) 6480464 Tretinoin results in decreased expression of PKM protein CTD PMID:28886987 Pkm Rat all-trans-retinoic acid multiple interactions ISO PKM (Homo sapiens) 6480464 [Tretinoin co-treated with arsenic trioxide] results in increased expression of PKM mRNA CTD PMID:15894607 Pkm Rat alpha-D-galactose multiple interactions ISO PKM (Homo sapiens) 6480464 Galactose affects the reaction [Fusaric Acid results in increased expression of PKM mRNA] CTD PMID:31654802 Pkm Rat alpha-naphthoflavone multiple interactions ISO PKM (Homo sapiens) 6480464 alpha-naphthoflavone inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of PKM mRNA] CTD PMID:23152189 Pkm Rat alpha-pinene multiple interactions ISO PKM (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of PKM mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased expression of PKM mRNA CTD PMID:32699268 Pkm Rat alpha-Zearalanol decreases expression EXP 6480464 Zeranol results in decreased expression of PKM mRNA CTD PMID:35163327 Pkm Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PKM mRNA CTD PMID:16483693 Pkm Rat ampicillin increases expression ISO PKM (Homo sapiens) 6480464 Ampicillin results in increased expression of PKM mRNA CTD PMID:21632981 Pkm Rat apigenin multiple interactions ISO PKM (Homo sapiens) 6480464 Apigenin inhibits the reaction [PKM protein results in increased metabolism of Phosphoenolpyruvate] CTD PMID:25388478 Pkm Rat aristolochic acid A increases expression ISO PKM (Homo sapiens) 6480464 aristolochic acid I results in increased expression of PKM protein CTD PMID:33212167 Pkm Rat arsane affects binding ISO PKM (Homo sapiens) 6480464 Arsenic binds to PKM protein CTD PMID:17499915 Pkm Rat arsenic atom affects binding ISO PKM (Homo sapiens) 6480464 Arsenic binds to PKM protein CTD PMID:17499915 Pkm Rat arsenite(3-) multiple interactions ISO PKM (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to PKM protein] CTD PMID:32406909 Pkm Rat arsenous acid multiple interactions ISO PKM (Homo sapiens) 6480464 [Ascorbic Acid co-treated with Arsenic Trioxide] results in decreased expression of PKM protein more ... CTD PMID:15894607 more ... Pkm Rat arsenous acid decreases expression ISO PKM (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of PKM mRNA and Arsenic Trioxide results in decreased expression of PKM protein CTD PMID:31003765 and PMID:38160894 Pkm Rat arsenous acid increases expression ISO PKM (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of PKM protein CTD PMID:25419056 Pkm Rat atorvastatin calcium increases expression EXP 6480464 Atorvastatin results in increased expression of PKM mRNA CTD PMID:27377005 Pkm Rat atrazine increases expression ISO PKM (Homo sapiens) 6480464 Atrazine results in increased expression of PKM mRNA CTD PMID:22378314 Pkm Rat baicalein increases activity ISO PKM (Homo sapiens) 6480464 baicalein results in increased activity of PKM protein CTD PMID:25388478 Pkm Rat baicalin increases activity ISO PKM (Homo sapiens) 6480464 baicalin results in increased activity of PKM protein CTD PMID:25388478 Pkm Rat Bardoxolone methyl decreases expression ISO PKM (Homo sapiens) 6480464 bardoxolone methyl results in decreased expression of PKM protein CTD PMID:35929395 Pkm Rat benzo[a]pyrene increases mutagenesis ISO PKM (Homo sapiens) 6480464 Benzo(a)pyrene results in increased mutagenesis of PKM gene CTD PMID:25435355 Pkm Rat benzo[a]pyrene increases expression ISO PKM (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of PKM mRNA CTD PMID:32234424 Pkm Rat benzo[a]pyrene increases expression ISO Pkm (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of PKM mRNA CTD PMID:19770486 and PMID:32417428 Pkm Rat benzo[a]pyrene diol epoxide I decreases expression ISO PKM (Homo sapiens) 6480464 7 more ... CTD PMID:20018196 Pkm Rat beta-lapachone increases expression ISO PKM (Homo sapiens) 6480464 beta-lapachone results in increased expression of PKM mRNA CTD PMID:38218311 Pkm Rat bifenthrin increases expression ISO Pkm (Mus musculus) 6480464 bifenthrin results in increased expression of PKM mRNA CTD PMID:26071804 Pkm Rat bis(2-chloroethyl) sulfide affects expression EXP 6480464 Mustard Gas affects the expression of PKM mRNA CTD PMID:15651846 Pkm Rat bis(2-ethylhexyl) phthalate decreases expression ISO Pkm (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of PKM mRNA CTD PMID:19850644 Pkm Rat bis(2-ethylhexyl) phthalate increases expression ISO Pkm (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of PKM mRNA CTD PMID:30284816 and PMID:33754040 Pkm Rat bis(2-ethylhexyl) phthalate increases expression ISO PKM (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of PKM mRNA CTD PMID:31163220 Pkm Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Pkm (Mus musculus) 6480464 PPARA protein promotes the reaction [Diethylhexyl Phthalate results in decreased expression of PKM mRNA] CTD PMID:19850644 Pkm Rat bisphenol A increases expression ISO PKM (Homo sapiens) 6480464 bisphenol A results in increased expression of PKM mRNA and bisphenol A results in increased expression of PKM protein CTD PMID:19371625 more ... Pkm Rat bisphenol A decreases expression ISO Pkm (Mus musculus) 6480464 bisphenol A results in decreased expression of PKM protein CTD PMID:35999755 Pkm Rat bisphenol A decreases expression ISO PKM (Homo sapiens) 6480464 bisphenol A results in decreased expression of PKM protein CTD PMID:34186270 Pkm Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of PKM mRNA CTD PMID:32145629 Pkm Rat bisphenol A affects expression ISO PKM (Homo sapiens) 6480464 bisphenol A affects the expression of PKM mRNA CTD PMID:30903817 Pkm Rat bisphenol A multiple interactions ISO PKM (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of PKM mRNA CTD PMID:28628672 Pkm Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PKM mRNA CTD PMID:12075121 and PMID:25181051 Pkm Rat bisphenol A increases expression ISO Pkm (Mus musculus) 6480464 bisphenol A results in increased expression of PKM mRNA CTD PMID:26063408 Pkm Rat bisphenol A multiple interactions EXP 6480464 [Fructose co-treated with bisphenol A] results in decreased expression of PKM protein CTD PMID:26930160 Pkm Rat bisphenol AF increases expression ISO PKM (Homo sapiens) 6480464 bisphenol AF results in increased expression of PKM protein CTD PMID:34186270 Pkm Rat Bisphenol B increases expression ISO PKM (Homo sapiens) 6480464 bisphenol B results in increased expression of PKM protein CTD PMID:34186270 Pkm Rat bisphenol F multiple interactions ISO PKM (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of PKM mRNA CTD PMID:28628672 Pkm Rat bisphenol F increases expression ISO PKM (Homo sapiens) 6480464 bisphenol F results in increased expression of PKM protein CTD PMID:34186270 Pkm Rat bisphenol F multiple interactions ISO Pkm (Mus musculus) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [bisphenol F results in increased expression of PKM mRNA] more ... CTD PMID:34147605 Pkm Rat bisphenol F increases expression ISO Pkm (Mus musculus) 6480464 bisphenol F results in increased expression of PKM mRNA and bisphenol F results in increased expression of PKM protein CTD PMID:34147605 Pkm Rat bruceine D multiple interactions ISO PKM (Homo sapiens) 6480464 bruceine D affects the reaction [Oxygen deficiency affects the expression of PKM protein] and CTNNBIP1 protein affects the reaction [bruceine D affects the reaction [Oxygen deficiency affects the expression of PKM protein]] CTD PMID:34900531 Pkm Rat C.I. Natural Red 20 multiple interactions ISO Pkm (Mus musculus) 6480464 shikonin inhibits the reaction [[Tobacco Smoke Pollution results in increased abundance of Particulate Matter] which results in increased expression of PKM protein] CTD PMID:35787437 Pkm Rat cadmium atom multiple interactions ISO Pkm (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PKM mRNA and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PKM protein CTD PMID:32917723 and PMID:34481905 Pkm Rat cadmium atom multiple interactions ISO PKM (Homo sapiens) 6480464 3-methyladenine inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PKM protein] more ... CTD PMID:34481905 more ... Pkm Rat cadmium dichloride multiple interactions ISO PKM (Homo sapiens) 6480464 3-methyladenine inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PKM protein] more ... CTD PMID:24980261 more ... Pkm Rat cadmium dichloride multiple interactions ISO Pkm (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PKM mRNA and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PKM protein CTD PMID:32917723 and PMID:34481905 Pkm Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of PKM mRNA CTD PMID:25993096 Pkm Rat cadmium dichloride increases expression ISO PKM (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of PKM mRNA and Cadmium Chloride results in increased expression of PKM protein CTD PMID:24527689 and PMID:38382870 Pkm Rat cadmium sulfate multiple interactions ISO Pkm (Mus musculus) 6480464 cadmium sulfate affects the reaction [MTF1 affects the expression of PKM mRNA] CTD PMID:16221973 Pkm Rat caffeine increases phosphorylation ISO PKM (Homo sapiens) 6480464 Caffeine results in increased phosphorylation of PKM protein CTD PMID:35688186 Pkm Rat carbon nanotube affects expression ISO Pkm (Mus musculus) 6480464 Nanotubes and Carbon affects the expression of PKM protein CTD PMID:21135415 Pkm Rat carbon nanotube increases expression ISO Pkm (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Pkm Rat CCCP multiple interactions ISO PKM (Homo sapiens) 6480464 Carbonyl Cyanide m-Chlorophenyl Hydrazone inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PKM protein] CTD PMID:34481905 Pkm Rat celastrol multiple interactions ISO Pkm (Mus musculus) 6480464 [celastrol co-treated with Dietary Fats] results in increased expression of PKM mRNA CTD PMID:35679966 Pkm Rat celastrol increases expression ISO Pkm (Mus musculus) 6480464 celastrol results in increased expression of PKM mRNA CTD PMID:35679966 Pkm Rat CGP 52608 multiple interactions ISO PKM (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to PKM gene] CTD PMID:28238834 Pkm Rat chloromethylisothiazolinone increases metabolic processing ISO PKM (Homo sapiens) 6480464 5-chloro-2-methyl-4-isothiazolin-3-one results in increased metabolism of PKM protein CTD PMID:29267982 Pkm Rat choline multiple interactions ISO Pkm (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of PKM mRNA and [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of PKM gene CTD PMID:20938992 Pkm Rat chromium(6+) multiple interactions ISO PKM (Homo sapiens) 6480464 MPC1 protein inhibits the reaction [chromium hexavalent ion results in increased expression of PKM protein] CTD PMID:38992767 Pkm Rat chromium(6+) increases expression ISO PKM (Homo sapiens) 6480464 chromium hexavalent ion results in increased expression of PKM protein CTD PMID:38992767 Pkm Rat cisplatin multiple interactions ISO PKM (Homo sapiens) 6480464 Cisplatin results in increased expression of and results in increased secretion of PKM protein CTD PMID:24980261 Pkm Rat clobetasol increases expression ISO Pkm (Mus musculus) 6480464 Clobetasol results in increased expression of PKM mRNA CTD PMID:27462272 Pkm Rat clozapine increases expression EXP 6480464 Clozapine results in increased expression of PKM mRNA CTD PMID:15860345 Pkm Rat cobalt dichloride decreases expression ISO PKM (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of PKM mRNA CTD PMID:19376846 Pkm Rat cocaine affects expression EXP 6480464 Cocaine affects the expression of PKM mRNA CTD PMID:20187946 Pkm Rat copper atom affects binding ISO PKM (Homo sapiens) 6480464 PKM protein binds to Copper CTD PMID:15359738 Pkm Rat copper(0) affects binding ISO PKM (Homo sapiens) 6480464 PKM protein binds to Copper CTD PMID:15359738 Pkm Rat coumarin affects phosphorylation ISO PKM (Homo sapiens) 6480464 coumarin affects the phosphorylation of PKM protein CTD PMID:35688186 Pkm Rat coumestrol multiple interactions ISO PKM (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of PKM mRNA CTD PMID:19167446 Pkm Rat crocidolite asbestos increases expression ISO PKM (Homo sapiens) 6480464 Asbestos and Crocidolite results in increased expression of PKM protein CTD PMID:29553831 Pkm Rat curcumin multiple interactions ISO PKM (Homo sapiens) 6480464 ATF4 inhibits the reaction [Curcumin results in decreased expression of PKM protein] more ... CTD PMID:36640941 Pkm Rat cyclosporin A multiple interactions ISO PKM (Homo sapiens) 6480464 Cyclosporine results in increased expression of and results in increased secretion of PKM protein CTD PMID:24980261 Pkm Rat cyclosporin A increases expression ISO PKM (Homo sapiens) 6480464 Cyclosporine results in increased expression of PKM mRNA CTD PMID:27989131 Pkm Rat cyclosporin A decreases expression ISO PKM (Homo sapiens) 6480464 Cyclosporine results in decreased expression of PKM mRNA CTD PMID:21163907 more ... Pkm Rat D-glucose increases uptake ISO PKM (Homo sapiens) 6480464 PKM protein results in increased uptake of Glucose CTD PMID:22574221 Pkm Rat D-glucose multiple interactions ISO PKM (Homo sapiens) 6480464 Fulvestrant inhibits the reaction [Glucose promotes the reaction [Estradiol results in increased phosphorylation of PKM protein]] more ... CTD PMID:23086999 more ... Pkm Rat DDT increases expression ISO PKM (Homo sapiens) 6480464 DDT results in increased expression of PKM mRNA alternative form CTD PMID:31724279 Pkm Rat DDT multiple interactions ISO PKM (Homo sapiens) 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [DDT results in increased expression of and affects the localization of PKM protein alternative form] more ... CTD PMID:31724279 Pkm Rat dexamethasone decreases expression ISO Pkm (Mus musculus) 6480464 Dexamethasone results in decreased expression of PKM protein CTD PMID:33567340 Pkm Rat dexamethasone multiple interactions ISO PKM (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of PKM mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of PKM mRNA CTD PMID:28628672 Pkm Rat diarsenic trioxide increases expression ISO PKM (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of PKM protein CTD PMID:25419056 Pkm Rat diarsenic trioxide decreases expression ISO PKM (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of PKM mRNA and Arsenic Trioxide results in decreased expression of PKM protein CTD PMID:31003765 and PMID:38160894 Pkm Rat diarsenic trioxide multiple interactions ISO PKM (Homo sapiens) 6480464 [Ascorbic Acid co-treated with Arsenic Trioxide] results in decreased expression of PKM protein more ... CTD PMID:15894607 more ... Pkm Rat Dibutyl phosphate affects expression ISO PKM (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of PKM mRNA CTD PMID:37042841 Pkm Rat dibutyl phthalate decreases expression ISO Pkm (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of PKM mRNA CTD PMID:21266533 Pkm Rat dichloroacetic acid decreases expression ISO PKM (Homo sapiens) 6480464 Dichloroacetic Acid results in decreased expression of PKM protein CTD PMID:31654802 Pkm Rat dicrotophos increases expression ISO PKM (Homo sapiens) 6480464 dicrotophos results in increased expression of PKM mRNA CTD PMID:28302478 Pkm Rat dihydroartemisinin affects binding ISO PKM (Homo sapiens) 6480464 artenimol analog binds to PKM protein CTD PMID:26340163 Pkm Rat dihydroartemisinin multiple interactions ISO PKM (Homo sapiens) 6480464 PKM protein inhibits the reaction [artenimol results in increased cleavage of CASP3 protein] more ... CTD PMID:34655567 Pkm Rat diosmetin increases activity ISO PKM (Homo sapiens) 6480464 diosmetin results in increased activity of PKM protein CTD PMID:25388478 Pkm Rat dioxygen increases expression ISO Pkm (Mus musculus) 6480464 Oxygen deficiency results in increased expression of PKM mRNA CTD PMID:20880076 Pkm Rat dioxygen affects expression ISO PKM (Homo sapiens) 6480464 Oxygen deficiency affects the expression of PKM protein CTD PMID:34900531 Pkm Rat dioxygen multiple interactions ISO Pkm (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of PKM mRNA CTD PMID:30529165 Pkm Rat dioxygen increases expression ISO PKM (Homo sapiens) 6480464 Oxygen deficiency results in increased expression of PKM protein CTD PMID:26087400 Pkm Rat dioxygen multiple interactions ISO PKM (Homo sapiens) 6480464 [IL15 protein co-treated with Oxygen deficiency] results in increased expression of PKM mRNA more ... CTD PMID:27129235 and PMID:34900531 Pkm Rat diuron increases expression EXP 6480464 Diuron results in increased expression of PKM mRNA CTD PMID:21551480 Pkm Rat dopamine increases expression ISO PKM (Homo sapiens) 6480464 Dopamine results in increased expression of PKM protein CTD PMID:24675778 Pkm Rat dorsomorphin multiple interactions ISO PKM (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Pkm Rat doxorubicin increases expression ISO Pkm (Mus musculus) 6480464 Doxorubicin results in increased expression of PKM protein CTD PMID:21251210 Pkm Rat doxorubicin decreases expression ISO PKM (Homo sapiens) 6480464 Doxorubicin results in decreased expression of PKM mRNA CTD PMID:29803840 Pkm Rat doxorubicin multiple interactions ISO Pkm (Mus musculus) 6480464 sodium nitrate inhibits the reaction [Doxorubicin results in increased expression of PKM protein] CTD PMID:21251210 Pkm Rat elemental selenium increases expression ISO PKM (Homo sapiens) 6480464 Selenium results in increased expression of PKM mRNA CTD PMID:19244175 Pkm Rat emodin decreases activity EXP 6480464 Emodin results in decreased activity of PKM protein CTD PMID:34971761 Pkm Rat emodin affects localization EXP 6480464 Emodin affects the localization of PKM protein CTD PMID:34971761 Pkm Rat emodin multiple interactions EXP 6480464 [[Emodin inhibits the reaction [PKM protein binds to PKM protein binds to PKM protein binds to PKM protein]] results in increased abundance of [PKM protein binds to PKM protein]] which binds to NFE2L2 protein more ... CTD PMID:34971761 Pkm Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of PKM mRNA CTD PMID:29391264 Pkm Rat Enterolactone multiple interactions ISO PKM (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of PKM mRNA CTD PMID:19167446 Pkm Rat enzyme inhibitor multiple interactions ISO PKM (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of PKM protein CTD PMID:23301498 Pkm Rat ethanol affects splicing ISO Pkm (Mus musculus) 6480464 Ethanol affects the splicing of PKM mRNA CTD PMID:30319688 Pkm Rat flavone multiple interactions ISO PKM (Homo sapiens) 6480464 flavone inhibits the reaction [PKM protein results in increased metabolism of Phosphoenolpyruvate] CTD PMID:25388478 Pkm Rat flavonol multiple interactions ISO PKM (Homo sapiens) 6480464 3-hydroxyflavone inhibits the reaction [PKM protein results in increased metabolism of Phosphoenolpyruvate] CTD PMID:25388478 Pkm Rat folic acid multiple interactions ISO Pkm (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of PKM mRNA and [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of PKM gene CTD PMID:20938992 Pkm Rat formaldehyde increases expression ISO Pkm (Mus musculus) 6480464 Formaldehyde results in increased expression of PKM protein CTD PMID:33259821 Pkm Rat formaldehyde increases expression EXP 6480464 Formaldehyde results in increased expression of PKM protein CTD PMID:33259821 Pkm Rat FR900359 affects phosphorylation ISO PKM (Homo sapiens) 6480464 FR900359 affects the phosphorylation of PKM protein CTD PMID:37730182 Pkm Rat fructose multiple interactions EXP 6480464 [Fructose co-treated with bisphenol A] results in decreased expression of PKM protein CTD PMID:26930160 Pkm Rat fulvestrant multiple interactions ISO PKM (Homo sapiens) 6480464 Fulvestrant inhibits the reaction [3 more ... CTD PMID:28284859 and PMID:32078667 Pkm Rat fulvestrant multiple interactions ISO Pkm (Mus musculus) 6480464 Fulvestrant inhibits the reaction [bisphenol F results in increased expression of PKM protein] CTD PMID:34147605 Pkm Rat furfural multiple interactions ISO PKM (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of PKM protein CTD PMID:38598786 Pkm Rat Fusaric acid multiple interactions ISO PKM (Homo sapiens) 6480464 Galactose affects the reaction [Fusaric Acid results in increased expression of PKM mRNA] more ... CTD PMID:31654802 Pkm Rat Fusaric acid increases expression ISO PKM (Homo sapiens) 6480464 Fusaric Acid results in increased expression of PKM mRNA and Fusaric Acid results in increased expression of PKM protein CTD PMID:31654802 Pkm Rat galactose multiple interactions ISO PKM (Homo sapiens) 6480464 Galactose affects the reaction [Fusaric Acid results in increased expression of PKM mRNA] CTD PMID:31654802 Pkm Rat gemcitabine affects response to substance ISO PKM (Homo sapiens) 6480464 PKM protein alternative form affects the susceptibility to Gemcitabine CTD PMID:38000456 Pkm Rat genistein increases expression EXP 6480464 Genistein results in increased expression of PKM mRNA CTD PMID:12075121 Pkm Rat glucose increases uptake ISO PKM (Homo sapiens) 6480464 PKM protein results in increased uptake of Glucose CTD PMID:22574221 Pkm Rat glucose multiple interactions ISO PKM (Homo sapiens) 6480464 Fulvestrant inhibits the reaction [Glucose promotes the reaction [Estradiol results in increased phosphorylation of PKM protein]] more ... CTD PMID:23086999 more ... Pkm Rat glycine multiple interactions ISO PKM (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] promotes the reaction [Glycine results in increased expression of PKM protein] more ... CTD PMID:39427783 Pkm Rat glycine increases expression ISO PKM (Homo sapiens) 6480464 Glycine results in increased expression of PKM protein CTD PMID:39427783 Pkm Rat glyphosate increases expression ISO Pkm (Mus musculus) 6480464 Glyphosate results in increased expression of PKM mRNA CTD PMID:36572786 Pkm Rat gold atom decreases expression ISO Pkm (Mus musculus) 6480464 Gold analog results in decreased expression of PKM protein CTD PMID:24780912 Pkm Rat gold(0) decreases expression ISO Pkm (Mus musculus) 6480464 Gold analog results in decreased expression of PKM protein CTD PMID:24780912 Pkm Rat GW 3965 multiple interactions ISO Pkm (Mus musculus) 6480464 GW 3965 inhibits the reaction [3 more ... CTD PMID:27052460 Pkm Rat haloperidol increases expression EXP 6480464 Haloperidol results in increased expression of PKM mRNA CTD PMID:15860345 Pkm Rat hydrogen peroxide decreases expression EXP 6480464 Hydrogen Peroxide results in decreased expression of PKM protein CTD PMID:23178681 Pkm Rat hydrogen peroxide decreases expression ISO PKM (Homo sapiens) 6480464 Hydrogen Peroxide results in decreased expression of PKM protein CTD PMID:34581912 Pkm Rat Icaritin decreases expression ISO PKM (Homo sapiens) 6480464 icaritin results in decreased expression of PKM mRNA and icaritin results in decreased expression of PKM protein CTD PMID:38431053 Pkm Rat Icaritin multiple interactions ISO PKM (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [icaritin results in decreased expression of PKM protein] more ... CTD PMID:38431053 Pkm Rat indometacin multiple interactions ISO PKM (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of PKM mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of PKM mRNA CTD PMID:28628672 Pkm Rat ivermectin affects expression ISO PKM (Homo sapiens) 6480464 Ivermectin affects the expression of PKM protein CTD PMID:32959892 Pkm Rat L-ascorbic acid increases expression ISO Pkm (Mus musculus) 6480464 Ascorbic Acid results in increased expression of PKM mRNA CTD PMID:22139585 Pkm Rat L-ascorbic acid decreases expression ISO PKM (Homo sapiens) 6480464 Ascorbic Acid results in decreased expression of PKM mRNA and Ascorbic Acid results in decreased expression of PKM protein CTD PMID:38160894 Pkm Rat L-ascorbic acid affects expression ISO PKM (Homo sapiens) 6480464 Ascorbic Acid affects the expression of PKM protein CTD PMID:38160894 Pkm Rat L-ascorbic acid multiple interactions ISO PKM (Homo sapiens) 6480464 [Ascorbic Acid co-treated with Arsenic Trioxide] results in decreased expression of PKM protein more ... CTD PMID:38160894 Pkm Rat L-methionine multiple interactions ISO Pkm (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of PKM mRNA and [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of PKM gene CTD PMID:20938992 Pkm Rat lactucin affects binding ISO PKM (Homo sapiens) 6480464 lactucin binds to PKM protein CTD PMID:36364182 Pkm Rat lipopolysaccharide increases expression ISO Pkm (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of PKM mRNA and Lipopolysaccharides results in increased expression of PKM protein CTD PMID:27339419 and PMID:36762617 Pkm Rat lipopolysaccharide multiple interactions ISO Pkm (Mus musculus) 6480464 [Lipopolysaccharides co-treated with IFNG1 protein] results in increased expression of PKM protein more ... CTD PMID:36762617 and PMID:38218310 Pkm Rat lovastatin decreases expression ISO Pkm (Mus musculus) 6480464 Lovastatin results in decreased expression of PKM mRNA CTD PMID:20493250 Pkm Rat luteolin increases activity ISO PKM (Homo sapiens) 6480464 Luteolin results in increased activity of PKM protein CTD PMID:25388478 Pkm Rat LY294002 multiple interactions ISO Pkm (Mus musculus) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [bisphenol F results in increased expression of PKM mRNA] and 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [bisphenol F results in increased expression of PKM protein] CTD PMID:34147605 Pkm Rat mercury dichloride multiple interactions ISO PKM (Homo sapiens) 6480464 Mercuric Chloride results in increased expression of and results in increased secretion of PKM protein CTD PMID:24980261 Pkm Rat methamphetamine increases expression EXP 6480464 Methamphetamine results in increased expression of PKM protein CTD PMID:19826936 Pkm Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of PKM mRNA CTD PMID:28903497 Pkm Rat methidathion increases expression ISO Pkm (Mus musculus) 6480464 methidathion results in increased expression of PKM mRNA CTD PMID:34813904 Pkm Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of PKM gene CTD PMID:35440735 Pkm Rat methylazoxymethanol increases expression ISO Pkm (Mus musculus) 6480464 methylazoxymethanol results in increased expression of PKM mRNA CTD PMID:17107856 Pkm Rat methylmercury chloride increases expression ISO PKM (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of PKM mRNA CTD PMID:28001369 Pkm Rat miconazole increases expression ISO Pkm (Mus musculus) 6480464 Miconazole results in increased expression of PKM mRNA CTD PMID:27462272 Pkm Rat N-acetyl-L-cysteine multiple interactions ISO Pkm (Mus musculus) 6480464 Acetylcysteine inhibits the reaction [NOX4 protein promotes the reaction [[Lipopolysaccharides co-treated with IFNG1 protein] results in increased expression of PKM protein]] and Acetylcysteine inhibits the reaction [quinone results in increased degradation of PKM protein] CTD PMID:25437431 and PMID:36762617 Pkm Rat N-acetyl-L-cysteine multiple interactions ISO PKM (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [2 more ... CTD PMID:28284859 more ... Pkm Rat N-methyl-4-phenylpyridinium decreases expression ISO Pkm (Mus musculus) 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of PKM mRNA and 1-Methyl-4-phenylpyridinium results in decreased expression of PKM protein CTD PMID:17475336 and PMID:22776087 Pkm Rat N-methyl-4-phenylpyridinium decreases expression ISO PKM (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of PKM protein CTD PMID:24675778 Pkm Rat naphthalene multiple interactions ISO Pkm (Mus musculus) 6480464 [naphthalene co-treated with CFTR gene mutant form] results in decreased expression of PKM protein CTD PMID:19438287 Pkm Rat nickel dichloride multiple interactions ISO Pkm (Mus musculus) 6480464 HIF1A affects the reaction [nickel chloride results in increased expression of PKM mRNA] CTD PMID:12426141 and PMID:12729255 Pkm Rat nickel dichloride increases expression ISO Pkm (Mus musculus) 6480464 nickel chloride results in increased expression of PKM mRNA CTD PMID:12426141 more ... Pkm Rat nickel subsulfide affects expression ISO Pkm (Mus musculus) 6480464 nickel subsulfide affects the expression of PKM mRNA CTD PMID:12729255 Pkm Rat niclosamide increases expression ISO PKM (Homo sapiens) 6480464 Niclosamide results in increased expression of PKM mRNA CTD PMID:22576131 Pkm Rat nitrates multiple interactions ISO Pkm (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of PKM mRNA CTD PMID:35964746 Pkm Rat Nutlin-3 multiple interactions ISO PKM (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of PKM protein CTD PMID:38460933 Pkm Rat ochratoxin A multiple interactions ISO PKM (Homo sapiens) 6480464 ochratoxin A results in increased phosphorylation of and results in decreased activity of and affects the localization of PKM protein CTD PMID:32835834 Pkm Rat ozone multiple interactions ISO PKM (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of PKM mRNA more ... CTD PMID:32699268 Pkm Rat ozone multiple interactions ISO Pkm (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of PKM mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of PKM mRNA CTD PMID:34911549 Pkm Rat paclitaxel affects response to substance ISO PKM (Homo sapiens) 6480464 PKM protein affects the susceptibility to Paclitaxel CTD PMID:16217747 Pkm Rat panobinostat increases expression ISO PKM (Homo sapiens) 6480464 panobinostat results in increased expression of PKM mRNA CTD PMID:26272509 Pkm Rat panobinostat multiple interactions ISO PKM (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PKM mRNA CTD PMID:27188386 Pkm Rat paracetamol affects expression ISO Pkm (Mus musculus) 6480464 Acetaminophen affects the expression of PKM mRNA CTD PMID:17562736 Pkm Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of PKM mRNA CTD PMID:33387578 Pkm Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of PKM mRNA CTD PMID:32680482 Pkm Rat PCB138 decreases expression EXP 6480464 2 more ... CTD PMID:21673325 Pkm Rat perfluorooctane-1-sulfonic acid increases expression ISO PKM (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in increased expression of PKM mRNA CTD PMID:27153767 Pkm Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Pkm (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PKM mRNA CTD PMID:36331819 Pkm Rat phenobarbital decreases expression ISO Pkm (Mus musculus) 6480464 Phenobarbital results in decreased expression of PKM mRNA CTD PMID:19363144 Pkm Rat phenylmercury acetate increases expression ISO PKM (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of PKM mRNA CTD PMID:26272509 Pkm Rat phenylmercury acetate multiple interactions ISO PKM (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PKM mRNA CTD PMID:27188386 Pkm Rat PhIP increases expression EXP 6480464 2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in increased expression of PKM mRNA CTD PMID:15215175 Pkm Rat phosphoenolpyruvate multiple interactions ISO PKM (Homo sapiens) 6480464 3-hydroxyflavone inhibits the reaction [PKM protein results in increased metabolism of Phosphoenolpyruvate] more ... CTD PMID:25388478 Pkm Rat phosphoenolpyruvate increases metabolic processing ISO PKM (Homo sapiens) 6480464 PKM protein results in increased metabolism of Phosphoenolpyruvate CTD PMID:25388478 Pkm Rat pifithrin-alpha hydrobromide multiple interactions ISO PKM (Homo sapiens) 6480464 pifithrin inhibits the reaction [icaritin results in decreased expression of PKM mRNA] and pifithrin inhibits the reaction [icaritin results in decreased expression of PKM protein] CTD PMID:38431053 Pkm Rat potassium dichromate increases expression ISO PKM (Homo sapiens) 6480464 Potassium Dichromate results in increased expression of PKM protein CTD PMID:20332019 more ... Pkm Rat potassium dichromate multiple interactions ISO PKM (Homo sapiens) 6480464 3-methyladenine inhibits the reaction [Potassium Dichromate results in increased expression of PKM protein] more ... CTD PMID:32569804 and PMID:36473502 Pkm Rat progesterone affects expression ISO Pkm (Mus musculus) 6480464 Progesterone affects the expression of PKM mRNA CTD PMID:17251523 Pkm Rat promethazine decreases expression EXP 6480464 Promethazine results in decreased expression of PKM mRNA CTD PMID:28903497 Pkm Rat Propiverine affects binding EXP 6480464 propiverine binds to PKM protein CTD PMID:29273565 Pkm Rat quartz affects expression ISO PKM (Homo sapiens) 6480464 Quartz affects the expression of PKM protein CTD PMID:27917503 Pkm Rat quercetin decreases expression ISO PKM (Homo sapiens) 6480464 Quercetin results in decreased expression of PKM protein CTD PMID:15221776 and PMID:35945655 Pkm Rat quercetin multiple interactions ISO PKM (Homo sapiens) 6480464 G3BP1 protein inhibits the reaction [Quercetin results in decreased expression of PKM protein] CTD PMID:35945655 Pkm Rat quercetin increases expression ISO PKM (Homo sapiens) 6480464 Quercetin results in increased expression of PKM mRNA and Quercetin results in increased expression of PKM protein CTD PMID:14750173 and PMID:21632981 Pkm Rat rac-lactic acid increases abundance ISO PKM (Homo sapiens) 6480464 PKM protein results in increased abundance of Lactic Acid CTD PMID:22574221 Pkm Rat rac-lactic acid multiple interactions ISO PKM (Homo sapiens) 6480464 Lactic Acid promotes the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PKM protein] more ... CTD PMID:36336208 Pkm Rat rac-lactic acid increases expression ISO PKM (Homo sapiens) 6480464 Lactic Acid results in increased expression of PKM protein CTD PMID:36336208 Pkm Rat reactive oxygen species multiple interactions ISO Pkm (Mus musculus) 6480464 Reactive Oxygen Species affects the reaction [quinone results in increased degradation of PKM protein] CTD PMID:25437431 Pkm Rat resveratrol multiple interactions ISO PKM (Homo sapiens) 6480464 [resveratrol results in decreased activity of MTOR protein] which results in decreased expression of PKM mRNA and [resveratrol results in decreased activity of MTOR protein] which results in decreased expression of PKM protein CTD PMID:22574221 Pkm Rat resveratrol increases expression EXP 6480464 resveratrol results in increased expression of PKM mRNA CTD PMID:25905778 Pkm Rat resveratrol decreases response to substance ISO PKM (Homo sapiens) 6480464 PKM protein results in decreased susceptibility to resveratrol CTD PMID:22574221 Pkm Rat rotenone increases oxidation EXP 6480464 Rotenone results in increased oxidation of PKM protein CTD PMID:30951809 Pkm Rat SAICAR multiple interactions ISO PKM (Homo sapiens) 6480464 Glucose deficiency promotes the reaction [SAICAR binds to and results in increased activity of PKM protein] CTD PMID:23086999 Pkm Rat SB 431542 multiple interactions ISO PKM (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 and PMID:37664457 Pkm Rat scutellarin increases activity ISO PKM (Homo sapiens) 6480464 scutellarin results in increased activity of PKM protein CTD PMID:25388478 Pkm Rat selenium atom increases expression ISO PKM (Homo sapiens) 6480464 Selenium results in increased expression of PKM mRNA CTD PMID:19244175 Pkm Rat Shikonin multiple interactions ISO Pkm (Mus musculus) 6480464 shikonin inhibits the reaction [[Tobacco Smoke Pollution results in increased abundance of Particulate Matter] which results in increased expression of PKM protein] CTD PMID:35787437 Pkm Rat silicon dioxide increases secretion ISO PKM (Homo sapiens) 6480464 Silicon Dioxide analog results in increased secretion of PKM protein CTD PMID:25895662 Pkm Rat silicon dioxide affects expression ISO PKM (Homo sapiens) 6480464 Silicon Dioxide affects the expression of PKM protein CTD PMID:27917503 Pkm Rat sirolimus multiple interactions ISO PKM (Homo sapiens) 6480464 [Sirolimus results in decreased activity of MTOR protein] which results in decreased expression of PKM protein more ... CTD PMID:22574221 more ... Pkm Rat sirolimus increases expression ISO PKM (Homo sapiens) 6480464 Sirolimus results in increased expression of PKM protein CTD PMID:36640941 Pkm Rat sodium arsenite affects expression ISO Pkm (Mus musculus) 6480464 sodium arsenite affects the expression of PKM mRNA CTD PMID:17450228 Pkm Rat sodium arsenite decreases expression ISO PKM (Homo sapiens) 6480464 sodium arsenite results in decreased expression of PKM mRNA CTD PMID:37956786 and PMID:38568856 Pkm Rat sodium arsenite affects expression ISO PKM (Homo sapiens) 6480464 sodium arsenite affects the expression of PKM mRNA CTD PMID:34032870 Pkm Rat sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of PKM mRNA and sodium arsenite results in decreased expression of PKM protein CTD PMID:29459688 and PMID:35314868 Pkm Rat sodium arsenite increases expression ISO PKM (Homo sapiens) 6480464 sodium arsenite results in increased expression of PKM mRNA CTD PMID:28595984 Pkm Rat sodium chloride multiple interactions ISO PKM (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of PKM protein more ... CTD PMID:38598786 Pkm Rat sodium fluoride increases expression ISO Pkm (Mus musculus) 6480464 Sodium Fluoride results in increased expression of PKM protein CTD PMID:27548804 Pkm Rat sodium nitrate multiple interactions ISO Pkm (Mus musculus) 6480464 sodium nitrate inhibits the reaction [Doxorubicin results in increased expression of PKM protein] CTD PMID:21251210 Pkm Rat sorafenib multiple interactions ISO PKM (Homo sapiens) 6480464 [SNHG1 protein affects the susceptibility to Sorafenib] which affects the expression of PKM protein CTD PMID:37927237 Pkm Rat streptozocin affects expression ISO Pkm (Mus musculus) 6480464 Streptozocin affects the expression of PKM mRNA CTD PMID:18583417 Pkm Rat sulindac sulfide decreases expression ISO PKM (Homo sapiens) 6480464 sulindac sulfide results in decreased expression of PKM mRNA CTD PMID:16184548 Pkm Rat sunitinib increases expression ISO PKM (Homo sapiens) 6480464 Sunitinib results in increased expression of PKM mRNA CTD PMID:31533062 Pkm Rat T-2 toxin affects expression EXP 6480464 T-2 Toxin affects the expression of PKM protein CTD PMID:26141394 Pkm Rat tanespimycin decreases expression ISO PKM (Homo sapiens) 6480464 tanespimycin results in decreased expression of PKM protein CTD PMID:31370342 Pkm Rat tangeretin increases activity ISO PKM (Homo sapiens) 6480464 tangeretin results in increased activity of PKM protein CTD PMID:25388478 Pkm Rat temozolomide decreases expression ISO PKM (Homo sapiens) 6480464 Temozolomide results in decreased expression of PKM mRNA CTD PMID:31758290 Pkm Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of PKM protein CTD PMID:12629582 Pkm Rat tetrachloromethane increases expression ISO Pkm (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of PKM mRNA CTD PMID:27339419 and PMID:31919559 Pkm Rat thapsigargin decreases expression ISO PKM (Homo sapiens) 6480464 Thapsigargin results in decreased expression of PKM mRNA CTD PMID:22378314 Pkm Rat thapsigargin increases expression EXP 6480464 Thapsigargin results in increased expression of PKM protein CTD PMID:35544339 Pkm Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of PKM mRNA CTD PMID:28903497 and PMID:34492290 Pkm Rat thiram decreases expression ISO PKM (Homo sapiens) 6480464 Thiram results in decreased expression of PKM mRNA CTD PMID:38568856 Pkm Rat titanium dioxide decreases methylation ISO Pkm (Mus musculus) 6480464 titanium dioxide results in decreased methylation of PKM enhancer and titanium dioxide results in decreased methylation of PKM gene CTD PMID:35295148 Pkm Rat tributylstannane increases expression ISO Pkm (Mus musculus) 6480464 tributyltin results in increased expression of PKM mRNA CTD PMID:31939706 Pkm Rat trichloroethene affects expression ISO Pkm (Mus musculus) 6480464 Trichloroethylene affects the expression of PKM mRNA CTD PMID:21135412 Pkm Rat trichostatin A increases expression ISO PKM (Homo sapiens) 6480464 trichostatin A results in increased expression of PKM mRNA CTD PMID:24935251 and PMID:26272509 Pkm Rat trichostatin A multiple interactions ISO PKM (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PKM mRNA CTD PMID:27188386 Pkm Rat triclosan decreases expression ISO PKM (Homo sapiens) 6480464 Triclosan results in decreased expression of PKM mRNA CTD PMID:30510588 Pkm Rat trimellitic anhydride increases expression ISO Pkm (Mus musculus) 6480464 trimellitic anhydride results in increased expression of PKM mRNA CTD PMID:19042947 Pkm Rat triphenylstannane decreases expression ISO PKM (Homo sapiens) 6480464 triphenyltin analog results in decreased expression of PKM protein CTD PMID:31634547 Pkm Rat Triptolide decreases expression ISO Pkm (Mus musculus) 6480464 triptolide results in decreased expression of PKM mRNA CTD PMID:34087332 Pkm Rat tunicamycin decreases expression ISO PKM (Homo sapiens) 6480464 Tunicamycin results in decreased expression of PKM mRNA CTD PMID:22378314 Pkm Rat tunicamycin multiple interactions ISO PKM (Homo sapiens) 6480464 PHGDH protein affects the reaction [Tunicamycin results in increased expression of PKM protein] CTD PMID:39427783 Pkm Rat tunicamycin increases expression ISO PKM (Homo sapiens) 6480464 Tunicamycin results in increased expression of PKM protein CTD PMID:36473502 and PMID:39427783 Pkm Rat ubiquinone-0 decreases expression ISO PKM (Homo sapiens) 6480464 ubiquinone-O results in decreased expression of PKM protein CTD PMID:36847822 Pkm Rat undecane decreases expression EXP 6480464 undecane results in decreased expression of PKM protein CTD PMID:17337753 Pkm Rat valproic acid increases expression ISO PKM (Homo sapiens) 6480464 Valproic Acid results in increased expression of PKM mRNA CTD PMID:23179753 more ... Pkm Rat valproic acid multiple interactions ISO PKM (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PKM mRNA CTD PMID:27188386 Pkm Rat vitamin E increases expression ISO PKM (Homo sapiens) 6480464 Vitamin E results in increased expression of PKM mRNA CTD PMID:19244175 Pkm Rat vorinostat increases expression ISO PKM (Homo sapiens) 6480464 vorinostat results in increased expression of PKM mRNA CTD PMID:26272509 Pkm Rat vorinostat multiple interactions ISO PKM (Homo sapiens) 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PKM mRNA CTD PMID:27188386 Pkm Rat warfarin decreases expression ISO Pkm (Mus musculus) 6480464 Warfarin results in decreased expression of PKM mRNA CTD PMID:20493250 Pkm Rat wogonin multiple interactions ISO PKM (Homo sapiens) 6480464 wogonin inhibits the reaction [PKM protein results in increased metabolism of Phosphoenolpyruvate] CTD PMID:25388478 Pkm Rat Yessotoxin increases expression ISO PKM (Homo sapiens) 6480464 yessotoxin analog results in increased expression of PKM mRNA CTD PMID:30679557 Pkm Rat zinc atom decreases expression ISO PKM (Homo sapiens) 6480464 Zinc results in decreased expression of PKM protein CTD PMID:15984569 Pkm Rat zinc(0) decreases expression ISO PKM (Homo sapiens) 6480464 Zinc results in decreased expression of PKM protein CTD PMID:15984569
Imported Annotations - PID (archival)
(1->4)-beta-D-glucan (ISO) (R)-adrenaline (EXP,ISO) 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (ISO) 1,2,4-trimethylbenzene (EXP) 1,4-benzoquinone (ISO) 1-chloro-2,4-dinitrobenzene (ISO) 14-Deoxy-11,12-didehydroandrographolide (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP,ISO) 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP) 2,4-dinitrotoluene (EXP) 2,5-hexanedione (EXP) 2,6-dimethoxyphenol (ISO) 2-acetamidofluorene (EXP) 2-deoxy-D-glucose (ISO) 2-hydroxypropanoic acid (ISO) 2-methoxyethanol (EXP) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3,5-diethoxycarbonyl-1,4-dihydrocollidine (ISO) 3-chloropropane-1,2-diol (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3-methyladenine (ISO) 3-phenylprop-2-enal (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-chlorobiphenyl (ISO) 4-hydroxynon-2-enal (ISO) 4-phenylbutyric acid (ISO) 5-aza-2'-deoxycytidine (ISO) 5-azacytidine (ISO) 5-Hydroxyflavone (ISO) 6-Hydroxyflavone (ISO) 7-hydroxyflavone (ISO) 7H-xanthine (EXP) 9-cis-retinoic acid (ISO) 9H-xanthine (EXP) acetamide (EXP) acrolein (ISO) acrylamide (EXP) actinomycin D (ISO) aflatoxin B1 (ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (ISO) alpha-D-galactose (ISO) alpha-naphthoflavone (ISO) alpha-pinene (ISO) alpha-Zearalanol (EXP) ammonium chloride (EXP) ampicillin (ISO) apigenin (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) atorvastatin calcium (EXP) atrazine (ISO) baicalein (ISO) baicalin (ISO) Bardoxolone methyl (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) beta-lapachone (ISO) bifenthrin (ISO) bis(2-chloroethyl) sulfide (EXP) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) bruceine D (ISO) C.I. Natural Red 20 (ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) cadmium sulfate (ISO) caffeine (ISO) carbon nanotube (ISO) CCCP (ISO) celastrol (ISO) CGP 52608 (ISO) chloromethylisothiazolinone (ISO) choline (ISO) chromium(6+) (ISO) cisplatin (ISO) clobetasol (ISO) clozapine (EXP) cobalt dichloride (ISO) cocaine (EXP) copper atom (ISO) copper(0) (ISO) coumarin (ISO) coumestrol (ISO) crocidolite asbestos (ISO) curcumin (ISO) cyclosporin A (ISO) D-glucose (ISO) DDT (ISO) dexamethasone (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) dichloroacetic acid (ISO) dicrotophos (ISO) dihydroartemisinin (ISO) diosmetin (ISO) dioxygen (ISO) diuron (EXP) dopamine (ISO) dorsomorphin (ISO) doxorubicin (ISO) elemental selenium (ISO) emodin (EXP) endosulfan (EXP) Enterolactone (ISO) enzyme inhibitor (ISO) ethanol (ISO) flavone (ISO) flavonol (ISO) folic acid (ISO) formaldehyde (EXP,ISO) FR900359 (ISO) fructose (EXP) fulvestrant (ISO) furfural (ISO) Fusaric acid (ISO) galactose (ISO) gemcitabine (ISO) genistein (EXP) glucose (ISO) glycine (ISO) glyphosate (ISO) gold atom (ISO) gold(0) (ISO) GW 3965 (ISO) haloperidol (EXP) hydrogen peroxide (EXP,ISO) Icaritin (ISO) indometacin (ISO) ivermectin (ISO) L-ascorbic acid (ISO) L-methionine (ISO) lactucin (ISO) lipopolysaccharide (ISO) lovastatin (ISO) luteolin (ISO) LY294002 (ISO) mercury dichloride (ISO) methamphetamine (EXP) methapyrilene (EXP) methidathion (ISO) methoxychlor (EXP) methylazoxymethanol (ISO) methylmercury chloride (ISO) miconazole (ISO) N-acetyl-L-cysteine (ISO) N-methyl-4-phenylpyridinium (ISO) naphthalene (ISO) nickel dichloride (ISO) nickel subsulfide (ISO) niclosamide (ISO) nitrates (ISO) Nutlin-3 (ISO) ochratoxin A (ISO) ozone (ISO) paclitaxel (ISO) panobinostat (ISO) paracetamol (EXP,ISO) paraquat (EXP) PCB138 (EXP) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) phenylmercury acetate (ISO) PhIP (EXP) phosphoenolpyruvate (ISO) pifithrin-alpha hydrobromide (ISO) potassium dichromate (ISO) progesterone (ISO) promethazine (EXP) Propiverine (EXP) quartz (ISO) quercetin (ISO) rac-lactic acid (ISO) reactive oxygen species (ISO) resveratrol (EXP,ISO) rotenone (EXP) SAICAR (ISO) SB 431542 (ISO) scutellarin (ISO) selenium atom (ISO) Shikonin (ISO) silicon dioxide (ISO) sirolimus (ISO) sodium arsenite (EXP,ISO) sodium chloride (ISO) sodium fluoride (ISO) sodium nitrate (ISO) sorafenib (ISO) streptozocin (ISO) sulindac sulfide (ISO) sunitinib (ISO) T-2 toxin (EXP) tanespimycin (ISO) tangeretin (ISO) temozolomide (ISO) tetrachloromethane (EXP,ISO) thapsigargin (EXP,ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) tributylstannane (ISO) trichloroethene (ISO) trichostatin A (ISO) triclosan (ISO) trimellitic anhydride (ISO) triphenylstannane (ISO) Triptolide (ISO) tunicamycin (ISO) ubiquinone-0 (ISO) undecane (EXP) valproic acid (ISO) vitamin E (ISO) vorinostat (ISO) warfarin (ISO) wogonin (ISO) Yessotoxin (ISO) zinc atom (ISO) zinc(0) (ISO)
1.
Alteration in the capacities as well as in the zonal and cellular distributions of pyruvate kinase L and M2 in regenerating rat liver.
Chatzipanagiotou S, etal., Biol Chem Hoppe Seyler. 1985 Mar;366(3):271-80.
2.
Effects of Tianshu Capsule on Spontaneously Hypertensive Rats as Revealed by 1H-NMR-Based Metabolic Profiling.
Gao J, etal., Front Pharmacol. 2019 Sep 11;10:989. doi: 10.3389/fphar.2019.00989. eCollection 2019.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
5.
Relationships between concentration of hepatic intermediary metabolites and induction of the key glycolytic enzymes in vivo.
Gunn JM and Taylor CB, Biochem J. 1973 Nov;136(3):455-65.
6.
Use of adenine nucleotide derivatives to assess the potential of exo-active-site-directed reagents as species- or isozyme-specific enzyme inactivators. 5. Interactions of adenosine 5'-triphosphate derivatives with rat pyruvate kinases, Escherichia coli thymidine kinase, and yeast and rat hexokinases.
Hampton A, etal., J Med Chem. 1982 Apr;25(4):386-92.
7.
Dominant negative role of the glutamic acid residue conserved in the pyruvate kinase M(1) isozyme in the heterotropic allosteric effect involving fructose-1,6-bisphosphate.
Ikeda Y, etal., J Biol Chem. 2000 Mar 31;275(13):9150-6. doi: 10.1074/jbc.275.13.9150.
8.
Control of glucose utilization in working perfused rat heart.
Kashiwaya Y, etal., J Biol Chem. 1994 Oct 14;269(41):25502-14.
9.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
10.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
11.
Metabolic cooperation between different oncogenes during cell transformation: interaction between activated ras and HPV-16 E7.
Mazurek S, etal., Oncogene. 2001 Oct 18;20(47):6891-8. doi: 10.1038/sj.onc.1204792.
12.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
13.
Dietary whey protein increases liver and skeletal muscle glycogen levels in exercise-trained rats.
Morifuji M, etal., Br J Nutr. 2005 Apr;93(4):439-45.
14.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
15.
Increased striatal mRNA and protein levels of the immunophilin FKBP-12 in experimental Parkinson's disease and identification of FKBP-12-binding proteins.
Nilsson A, etal., J Proteome Res. 2007 Oct;6(10):3952-61. Epub 2007 Sep 18.
16.
The M1- and M2-type isozymes of rat pyruvate kinase are produced from the same gene by alternative RNA splicing.
Noguchi T, etal., J Biol Chem 1986 Oct 15;261(29):13807-12.
17.
The monomer of pyruvate kinase, subtype M1, is both a kinase and a cytosolic thyroid hormone binding protein.
Parkison C, etal., Biochem Biophys Res Commun. 1991 Aug 30;179(1):668-74.
18.
The nucleotide sequence of a full length cDNA encoding rat pituitary pyruvate kinase.
Parkison C, etal., Nucleic Acids Res 1989 Sep 12;17(17):7106.
19.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
20.
Response of rat cerebral glycolytic enzymes to hyperammonemic states.
Ratnakumari L and Murthy CR, Neurosci Lett. 1993 Oct 14;161(1):37-40.
21.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
22.
Metabolic adaptation of muscles to exercise, vibration and raised temperature under the influence of cernitins.
Sawicka TJ, etal., Acta Physiol Pol. 1984 Mar-Apr;35(2):141-50.
23.
Energy metabolism pathways in rat muscle under conditions of simulated microgravity.
Stein T, etal., J Nutr Biochem. 2002 Aug;13(8):471.
24.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
25.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
26.
Effect of immobilization on some glycolytic enzymes of skeletal muscle.
Vereb G, etal., Acta Physiol Hung. 1984;63(1):55-61.
27.
Developmental patterns of glycolytic enzymes in regenerating skeletal muscle after autogenous free grafting.
Wagner KR, etal., J Neurol Sci. 1977 Dec;34(3):373-90.
28.
Regulation of glycolytic enzyme RNA transcriptional rates by oxygen availability in skeletal muscle cells.
Webster KA Mol Cell Biochem. 1987 Sep;77(1):19-28.
29.
Biosynthesis of pyruvate kinase isozymes in rat liver.
Wu SW, etal., Eur J Biochem. 1981 Dec;121(1):59-63.
Pkm Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 68,949,731 - 68,975,394 (+) NCBI GRCr8 mRatBN7.2 8 60,057,629 - 60,079,600 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 60,057,402 - 60,079,599 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 65,580,124 - 65,601,628 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 63,853,049 - 63,874,553 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 61,722,501 - 61,744,005 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 64,480,963 - 64,502,957 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 64,481,172 - 64,502,722 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 64,243,957 - 64,265,970 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 63,486,492 - 63,508,016 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 63,505,545 - 63,527,070 (+) NCBI Celera 8 59,500,837 - 59,522,361 (+) NCBI Celera RH 3.4 Map 8 703.1 RGD Cytogenetic Map 8 q24 NCBI
PKM Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 15 72,199,029 - 72,231,591 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 15 72,199,029 - 72,231,819 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 15 72,491,370 - 72,523,531 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 15 70,278,424 - 70,310,738 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 15 70,278,423 - 70,310,738 NCBI Celera 15 49,377,704 - 49,410,018 (-) NCBI Celera Cytogenetic Map 15 q23 NCBI HuRef 15 49,321,965 - 49,354,312 (-) NCBI HuRef CHM1_1 15 72,609,505 - 72,641,870 (-) NCBI CHM1_1 T2T-CHM13v2.0 15 70,015,755 - 70,047,883 (-) NCBI T2T-CHM13v2.0
Pkm Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 59,563,859 - 59,586,655 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 59,563,651 - 59,586,658 (+) Ensembl GRCm39 Ensembl GRCm38 9 59,656,576 - 59,679,372 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 59,656,368 - 59,679,375 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 59,504,415 - 59,527,182 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 59,454,614 - 59,477,381 (+) NCBI MGSCv36 mm8 Celera 9 56,883,742 - 56,906,668 (+) NCBI Celera Cytogenetic Map 9 B NCBI cM Map 9 32.03 NCBI
Pkm Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955450 4,907,788 - 4,936,199 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955450 4,907,962 - 4,935,179 (+) NCBI ChiLan1.0 ChiLan1.0
PKM Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 16 61,463,312 - 61,495,601 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 15 65,627,528 - 65,659,784 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 15 51,149,584 - 51,182,193 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 15 69,913,455 - 69,946,070 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 15 69,913,455 - 69,945,832 (-) Ensembl panpan1.1 panPan2
PKM Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 30 35,712,853 - 35,737,643 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 30 35,649,842 - 35,676,381 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 30 35,917,488 - 35,942,263 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 30 35,912,436 - 35,944,108 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 30 35,870,513 - 35,897,163 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 30 35,898,407 - 35,923,216 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 30 36,153,315 - 36,179,852 (-) NCBI UU_Cfam_GSD_1.0
Pkm Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 113,741,261 - 113,769,688 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936471 31,589,324 - 31,617,873 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936471 31,589,322 - 31,617,891 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PKM Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 61,013,723 - 61,032,777 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 Ensembl 7 60,975,667 - 61,004,316 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 60,971,807 - 61,032,780 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 65,514,303 - 65,575,391 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PKM
Pkm
.
Predicted Target Of
Count of predictions: 326 Count of miRNA genes: 185 Interacting mature miRNAs: 200 Transcripts: ENSRNOT00000015332 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
1298065 Scl16 Serum cholesterol level QTL 16 3.8 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30856404 75856404 Rat 1554321 Bmd3 Bone mineral density QTL 3 7.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 40952565 123900184 Rat 1578769 Uae31 Urinary albumin excretion QTL 31 3.3 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 30848154 101699754 Rat 1298079 Activ2 Activity QTL 2 9.5 0.000001 voluntary movement trait (VT:0003491) rearing measurement (CMO:0001515) 8 41866876 86866876 Rat 11556286 Cm81 Cardiac mass QTL 81 0.01 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 30848154 61290444 Rat 70161 Bp62 Blood pressure QTL 62 2.9 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 42692684 90165460 Rat 1578765 Klgr1 Kidney lesion grade QTL 1 3.3 0.0001 kidney morphology trait (VT:0002135) organ lesion measurement (CMO:0000677) 8 30848154 101699754 Rat 1582222 Epfw2 Epididymal fat weight QTL 2 3.2 0.0005 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 8 31737729 76737729 Rat 61464 Niddm11 Non-insulin dependent diabetes mellitus QTL 11 3.1 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 35582032 80582032 Rat 4889938 Bss89 Bone structure and strength QTL 89 3.8 tibia size trait (VT:0100001) tibia cortical bone volume (CMO:0001725) 8 50095249 82460899 Rat 1578755 Pur5 Proteinuria QTL 5 3.3 0.0001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 8 30848154 101699754 Rat 1300146 Rf17 Renal function QTL 17 2.9 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 8 28242912 73242912 Rat 8662823 Vetf5 Vascular elastic tissue fragility QTL 5 1.9 artery integrity trait (VT:0010639) patent ductus arteriosus score (CMO:0002566) 8 28242912 99525068 Rat 2313088 Bss75 Bone structure and strength QTL 75 3.1 0.0001 body length (VT:0001256) body length, nose to rump (CMO:0000079) 8 30848154 82460899 Rat 1358896 Bp262 Blood pressure QTL 262 2.89 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 27205715 99103503 Rat 731182 Uae24 Urinary albumin excretion QTL 24 6.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 19331152 93965294 Rat 724514 Uae15 Urinary albumin excretion QTL 15 2.9 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 29502665 70386295 Rat 61353 Bp35 Blood pressure QTL 35 0.001 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 8 30848154 61290444 Rat 631842 Inf1 Infertility severity QTL 1 4.1 0.001 seminal gland mass (VT:0010524) seminal vesicle wet weight (CMO:0001603) 8 22662330 67662330 Rat 737824 Hcar10 Hepatocarcinoma resistance QTL 10 2.9 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 8 40713066 82925667 Rat 1359033 Bp273 Blood pressure QTL 273 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 30848154 61290444 Rat 1331769 Rf39 Renal function QTL 39 3.871 urine output (VT:0003620) timed urine volume (CMO:0000260) 8 41866876 75097878 Rat 61358 Bp39 Blood pressure QTL 39 2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 35551938 80551938 Rat 1358906 Bp253 Blood pressure QTL 253 4 0.0004 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 40713066 93965294 Rat 1358907 Cm40 Cardiac mass QTL 40 1.89 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 27205715 99103503 Rat 70197 BpQTLcluster8 Blood pressure QTL cluster 8 3.482 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 46531639 119088626 Rat 2316950 Scl66 Serum cholesterol level QTL 66 4.1 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30848259 105647037 Rat 1582254 Kidm31 Kidney mass QTL 31 3 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 8 54237644 85365202 Rat 10402857 Bp380 Blood pressure QTL 380 0.95 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 53968765 98968765 Rat 1358892 Kidm26 Kidney mass QTL 26 3.69 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 27205715 99103503 Rat 631216 Stl9 Serum triglyceride level QTL 9 4.71 0.0001 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 8 41867010 70386132 Rat 5684973 Bss100 Bone structure and strength QTL 100 4.7 tibia area (VT:1000281) tibia area measurement (CMO:0001382) 8 50095249 82460899 Rat 1582243 Bw66 Body weight QTL 66 3.4 0.0048 body mass (VT:0001259) body weight (CMO:0000012) 8 54237644 85365202 Rat 61373 Mcs4 Mammary carcinoma susceptibility QTL 4 1.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 8 16290444 61290444 Rat 2313057 Bss76 Bone structure and strength QTL 76 3 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 8 30848154 82460899 Rat 12879878 Bw183 Body weight QTL 183 0.001 body mass (VT:0001259) body weight (CMO:0000012) 8 43296169 98968765 Rat 1300177 Cm2 Cardiac mass QTL 2 3.65 heart mass (VT:0007028) heart weight (CMO:0000017) 8 54259986 100382532 Rat 1549908 Neudeg1 Neurodegradation QTL 1 5.5 0 nervous system integrity trait (VT:0010566) logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986) 8 30188867 94457446 Rat 12879879 Cm99 Cardiac mass QTL 99 0.001 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 43296169 98968765 Rat 2313067 Bss77 Bone structure and strength QTL 77 3.1 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 8 30848154 82460899 Rat 12879880 Cm100 Cardiac mass QTL 100 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 8 43296169 98968765 Rat 12879881 Cm101 Cardiac mass QTL 101 0.001 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 8 43296169 98968765 Rat 12879882 Am8 Aortic mass QTL 8 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 8 43296169 98968765 Rat 12879883 Kidm65 Kidney mass QTL 65 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 43296169 98968765 Rat 1358912 Bw51 Body weight QTL 51 2.95 body mass (VT:0001259) body weight (CMO:0000012) 8 51351728 107062046 Rat 2313086 Bss60 Bone structure and strength QTL 60 4.1 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 8 50095249 82460899 Rat 2293697 Bmd39 Bone mineral density QTL 39 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 8 54043744 98968765 Rat 1331837 Bw23 Body weight QTL 23 4.19 0.00007 body mass (VT:0001259) body weight (CMO:0000012) 8 46531722 99083736 Rat 1331838 Niddm61 Non-insulin dependent diabetes mellitus QTL 61 3.53 0.0004 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 36469535 99083736 Rat 631650 Stl6 Serum triglyceride level QTL 6 4 0.0019 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 10378157 112202585 Rat 1581557 Eae16 Experimental allergic encephalomyelitis QTL 16 3.8 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 8 8462195 110921472 Rat 631271 Lecl1 Lens clarity QTL 1 0.001 lens clarity trait (VT:0001304) age of onset/diagnosis of cataract (CMO:0001584) 8 18984168 84531599 Rat 2303564 Gluco43 Glucose level QTL 43 3 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 26130187 71130187 Rat 2303570 Gluco48 Glucose level QTL 48 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 49805831 94805831 Rat 2313046 Bss78 Bone structure and strength QTL 78 3.5 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 8 30848154 82460899 Rat 2303572 Insul13 Insulin level QTL 13 2 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 8 26130187 71130187 Rat 2301402 Bp316 Blood pressure QTL 316 0.005 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 53968765 98968765 Rat 631664 Hcar3 Hepatocarcinoma resistance QTL 3 2.9 0.0005 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 8 54237644 99103503 Rat
RH94821
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 8 68,968,206 - 68,968,480 (+) Marker Load Pipeline mRatBN7.2 8 60,072,412 - 60,072,686 (+) MAPPER mRatBN7.2 Rnor_6.0 8 64,495,746 - 64,496,019 NCBI Rnor6.0 Rnor_5.0 8 64,258,759 - 64,259,032 UniSTS Rnor5.0 RGSC_v3.4 8 63,501,064 - 63,501,337 UniSTS RGSC3.4 Celera 8 59,515,409 - 59,515,682 UniSTS RH 3.4 Map 8 703.1 UniSTS Cytogenetic Map 8 q24 UniSTS
Pkm2
Rat Assembly Chr Position (strand) Source JBrowse Celera 8 59,519,198 - 59,519,266 UniSTS Cytogenetic Map 8 q24 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000015332 ⟹ ENSRNOP00000015331
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 60,057,798 - 60,079,590 (+) Ensembl Rnor_6.0 Ensembl 8 64,481,172 - 64,502,722 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000083666 ⟹ ENSRNOP00000069474
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 60,057,402 - 60,079,594 (+) Ensembl Rnor_6.0 Ensembl 8 64,489,942 - 64,502,429 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000098634 ⟹ ENSRNOP00000079846
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 60,059,124 - 60,079,594 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000118042 ⟹ ENSRNOP00000089941
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 60,059,124 - 60,079,599 (+) Ensembl
RefSeq Acc Id:
NM_053297 ⟹ NP_445749
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 68,953,635 - 68,975,159 (+) NCBI mRatBN7.2 8 60,057,840 - 60,079,365 (+) NCBI Rnor_6.0 8 64,481,174 - 64,502,722 (+) NCBI Rnor_5.0 8 64,243,957 - 64,265,970 (+) NCBI RGSC_v3.4 8 63,486,492 - 63,508,016 (+) RGD Celera 8 59,500,837 - 59,522,361 (+) RGD
Sequence:
GCAGCGACCCGTCCTAAGTCGACAGACGTCCTCTTTAGGTATTGCAACAGGATCTGAAGTACGCCCGAGGATCTCAGAAACCATGCCCAAGCCAGACAGCGAAGCAGGGACTGCCTTCATTCAGACCC
hide sequence
RefSeq Acc Id:
XM_006243188 ⟹ XP_006243250
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 68,949,731 - 68,975,394 (+) NCBI mRatBN7.2 8 60,057,629 - 60,079,600 (+) NCBI Rnor_6.0 8 64,480,963 - 64,502,957 (+) NCBI Rnor_5.0 8 64,243,957 - 64,265,970 (+) NCBI
Sequence:
AATGTCCTTCCGCCACGGAAGGTAGTCCCCCTCAAAAGGGCAACCTGCTTGTCCCGCCTACCCT
hide sequence
RefSeq Acc Id:
XM_006243190 ⟹ XP_006243252
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 68,955,466 - 68,975,394 (+) NCBI mRatBN7.2 8 60,059,758 - 60,079,600 (+) NCBI Rnor_6.0 8 64,483,092 - 64,502,957 (+) NCBI Rnor_5.0 8 64,243,957 - 64,265,970 (+) NCBI
Sequence:
CATCACCGGGTCTGGGCAAGATGACTCAACCTTTCAACTTAGAGGCTTTTGAGAGAATTTTCTT
hide sequence
RefSeq Acc Id:
XM_063264953 ⟹ XP_063121023
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 68,953,469 - 68,975,394 (+) NCBI
RefSeq Acc Id:
XM_063264954 ⟹ XP_063121024
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 68,953,462 - 68,975,394 (+) NCBI
RefSeq Acc Id:
XM_063264955 ⟹ XP_063121025
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 68,960,402 - 68,973,056 (+) NCBI
RefSeq Acc Id:
XM_063264956 ⟹ XP_063121026
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 68,960,402 - 68,974,205 (+) NCBI
RefSeq Acc Id:
XM_063264957 ⟹ XP_063121027
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 68,953,469 - 68,975,394 (+) NCBI
RefSeq Acc Id:
XM_063264958 ⟹ XP_063121028
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 68,953,462 - 68,975,394 (+) NCBI
RefSeq Acc Id:
XM_063264960 ⟹ XP_063121030
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 68,955,531 - 68,975,394 (+) NCBI
RefSeq Acc Id:
XM_063264961 ⟹ XP_063121031
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 68,953,783 - 68,975,394 (+) NCBI
RefSeq Acc Id:
XM_063264962 ⟹ XP_063121032
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 68,958,736 - 68,975,394 (+) NCBI
RefSeq Acc Id:
XM_063264963 ⟹ XP_063121033
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 68,958,740 - 68,975,394 (+) NCBI
RefSeq Acc Id:
XM_063264964 ⟹ XP_063121034
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 68,960,465 - 68,975,394 (+) NCBI
RefSeq Acc Id:
NP_445749 ⟸ NM_053297
- UniProtKB:
P11981 (UniProtKB/Swiss-Prot), P11980 (UniProtKB/Swiss-Prot), A6J531 (UniProtKB/TrEMBL), A0A8L2Q7B9 (UniProtKB/TrEMBL)
- Sequence:
MPKPDSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSAPITARNTGIICTIGPASRSVEMLKEMIKSGMNVARLNFSHGTHEYHAETIKNVRAATESFASDPILYRPVAVALDTKGPEIRTGLIKGSG
hide sequence
RefSeq Acc Id:
XP_006243250 ⟸ XM_006243188
- Peptide Label:
isoform X7
- UniProtKB:
A0A8L2Q7B9 (UniProtKB/TrEMBL)
- Sequence:
MPKPDSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSAPITARNTGIICTIGPASRSVEMLKEM
hide sequence
RefSeq Acc Id:
XP_006243252 ⟸ XM_006243190
- Peptide Label:
isoform X8
- UniProtKB:
A0A8I6ABE3 (UniProtKB/TrEMBL), A0A8L2Q7B9 (UniProtKB/TrEMBL)
- Sequence:
MTQPFNLEAFERIFFLGSSGQSILSSELSFQVGPSSQSGSKKRQYVNRSPDPEIQRISETMPKPDSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSAPITARNTGIICTIGPASRSVEMLKEMIKSG
hide sequence
Ensembl Acc Id:
ENSRNOP00000069474 ⟸ ENSRNOT00000083666
Ensembl Acc Id:
ENSRNOP00000015331 ⟸ ENSRNOT00000015332
Ensembl Acc Id:
ENSRNOP00000089941 ⟸ ENSRNOT00000118042
Ensembl Acc Id:
ENSRNOP00000079846 ⟸ ENSRNOT00000098634
RefSeq Acc Id:
XP_063121024 ⟸ XM_063264954
- Peptide Label:
isoform X2
- UniProtKB:
A0A8L2Q7B9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063121028 ⟸ XM_063264958
- Peptide Label:
isoform X6
- UniProtKB:
A0A8L2Q7B9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063121023 ⟸ XM_063264953
- Peptide Label:
isoform X1
- UniProtKB:
A0A8L2Q7B9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063121027 ⟸ XM_063264957
- Peptide Label:
isoform X5
- UniProtKB:
A0A8L2Q7B9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063121031 ⟸ XM_063264961
- Peptide Label:
isoform X10
- UniProtKB:
P11981 (UniProtKB/Swiss-Prot), P11980 (UniProtKB/Swiss-Prot), A6J531 (UniProtKB/TrEMBL), A0A8L2Q7B9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063121030 ⟸ XM_063264960
- Peptide Label:
isoform X9
- UniProtKB:
A0A8I6G5T6 (UniProtKB/TrEMBL), A0A8L2Q7B9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063121032 ⟸ XM_063264962
- Peptide Label:
isoform X10
- UniProtKB:
P11981 (UniProtKB/Swiss-Prot), P11980 (UniProtKB/Swiss-Prot), A6J531 (UniProtKB/TrEMBL), A0A8L2Q7B9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063121033 ⟸ XM_063264963
- Peptide Label:
isoform X11
- UniProtKB:
A6J532 (UniProtKB/TrEMBL), A0A8L2Q7B9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063121026 ⟸ XM_063264956
- Peptide Label:
isoform X4
- UniProtKB:
A0A0G2JVG3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063121025 ⟸ XM_063264955
- Peptide Label:
isoform X3
- UniProtKB:
A0A0G2JVG3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063121034 ⟸ XM_063264964
- Peptide Label:
isoform X12
- UniProtKB:
A0A8L2Q7B9 (UniProtKB/TrEMBL)
RGD ID: 13696042 Promoter ID: EPDNEW_R6566 Type: multiple initiation site Name: Pkm_1 Description: pyruvate kinase M1/2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 8 64,481,166 - 64,481,226 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2017-09-28
Pkm
pyruvate kinase M1/2
Pkm
pyruvate kinase, muscle
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2012-05-23
Pkm
pyruvate kinase, muscle
Pkm2
pyruvate kinase, muscle
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-11-06
Pkm2
pyruvate kinase, muscle
Pyruvate kinase, muscle
Name updated
625702 APPROVED
2002-06-10
Pkm2
Pyruvate kinase, muscle
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_expression
M1 isoform replaces M2 during development in skeletal muscle, heart, and brain
633549
