Symbol:
Pklr
Name:
pyruvate kinase L/R
RGD ID:
3336
Description:
Enables monosaccharide binding activity and pyruvate kinase activity. Involved in several processes, including cellular response to epinephrine stimulus; cellular response to insulin stimulus; and pyruvate metabolic process. Predicted to be located in plasma membrane. Predicted to be part of pyruvate kinase complex. Predicted to be active in cytosol. Biomarker of hyperglycemia and metabolic dysfunction-associated steatotic liver disease. Human ortholog(s) of this gene implicated in Gaucher's disease; congenital nonspherocytic hemolytic anemia; congenital nonspherocytic hemolytic anemia 2; malaria; and type 2 diabetes mellitus. Orthologous to human PKLR (pyruvate kinase L/R); PARTICIPATES IN glycolysis pathway; pyruvate metabolic pathway; Fanconi syndrome pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
L-PK; PK1; PKL; Pklg; pyruvate kinase isozymes L/R; pyruvate kinase isozymes R/L; pyruvate kinase PKLR; pyruvate kinase, liver and RBC; pyruvate kinase, liver and red blood cell
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PKLR (pyruvate kinase L/R) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Pklr (pyruvate kinase liver and red blood cell) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Pklr (pyruvate kinase L/R) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PKLR (pyruvate kinase L/R) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PKLR (pyruvate kinase L/R) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Pklr (pyruvate kinase L/R) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PKLR (pyruvate kinase L/R) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PKLR (pyruvate kinase L/R) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Pklr (pyruvate kinase L/R) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
OGDHL (oxoglutarate dehydrogenase L) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Pklr (pyruvate kinase liver and red blood cell)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
PKLR (pyruvate kinase L/R)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
pklr (pyruvate kinase L/R)
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
pyk-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG2964
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):
CDC19
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
PYK2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
pyk-2
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
CG7362
Alliance
DIOPT (OrthoFinder|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
PyK
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
pklr
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Is Marker For:
Strains:
WKY.SHRSP-(D2Mit5-D2Mgh12 )/Gcrc
WKY.SHRSP-(Fst-Pklr )/Gcrc QTLs:
Niddm8
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 176,840,779 - 176,849,637 (+) NCBI GRCr8 mRatBN7.2 2 174,543,008 - 174,551,863 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 174,543,039 - 174,551,870 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 181,689,431 - 181,697,810 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 179,711,798 - 179,720,184 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 174,311,737 - 174,320,129 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 188,449,158 - 188,458,034 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 188,449,210 - 188,459,592 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 207,865,529 - 207,874,394 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 181,214,853 - 181,223,505 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 181,164,961 - 181,173,618 (+) NCBI Celera 2 168,486,468 - 168,494,841 (+) NCBI Celera RH 3.4 Map 2 1154.4 RGD Cytogenetic Map 2 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pklr Rat (1->4)-beta-D-glucan multiple interactions ISO Pklr (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of PKLR mRNA CTD PMID:36331819 Pklr Rat (S)-nicotine multiple interactions ISO PKLR (Homo sapiens) 6480464 [Nicotine co-treated with Propylene Glycol co-treated with Glycerol co-treated with Flavoring Agents] results in increased expression of PKLR mRNA CTD PMID:28065790 Pklr Rat 1,1-dichloroethene increases expression ISO Pklr (Mus musculus) 6480464 vinylidene chloride results in increased expression of PKLR mRNA CTD PMID:26682919 Pklr Rat 1,2-dichloroethane decreases expression ISO Pklr (Mus musculus) 6480464 ethylene dichloride results in decreased expression of PKLR mRNA CTD PMID:28189721 and PMID:28960355 Pklr Rat 1-naphthyl isothiocyanate decreases expression EXP 6480464 1-Naphthylisothiocyanate results in decreased expression of PKLR mRNA CTD PMID:17522070 and PMID:25380136 Pklr Rat 17alpha-ethynylestradiol affects expression ISO Pklr (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of PKLR mRNA CTD PMID:17555576 Pklr Rat 17alpha-ethynylestradiol multiple interactions ISO Pklr (Mus musculus) 6480464 [lard co-treated with Cholesterol co-treated with Sucrose co-treated with Ethinyl Estradiol] results in increased expression of PKLR mRNA CTD PMID:24440342 Pklr Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of PKLR mRNA CTD PMID:15953391 Pklr Rat 17beta-estradiol decreases expression ISO PKLR (Homo sapiens) 6480464 Estradiol results in decreased expression of PKLR mRNA CTD PMID:20106945 Pklr Rat 17beta-estradiol decreases expression ISO Pklr (Mus musculus) 6480464 Estradiol results in decreased expression of PKLR mRNA CTD PMID:39298647 Pklr Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of PKLR mRNA CTD PMID:32145629 Pklr Rat 2,2',5,5'-tetrachlorobiphenyl increases expression EXP 6480464 2 more ... CTD PMID:23829299 Pklr Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO PKLR (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of PKLR mRNA CTD PMID:20106945 and PMID:31520823 Pklr Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Pklr (Mus musculus) 6480464 Dietary Fats promotes the reaction [Tetrachlorodibenzodioxin results in decreased expression of PKLR mRNA] and Tetrachlorodibenzodioxin promotes the reaction [Dietary Fats results in decreased expression of PKLR mRNA] CTD PMID:27713108 Pklr Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Pklr (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PKLR mRNA CTD PMID:26377647 Pklr Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Pklr (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of PKLR mRNA CTD PMID:25975270 and PMID:26290441 Pklr Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO PKLR (Homo sapiens) 6480464 [Endosulfan co-treated with Tetrachlorodibenzodioxin] results in decreased expression of PKLR mRNA CTD PMID:26159488 Pklr Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PKLR mRNA CTD PMID:21215274 and PMID:21724226 Pklr Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of PKLR mRNA CTD PMID:22298810 Pklr Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO PKLR (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of PKLR mRNA CTD PMID:22298810 Pklr Rat 2,4,6-trinitrobenzenesulfonic acid increases expression ISO Pklr (Mus musculus) 6480464 Trinitrobenzenesulfonic Acid results in increased expression of PKLR mRNA CTD PMID:17982090 Pklr Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Pklr (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Pklr Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of PKLR mRNA CTD PMID:21346803 Pklr Rat 2-butoxyethanol increases expression ISO Pklr (Mus musculus) 6480464 n-butoxyethanol results in increased expression of PKLR mRNA CTD PMID:19812364 Pklr Rat 3,3',4,4',5-pentachlorobiphenyl multiple interactions ISO Pklr (Mus musculus) 6480464 3 more ... CTD PMID:28973532 Pklr Rat 3,3',4,4',5-pentachlorobiphenyl multiple interactions EXP 6480464 AHR gene mutant form inhibits the reaction [3 more ... CTD PMID:34256052 Pklr Rat 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3 more ... CTD PMID:34256052 Pklr Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression ISO Pklr (Mus musculus) 6480464 3 more ... CTD PMID:28973532 Pklr Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin analog results in increased expression of PKLR protein more ... CTD PMID:26597043 and PMID:28522335 Pklr Rat 3-phenylprop-2-enal multiple interactions EXP 6480464 cinnamaldehyde inhibits the reaction [Streptozocin results in decreased expression of PKLR mRNA] CTD PMID:20363216 Pklr Rat 3H-1,2-dithiole-3-thione increases expression EXP 6480464 1 and 2-dithiol-3-thione results in increased expression of PKLR mRNA CTD PMID:19162173 Pklr Rat 4,4'-diaminodiphenylmethane decreases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of PKLR mRNA CTD PMID:25380136 and PMID:30723492 Pklr Rat 4,4'-sulfonyldiphenol increases expression ISO PKLR (Homo sapiens) 6480464 bisphenol S results in increased expression of PKLR mRNA CTD PMID:31121516 Pklr Rat 4,4'-sulfonyldiphenol affects methylation ISO Pklr (Mus musculus) 6480464 bisphenol S affects the methylation of PKLR gene CTD PMID:31683443 Pklr Rat 4,4'-sulfonyldiphenol increases expression ISO Pklr (Mus musculus) 6480464 bisphenol S results in increased expression of PKLR mRNA CTD PMID:30145421 Pklr Rat 4-hydroxy-3-[4-(2-hydroxyphenyl)phenyl]-6-oxo-7H-thieno[2,3-b]pyridine-5-carbonitrile multiple interactions EXP 6480464 4-hydroxy-3-(4-(2-hydroxyphenyl)phenyl)-6-oxo-7H-thieno(2 more ... CTD PMID:31974165 Pklr Rat 4-hydroxyphenyl retinamide increases expression ISO Pklr (Mus musculus) 6480464 Fenretinide results in increased expression of PKLR mRNA CTD PMID:28973697 Pklr Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole affects expression EXP 6480464 Omeprazole affects the expression of PKLR mRNA CTD PMID:19483382 Pklr Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of PKLR mRNA CTD PMID:19483382 Pklr Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of PKLR mRNA CTD PMID:31881176 Pklr Rat aflatoxin B1 affects expression ISO PKLR (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of PKLR protein CTD PMID:20106945 Pklr Rat aflatoxin B1 decreases expression ISO PKLR (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of PKLR mRNA CTD PMID:21641981 and PMID:27153756 Pklr Rat aflatoxin B1 multiple interactions EXP 6480464 [sulforaphane co-treated with Aflatoxin B1] affects the expression of PKLR mRNA CTD PMID:25450479 Pklr Rat aflatoxin B1 decreases expression ISO Pklr (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of PKLR mRNA CTD PMID:19770486 Pklr Rat aldehydo-D-glucose increases expression EXP 6480464 Glucose results in increased expression of PKLR mRNA CTD PMID:16644726 more ... Pklr Rat aldehydo-D-glucose increases expression ISO PKLR (Homo sapiens) 6480464 Glucose results in increased expression of PKLR mRNA CTD PMID:27226639 Pklr Rat aldehydo-D-glucose multiple interactions EXP 6480464 4-hydroxy-3-(4-(2-hydroxyphenyl)phenyl)-6-oxo-7H-thieno(2 more ... CTD PMID:16644726 and PMID:31974165 Pklr Rat aldehydo-D-glucose increases activity EXP 6480464 Glucose results in increased activity of PKLR protein CTD PMID:16644726 Pklr Rat aldehydo-D-glucose increases expression ISO Pklr (Mus musculus) 6480464 Glucose results in increased expression of PKLR mRNA CTD PMID:17786952 Pklr Rat all-trans-retinoic acid multiple interactions ISO Pklr (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of PKLR mRNA CTD PMID:36189433 Pklr Rat aluminium atom increases activity ISO PKLR (Homo sapiens) 6480464 Aluminum results in increased activity of PKLR protein CTD PMID:16979867 Pklr Rat aluminium(0) increases activity ISO PKLR (Homo sapiens) 6480464 Aluminum results in increased activity of PKLR protein CTD PMID:16979867 Pklr Rat amiodarone affects expression EXP 6480464 Amiodarone affects the expression of PKLR mRNA CTD PMID:19483382 Pklr Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PKLR mRNA CTD PMID:16483693 Pklr Rat amphotericin B increases expression ISO PKLR (Homo sapiens) 6480464 Amphotericin B analog results in increased expression of PKLR mRNA CTD PMID:28534445 Pklr Rat aristolochic acid A multiple interactions EXP 6480464 [aristolochic acid I co-treated with aristolochic acid II] results in decreased expression of PKLR mRNA CTD PMID:23912714 Pklr Rat arsane affects methylation ISO PKLR (Homo sapiens) 6480464 Arsenic affects the methylation of PKLR gene CTD PMID:25304211 Pklr Rat arsane multiple interactions ISO Pklr (Mus musculus) 6480464 [Cadmium co-treated with Arsenic co-treated with Mercury co-treated with Diclofenac co-treated with flumequine] results in decreased expression of PKLR mRNA and Sodium Selenite promotes the reaction [[Cadmium co-treated with Arsenic co-treated with Mercury co-treated with Diclofenac co-treated with flumequine] results in decreased expression of PKLR mRNA] CTD PMID:38945390 Pklr Rat arsenic atom affects methylation ISO PKLR (Homo sapiens) 6480464 Arsenic affects the methylation of PKLR gene CTD PMID:25304211 Pklr Rat arsenic atom multiple interactions ISO Pklr (Mus musculus) 6480464 [Cadmium co-treated with Arsenic co-treated with Mercury co-treated with Diclofenac co-treated with flumequine] results in decreased expression of PKLR mRNA and Sodium Selenite promotes the reaction [[Cadmium co-treated with Arsenic co-treated with Mercury co-treated with Diclofenac co-treated with flumequine] results in decreased expression of PKLR mRNA] CTD PMID:38945390 Pklr Rat arsenous acid multiple interactions ISO Pklr (Mus musculus) 6480464 Taurine inhibits the reaction [Arsenic Trioxide results in decreased expression of PKLR mRNA] CTD PMID:30362509 Pklr Rat arsenous acid decreases expression ISO Pklr (Mus musculus) 6480464 Arsenic Trioxide results in decreased expression of PKLR mRNA CTD PMID:30362509 Pklr Rat atorvastatin calcium multiple interactions EXP 6480464 Atorvastatin inhibits the reaction [Fructose results in increased expression of PKLR mRNA] CTD PMID:19053045 and PMID:21122807 Pklr Rat atrazine multiple interactions ISO Pklr (Mus musculus) 6480464 [lard co-treated with Cholesterol co-treated with Sucrose co-treated with Atrazine] results in increased expression of PKLR mRNA CTD PMID:24440342 Pklr Rat atrazine increases expression ISO PKLR (Homo sapiens) 6480464 Atrazine results in increased expression of PKLR mRNA CTD PMID:25275270 Pklr Rat Azoxymethane multiple interactions ISO Pklr (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of PKLR mRNA CTD PMID:29950665 Pklr Rat benzbromarone affects expression EXP 6480464 Benzbromarone affects the expression of PKLR mRNA CTD PMID:19483382 Pklr Rat benzo[a]pyrene decreases expression ISO Pklr (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of PKLR mRNA CTD PMID:19770486 and PMID:21715664 Pklr Rat benzo[a]pyrene decreases methylation ISO PKLR (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of PKLR promoter CTD PMID:27901495 Pklr Rat benzo[a]pyrene decreases expression ISO PKLR (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of PKLR mRNA CTD PMID:20106945 and PMID:32234424 Pklr Rat bicalutamide decreases expression EXP 6480464 bicalutamide results in decreased expression of PKLR protein CTD PMID:35151640 Pklr Rat bifenthrin decreases expression ISO Pklr (Mus musculus) 6480464 bifenthrin results in decreased expression of PKLR mRNA CTD PMID:26071804 Pklr Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Pklr (Mus musculus) 6480464 PPARA protein promotes the reaction [Diethylhexyl Phthalate results in decreased expression of PKLR mRNA] CTD PMID:19850644 Pklr Rat bis(2-ethylhexyl) phthalate decreases expression ISO Pklr (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of PKLR mRNA CTD PMID:19245819 and PMID:19850644 Pklr Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PKLR mRNA CTD PMID:25181051 Pklr Rat bisphenol A decreases expression ISO PKLR (Homo sapiens) 6480464 bisphenol A results in decreased expression of PKLR protein CTD PMID:33376534 Pklr Rat bisphenol A increases expression ISO Pklr (Mus musculus) 6480464 bisphenol A results in increased expression of PKLR mRNA CTD PMID:34585602 Pklr Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PKLR mRNA and bisphenol A results in increased expression of PKLR protein CTD PMID:32145629 Pklr Rat bisphenol AF increases expression ISO Pklr (Mus musculus) 6480464 bisphenol AF results in increased expression of PKLR mRNA CTD PMID:30145421 Pklr Rat bisphenol AF increases expression ISO PKLR (Homo sapiens) 6480464 bisphenol AF results in increased expression of PKLR mRNA CTD PMID:31121516 Pklr Rat bosentan affects expression ISO PKLR (Homo sapiens) 6480464 Bosentan affects the expression of PKLR mRNA CTD PMID:29761207 Pklr Rat bromobenzene decreases expression EXP 6480464 bromobenzene results in decreased expression of PKLR mRNA CTD PMID:32479839 Pklr Rat buspirone decreases expression EXP 6480464 Buspirone results in decreased expression of PKLR mRNA CTD PMID:24136188 Pklr Rat Butylbenzyl phthalate decreases expression ISO Pklr (Mus musculus) 6480464 butylbenzyl phthalate results in decreased expression of PKLR mRNA CTD PMID:32308655 Pklr Rat cadmium atom multiple interactions ISO Pklr (Mus musculus) 6480464 [Cadmium co-treated with Arsenic co-treated with Mercury co-treated with Diclofenac co-treated with flumequine] results in decreased expression of PKLR mRNA and Sodium Selenite promotes the reaction [[Cadmium co-treated with Arsenic co-treated with Mercury co-treated with Diclofenac co-treated with flumequine] results in decreased expression of PKLR mRNA] CTD PMID:38945390 Pklr Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of PKLR mRNA CTD PMID:25993096 Pklr Rat calcium atom multiple interactions EXP 6480464 Calcium inhibits the reaction [Phenylephrine results in decreased activity of PKLR protein] CTD PMID:747652 Pklr Rat calcium(0) multiple interactions EXP 6480464 Calcium inhibits the reaction [Phenylephrine results in decreased activity of PKLR protein] CTD PMID:747652 Pklr Rat carbon nanotube decreases expression ISO Pklr (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25620056 Pklr Rat chlorothalonil multiple interactions ISO Pklr (Mus musculus) 6480464 [procymidone co-treated with tetrachloroisophthalonitrile] results in decreased expression of PKLR mRNA CTD PMID:33246813 Pklr Rat chlorothalonil decreases expression ISO Pklr (Mus musculus) 6480464 tetrachloroisophthalonitrile results in decreased expression of PKLR mRNA CTD PMID:33246813 Pklr Rat cholesterol multiple interactions ISO Pklr (Mus musculus) 6480464 [lard co-treated with Cholesterol co-treated with Sucrose co-treated with Atrazine] results in increased expression of PKLR mRNA more ... CTD PMID:24440342 Pklr Rat choline multiple interactions ISO Pklr (Mus musculus) 6480464 3 more ... CTD PMID:28973532 Pklr Rat clofibrate affects expression EXP 6480464 Clofibrate affects the expression of PKLR mRNA CTD PMID:19483382 Pklr Rat clofibrate decreases expression ISO Pklr (Mus musculus) 6480464 Clofibrate results in decreased expression of PKLR mRNA CTD PMID:17585979 and PMID:30629241 Pklr Rat clofibrate decreases expression EXP 6480464 Clofibrate results in decreased expression of PKLR mRNA and Clofibrate results in decreased expression of PKLR protein CTD PMID:16470657 more ... Pklr Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of PKLR mRNA CTD PMID:24386269 Pklr Rat copper atom decreases expression EXP 6480464 Copper results in decreased expression of PKLR mRNA CTD PMID:22465980 Pklr Rat copper(0) decreases expression EXP 6480464 Copper results in decreased expression of PKLR mRNA CTD PMID:22465980 Pklr Rat cyclosporin A decreases expression EXP 6480464 Cyclosporine results in decreased expression of PKLR mRNA CTD PMID:19224547 Pklr Rat cyclosporin A decreases expression ISO Pklr (Mus musculus) 6480464 Cyclosporine results in decreased expression of PKLR mRNA CTD PMID:23830897 Pklr Rat cyclosporin A decreases expression ISO PKLR (Homo sapiens) 6480464 Cyclosporine results in decreased expression of PKLR mRNA CTD PMID:20106945 and PMID:23830897 Pklr Rat cypermethrin multiple interactions ISO Pklr (Mus musculus) 6480464 [lard co-treated with Cholesterol co-treated with Sucrose co-treated with cypermethrin] results in increased expression of PKLR mRNA CTD PMID:24440342 Pklr Rat D-glucose increases expression ISO Pklr (Mus musculus) 6480464 Glucose results in increased expression of PKLR mRNA CTD PMID:17786952 Pklr Rat D-glucose increases expression ISO PKLR (Homo sapiens) 6480464 Glucose results in increased expression of PKLR mRNA CTD PMID:27226639 Pklr Rat D-glucose increases expression EXP 6480464 Glucose results in increased expression of PKLR mRNA CTD PMID:16644726 more ... Pklr Rat D-glucose increases activity EXP 6480464 Glucose results in increased activity of PKLR protein CTD PMID:16644726 Pklr Rat D-glucose multiple interactions EXP 6480464 4-hydroxy-3-(4-(2-hydroxyphenyl)phenyl)-6-oxo-7H-thieno(2 more ... CTD PMID:16644726 and PMID:31974165 Pklr Rat dextran sulfate multiple interactions ISO Pklr (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of PKLR mRNA CTD PMID:29950665 Pklr Rat diarsenic trioxide decreases expression ISO Pklr (Mus musculus) 6480464 Arsenic Trioxide results in decreased expression of PKLR mRNA CTD PMID:30362509 Pklr Rat diarsenic trioxide multiple interactions ISO Pklr (Mus musculus) 6480464 Taurine inhibits the reaction [Arsenic Trioxide results in decreased expression of PKLR mRNA] CTD PMID:30362509 Pklr Rat dibenz[a,h]anthracene increases expression ISO Pklr (Mus musculus) 6480464 1 more ... CTD PMID:26377693 Pklr Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of PKLR mRNA CTD PMID:21266533 Pklr Rat diclofenac increases expression ISO Pklr (Mus musculus) 6480464 Diclofenac results in increased expression of PKLR mRNA CTD PMID:26934552 Pklr Rat diclofenac multiple interactions ISO Pklr (Mus musculus) 6480464 [Cadmium co-treated with Arsenic co-treated with Mercury co-treated with Diclofenac co-treated with flumequine] results in decreased expression of PKLR mRNA and Sodium Selenite promotes the reaction [[Cadmium co-treated with Arsenic co-treated with Mercury co-treated with Diclofenac co-treated with flumequine] results in decreased expression of PKLR mRNA] CTD PMID:38945390 Pklr Rat diethyl maleate decreases expression EXP 6480464 diethyl maleate results in decreased expression of PKLR mRNA CTD PMID:21161181 Pklr Rat dihydroxyacetone multiple interactions EXP 6480464 4-hydroxy-3-(4-(2-hydroxyphenyl)phenyl)-6-oxo-7H-thieno(2 and 3-b)pyridine-5-carbonitrile inhibits the reaction [Dihydroxyacetone results in increased expression of PKLR mRNA] CTD PMID:31974165 Pklr Rat Diosbulbin B increases expression ISO Pklr (Mus musculus) 6480464 diosbulbin B results in increased expression of PKLR mRNA CTD PMID:32148032 Pklr Rat diquat increases expression ISO Pklr (Mus musculus) 6480464 Diquat results in increased expression of PKLR mRNA CTD PMID:36851058 Pklr Rat disodium selenite multiple interactions ISO Pklr (Mus musculus) 6480464 Sodium Selenite promotes the reaction [[Cadmium co-treated with Arsenic co-treated with Mercury co-treated with Diclofenac co-treated with flumequine] results in decreased expression of PKLR mRNA] and Sodium Selenite promotes the reaction [[Streptozocin co-treated with Dietary Fats] results in decreased expression of PKLR mRNA] CTD PMID:26522834 and PMID:38945390 Pklr Rat duvoglustat multiple interactions ISO Pklr (Mus musculus) 6480464 [1-Deoxynojirimycin co-treated with Polysaccharides] inhibits the reaction [[Dietary Fats co-treated with Streptozocin] results in decreased expression of PKLR protein] CTD PMID:25446853 Pklr Rat endosulfan multiple interactions ISO PKLR (Homo sapiens) 6480464 [Endosulfan co-treated with Tetrachlorodibenzodioxin] results in decreased expression of PKLR mRNA CTD PMID:26159488 Pklr Rat endosulfan decreases expression ISO PKLR (Homo sapiens) 6480464 Endosulfan results in decreased expression of PKLR mRNA CTD PMID:31520823 Pklr Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of PKLR mRNA CTD PMID:29391264 Pklr Rat epoxiconazole decreases expression ISO Pklr (Mus musculus) 6480464 epoxiconazole results in decreased expression of PKLR mRNA CTD PMID:35436446 Pklr Rat erythromycin estolate decreases expression EXP 6480464 Erythromycin Estolate results in decreased expression of PKLR mRNA CTD PMID:17522070 Pklr Rat ethanol multiple interactions ISO Pklr (Mus musculus) 6480464 Ethanol inhibits the reaction [Fish Oils results in decreased expression of PKLR mRNA] and pirinixic acid inhibits the reaction [Ethanol results in increased expression of PKLR mRNA] CTD PMID:18620774 Pklr Rat ethanol increases expression ISO Pklr (Mus musculus) 6480464 Ethanol results in increased expression of PKLR mRNA CTD PMID:18620774 and PMID:19167417 Pklr Rat fenofibrate decreases expression ISO PKLR (Homo sapiens) 6480464 Fenofibrate results in decreased expression of PKLR mRNA CTD PMID:25572481 Pklr Rat fenthion increases expression ISO Pklr (Mus musculus) 6480464 Fenthion results in increased expression of PKLR mRNA CTD PMID:34813904 Pklr Rat flavonoids decreases expression EXP 6480464 Flavonoids results in decreased expression of PKLR mRNA CTD PMID:18035473 Pklr Rat flumequine multiple interactions ISO Pklr (Mus musculus) 6480464 [Cadmium co-treated with Arsenic co-treated with Mercury co-treated with Diclofenac co-treated with flumequine] results in decreased expression of PKLR mRNA and Sodium Selenite promotes the reaction [[Cadmium co-treated with Arsenic co-treated with Mercury co-treated with Diclofenac co-treated with flumequine] results in decreased expression of PKLR mRNA] CTD PMID:38945390 Pklr Rat flutamide decreases expression ISO Pklr (Mus musculus) 6480464 Flutamide results in decreased expression of PKLR mRNA CTD PMID:17702527 Pklr Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of PKLR mRNA CTD PMID:24136188 Pklr Rat fructose increases expression ISO Pklr (Mus musculus) 6480464 Fructose results in increased expression of PKLR mRNA CTD PMID:17786952 and PMID:28123933 Pklr Rat fructose increases expression EXP 6480464 Fructose results in increased expression of PKLR mRNA CTD PMID:18346472 more ... Pklr Rat fructose multiple interactions EXP 6480464 Atorvastatin inhibits the reaction [Fructose results in increased expression of PKLR mRNA] and GCG protein affects the reaction [Fructose affects the degradation of PKLR mRNA] CTD PMID:19053045 more ... Pklr Rat fructose affects expression EXP 6480464 Fructose affects the expression of PKLR mRNA CTD PMID:6759123 Pklr Rat fructose affects degradation EXP 6480464 Fructose affects the degradation of PKLR mRNA CTD PMID:2414297 Pklr Rat fructose multiple interactions ISO Pklr (Mus musculus) 6480464 FGF21 gene mutant form inhibits the reaction [Fructose results in increased expression of PKLR mRNA] and lactisole inhibits the reaction [Fructose results in increased expression of PKLR mRNA] CTD PMID:17786952 and PMID:28123933 Pklr Rat furan increases methylation EXP 6480464 furan results in increased methylation of PKLR gene CTD PMID:22079235 Pklr Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of PKLR mRNA CTD PMID:22061828 Pklr Rat glucose increases expression ISO Pklr (Mus musculus) 6480464 Glucose results in increased expression of PKLR mRNA CTD PMID:17786952 Pklr Rat glucose increases expression ISO PKLR (Homo sapiens) 6480464 Glucose results in increased expression of PKLR mRNA CTD PMID:27226639 Pklr Rat glucose increases expression EXP 6480464 Glucose results in increased expression of PKLR mRNA CTD PMID:16644726 more ... Pklr Rat glucose increases activity EXP 6480464 Glucose results in increased activity of PKLR protein CTD PMID:16644726 Pklr Rat glucose multiple interactions EXP 6480464 4-hydroxy-3-(4-(2-hydroxyphenyl)phenyl)-6-oxo-7H-thieno(2 more ... CTD PMID:16644726 and PMID:31974165 Pklr Rat glyburide multiple interactions EXP 6480464 Glyburide inhibits the reaction [Streptozocin results in decreased expression of PKLR mRNA] CTD PMID:20363216 Pklr Rat glycerol increases expression EXP 6480464 Glycerol results in increased expression of PKLR mRNA CTD PMID:2193023 Pklr Rat glycerol multiple interactions ISO PKLR (Homo sapiens) 6480464 [Nicotine co-treated with Propylene Glycol co-treated with Glycerol co-treated with Flavoring Agents] results in increased expression of PKLR mRNA CTD PMID:28065790 Pklr Rat hexadecanoic acid multiple interactions ISO PKLR (Homo sapiens) 6480464 [Palmitic Acid co-treated with Oleic Acid co-treated with TNF protein] affects the expression of PKLR mRNA and [Palmitic Acid co-treated with Oleic Acid] affects the expression of PKLR mRNA CTD PMID:30547786 Pklr Rat hydroxyurea decreases expression ISO Pklr (Mus musculus) 6480464 Hydroxyurea results in decreased expression of PKLR mRNA CTD PMID:12929121 Pklr Rat indometacin decreases expression EXP 6480464 Indomethacin results in decreased expression of PKLR mRNA CTD PMID:36868495 Pklr Rat isotretinoin decreases expression ISO PKLR (Homo sapiens) 6480464 Isotretinoin results in decreased expression of PKLR mRNA CTD PMID:20436886 Pklr Rat L-ethionine affects expression EXP 6480464 Ethionine affects the expression of PKLR mRNA CTD PMID:19483382 Pklr Rat L-methionine multiple interactions ISO Pklr (Mus musculus) 6480464 3 more ... CTD PMID:28973532 Pklr Rat Lasiocarpine decreases expression ISO PKLR (Homo sapiens) 6480464 lasiocarpine results in decreased expression of PKLR mRNA CTD PMID:32234424 Pklr Rat leflunomide decreases expression EXP 6480464 leflunomide results in decreased expression of PKLR mRNA CTD PMID:24136188 Pklr Rat lipopolysaccharide multiple interactions ISO PKLR (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of PKLR mRNA CTD PMID:35811015 Pklr Rat mercury atom multiple interactions ISO Pklr (Mus musculus) 6480464 [Cadmium co-treated with Arsenic co-treated with Mercury co-treated with Diclofenac co-treated with flumequine] results in decreased expression of PKLR mRNA and Sodium Selenite promotes the reaction [[Cadmium co-treated with Arsenic co-treated with Mercury co-treated with Diclofenac co-treated with flumequine] results in decreased expression of PKLR mRNA] CTD PMID:38945390 Pklr Rat mercury(0) multiple interactions ISO Pklr (Mus musculus) 6480464 [Cadmium co-treated with Arsenic co-treated with Mercury co-treated with Diclofenac co-treated with flumequine] results in decreased expression of PKLR mRNA and Sodium Selenite promotes the reaction [[Cadmium co-treated with Arsenic co-treated with Mercury co-treated with Diclofenac co-treated with flumequine] results in decreased expression of PKLR mRNA] CTD PMID:38945390 Pklr Rat metformin increases expression EXP 6480464 Metformin results in increased expression of PKLR mRNA CTD PMID:31324951 Pklr Rat metformin multiple interactions EXP 6480464 Metformin inhibits the reaction [Glucose results in increased expression of PKLR mRNA] CTD PMID:31974165 Pklr Rat methapyrilene increases expression EXP 6480464 Methapyrilene results in increased expression of PKLR mRNA CTD PMID:22484513 Pklr Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of PKLR mRNA CTD PMID:28903497 Pklr Rat mono(2-ethylhexyl) phthalate multiple interactions ISO Pklr (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of PKLR mRNA CTD PMID:36189433 Pklr Rat monosodium L-glutamate increases expression EXP 6480464 Sodium Glutamate results in increased expression of PKLR mRNA CTD PMID:26092479 Pklr Rat N-[3,5-bis(trifluoromethyl)phenyl]-5-chloro-2-hydroxybenzamide multiple interactions ISO Pklr (Mus musculus) 6480464 N-(3 and 5-bis(trifluoromethyl)phenyl)-5-chloro-2-hydroxybenzamide inhibits the reaction [Particulate Matter results in increased expression of PKLR mRNA] CTD PMID:29635361 Pklr Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in decreased expression of PKLR mRNA CTD PMID:28943392 Pklr Rat N-nitrosodimethylamine decreases expression EXP 6480464 Dimethylnitrosamine results in decreased expression of PKLR mRNA CTD PMID:25380136 Pklr Rat N-Nitrosopyrrolidine decreases expression ISO PKLR (Homo sapiens) 6480464 N-Nitrosopyrrolidine results in decreased expression of PKLR mRNA CTD PMID:32234424 Pklr Rat naloxone decreases expression EXP 6480464 Naloxone results in decreased expression of PKLR mRNA CTD PMID:17522070 Pklr Rat nefazodone decreases expression EXP 6480464 nefazodone results in decreased expression of PKLR mRNA CTD PMID:24136188 Pklr Rat nickel atom decreases expression ISO PKLR (Homo sapiens) 6480464 Nickel results in decreased expression of PKLR mRNA CTD PMID:24768652 Pklr Rat nicotine multiple interactions ISO PKLR (Homo sapiens) 6480464 [Nicotine co-treated with Propylene Glycol co-treated with Glycerol co-treated with Flavoring Agents] results in increased expression of PKLR mRNA CTD PMID:28065790 Pklr Rat nimesulide decreases expression EXP 6480464 nimesulide results in decreased expression of PKLR mRNA CTD PMID:24136188 Pklr Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of PKLR mRNA CTD PMID:33484710 Pklr Rat nordihydroguaiaretic acid decreases expression EXP 329955565 NDGA decreases expression of mRNA in liver of high fructose fed rats RGD Pklr Rat O-methyleugenol decreases expression ISO PKLR (Homo sapiens) 6480464 methyleugenol results in decreased expression of PKLR mRNA CTD PMID:32234424 Pklr Rat ochratoxin A decreases expression EXP 6480464 ochratoxin A results in decreased expression of PKLR mRNA CTD PMID:16251485 Pklr Rat octadecanoic acid decreases expression ISO PKLR (Homo sapiens) 6480464 stearic acid results in decreased expression of PKLR protein CTD PMID:26739624 Pklr Rat oleic acid multiple interactions ISO PKLR (Homo sapiens) 6480464 [Palmitic Acid co-treated with Oleic Acid co-treated with TNF protein] affects the expression of PKLR mRNA and [Palmitic Acid co-treated with Oleic Acid] affects the expression of PKLR mRNA CTD PMID:30547786 Pklr Rat omeprazole affects expression EXP 6480464 Omeprazole affects the expression of PKLR mRNA CTD PMID:19483382 Pklr Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of PKLR mRNA CTD PMID:25729387 Pklr Rat oxaliplatin decreases expression EXP 6480464 oxaliplatin results in decreased expression of PKLR mRNA CTD PMID:25729387 Pklr Rat ozone increases expression EXP 6480464 Ozone results in increased expression of PKLR mRNA CTD PMID:25838073 Pklr Rat ozone decreases expression ISO Pklr (Mus musculus) 6480464 Ozone results in decreased expression of PKLR mRNA CTD PMID:33026818 Pklr Rat p-anisidine decreases expression ISO Pklr (Mus musculus) 6480464 4-anisidine results in decreased expression of PKLR mRNA CTD PMID:12929121 Pklr Rat p-toluidine decreases expression EXP 6480464 4-toluidine results in decreased expression of PKLR mRNA CTD PMID:27638505 Pklr Rat paclitaxel decreases expression ISO Pklr (Mus musculus) 6480464 Paclitaxel results in decreased expression of PKLR mRNA CTD PMID:12929121 Pklr Rat paracetamol affects expression ISO Pklr (Mus musculus) 6480464 Acetaminophen affects the expression of PKLR mRNA CTD PMID:17562736 Pklr Rat paracetamol multiple interactions ISO Pklr (Mus musculus) 6480464 PANX1 gene mutant form inhibits the reaction [Acetaminophen results in increased expression of PKLR mRNA] CTD PMID:29246445 Pklr Rat paracetamol increases expression ISO Pklr (Mus musculus) 6480464 Acetaminophen results in increased expression of PKLR mRNA CTD PMID:29246445 Pklr Rat paracetamol decreases expression ISO PKLR (Homo sapiens) 6480464 Acetaminophen results in decreased expression of PKLR mRNA CTD PMID:22230336 more ... Pklr Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of PKLR mRNA CTD PMID:17202762 and PMID:17522070 Pklr Rat PCB138 decreases expression EXP 6480464 2 more ... CTD PMID:23829299 Pklr Rat penconazole decreases expression ISO Pklr (Mus musculus) 6480464 penconazole results in decreased expression of PKLR mRNA CTD PMID:31733957 Pklr Rat perfluorononanoic acid decreases expression ISO PKLR (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in decreased expression of PKLR mRNA CTD PMID:32588087 Pklr Rat perfluorooctane-1-sulfonic acid affects expression ISO Pklr (Mus musculus) 6480464 perfluorooctane sulfonic acid affects the expression of PKLR mRNA CTD PMID:19429403 Pklr Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Pklr (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of PKLR mRNA CTD PMID:36331819 Pklr Rat perfluorooctane-1-sulfonic acid decreases expression ISO PKLR (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in decreased expression of PKLR mRNA CTD PMID:32588087 Pklr Rat perfluorooctane-1-sulfonic acid decreases expression EXP 6480464 perfluorooctane sulfonic acid results in decreased expression of PKLR mRNA CTD PMID:19162173 and PMID:21723365 Pklr Rat perfluorooctanoic acid affects expression ISO Pklr (Mus musculus) 6480464 perfluorooctanoic acid affects the expression of PKLR mRNA CTD PMID:19429403 Pklr Rat perfluorooctanoic acid decreases expression ISO PKLR (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of PKLR mRNA CTD PMID:32588087 Pklr Rat perfluorooctanoic acid decreases expression ISO Pklr (Mus musculus) 6480464 perfluorooctanoic acid results in decreased expression of PKLR mRNA CTD PMID:20118188 and PMID:23626681 Pklr Rat perfluorooctanoic acid decreases expression EXP 6480464 perfluorooctanoic acid results in decreased expression of PKLR mRNA and perfluorooctanoic acid results in decreased expression of PKLR protein CTD PMID:19162173 more ... Pklr Rat perfluorooctanoic acid multiple interactions ISO Pklr (Mus musculus) 6480464 [perfluorooctanoic acid co-treated with Dietary Fats more ... CTD PMID:20118188 and PMID:23626681 Pklr Rat permethrin decreases expression ISO Pklr (Mus musculus) 6480464 Permethrin results in decreased expression of PKLR mRNA CTD PMID:30629241 Pklr Rat phenformin decreases expression EXP 6480464 Phenformin results in decreased expression of PKLR mRNA CTD PMID:31324951 Pklr Rat phenobarbital multiple interactions ISO Pklr (Mus musculus) 6480464 NR1I3 protein affects the reaction [Phenobarbital results in increased expression of PKLR mRNA] CTD PMID:19482888 Pklr Rat phenobarbital affects expression ISO Pklr (Mus musculus) 6480464 Phenobarbital affects the expression of PKLR mRNA CTD PMID:23091169 Pklr Rat phenobarbital increases expression ISO Pklr (Mus musculus) 6480464 Phenobarbital results in increased expression of PKLR mRNA CTD PMID:19270015 and PMID:19482888 Pklr Rat phenobarbital decreases expression EXP 6480464 Phenobarbital results in decreased expression of PKLR mRNA CTD PMID:19162173 Pklr Rat phenylephrine multiple interactions EXP 6480464 Calcium inhibits the reaction [Phenylephrine results in decreased activity of PKLR protein] CTD PMID:747652 Pklr Rat phenylephrine decreases activity EXP 6480464 Phenylephrine results in decreased activity of PKLR protein CTD PMID:747652 Pklr Rat piperonyl butoxide decreases expression EXP 6480464 Piperonyl Butoxide results in decreased expression of PKLR mRNA CTD PMID:22484513 Pklr Rat pirinixic acid multiple interactions ISO PKLR (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of PKLR mRNA CTD PMID:19710929 Pklr Rat pirinixic acid decreases expression ISO Pklr (Mus musculus) 6480464 pirinixic acid results in decreased expression of PKLR mRNA CTD PMID:16807375 more ... Pklr Rat pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of PKLR mRNA CTD PMID:16644726 more ... Pklr Rat pirinixic acid affects expression EXP 6480464 pirinixic acid affects the expression of PKLR mRNA CTD PMID:19483382 Pklr Rat pirinixic acid multiple interactions EXP 6480464 MLXIPL protein inhibits the reaction [pirinixic acid results in decreased expression of PKLR mRNA] more ... CTD PMID:16644726 Pklr Rat pirinixic acid multiple interactions ISO Pklr (Mus musculus) 6480464 [pirinixic acid co-treated with PPARA] results in decreased expression of PKLR mRNA more ... CTD PMID:18620774 more ... Pklr Rat pregnenolone 16alpha-carbonitrile decreases expression EXP 6480464 Pregnenolone Carbonitrile results in decreased expression of PKLR mRNA CTD PMID:19162173 Pklr Rat pregnenolone 16alpha-carbonitrile decreases expression ISO Pklr (Mus musculus) 6480464 Pregnenolone Carbonitrile results in decreased expression of PKLR mRNA CTD PMID:28903501 Pklr Rat procymidone decreases expression ISO Pklr (Mus musculus) 6480464 procymidone results in decreased expression of PKLR mRNA CTD PMID:33246813 Pklr Rat procymidone increases expression ISO Pklr (Mus musculus) 6480464 procymidone results in increased expression of PKLR mRNA CTD PMID:36764477 Pklr Rat procymidone multiple interactions ISO Pklr (Mus musculus) 6480464 [procymidone co-treated with tetrachloroisophthalonitrile] results in decreased expression of PKLR mRNA CTD PMID:33246813 Pklr Rat propamocarb decreases expression ISO Pklr (Mus musculus) 6480464 propamocarb results in decreased expression of PKLR mRNA CTD PMID:29137890 Pklr Rat propane-1,2-diol multiple interactions ISO PKLR (Homo sapiens) 6480464 [Nicotine co-treated with Propylene Glycol co-treated with Glycerol co-treated with Flavoring Agents] results in increased expression of PKLR mRNA CTD PMID:28065790 Pklr Rat propiconazole decreases expression EXP 6480464 propiconazole results in decreased expression of PKLR mRNA CTD PMID:19423681 Pklr Rat Propiverine affects binding EXP 6480464 propiverine binds to PKLR protein CTD PMID:29273565 Pklr Rat prostaglandin E2 decreases expression ISO Pklr (Mus musculus) 6480464 Dinoprostone results in decreased expression of PKLR mRNA CTD PMID:10357836 Pklr Rat quinidine decreases expression EXP 6480464 Quinidine results in decreased expression of PKLR mRNA CTD PMID:17522070 Pklr Rat resveratrol multiple interactions ISO PKLR (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of PKLR mRNA CTD PMID:23557933 Pklr Rat rifampicin increases expression ISO PKLR (Homo sapiens) 6480464 Rifampin results in increased expression of PKLR mRNA CTD PMID:24552687 Pklr Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of PKLR mRNA CTD PMID:28374803 Pklr Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO PKLR (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of PKLR mRNA CTD PMID:35811015 Pklr Rat S-(1,2-dichlorovinyl)-L-cysteine increases expression ISO PKLR (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in increased expression of PKLR mRNA CTD PMID:35811015 Pklr Rat silver atom increases expression ISO Pklr (Mus musculus) 6480464 Silver results in increased expression of PKLR mRNA CTD PMID:27131904 Pklr Rat silver(0) increases expression ISO Pklr (Mus musculus) 6480464 Silver results in increased expression of PKLR mRNA CTD PMID:27131904 Pklr Rat sodium arsenite decreases expression ISO PKLR (Homo sapiens) 6480464 sodium arsenite results in decreased expression of PKLR mRNA CTD PMID:17879257 and PMID:29301061 Pklr Rat sodium arsenite decreases expression ISO Pklr (Mus musculus) 6480464 sodium arsenite results in decreased expression of PKLR mRNA CTD PMID:37682722 Pklr Rat sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of PKLR mRNA CTD PMID:35314868 Pklr Rat sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of PKLR protein CTD PMID:29459688 Pklr Rat sodium arsenite increases expression ISO PKLR (Homo sapiens) 6480464 sodium arsenite results in increased expression of PKLR mRNA CTD PMID:23648393 Pklr Rat sodium dichromate decreases expression EXP 6480464 sodium bichromate results in decreased expression of PKLR mRNA CTD PMID:25993096 Pklr Rat streptozocin multiple interactions EXP 6480464 cinnamaldehyde inhibits the reaction [Streptozocin results in decreased expression of PKLR mRNA] and Glyburide inhibits the reaction [Streptozocin results in decreased expression of PKLR mRNA] CTD PMID:20363216 Pklr Rat streptozocin multiple interactions ISO Pklr (Mus musculus) 6480464 [1-Deoxynojirimycin co-treated with Polysaccharides] inhibits the reaction [[Dietary Fats co-treated with Streptozocin] results in decreased expression of PKLR protein] more ... CTD PMID:25446853 and PMID:26522834 Pklr Rat streptozocin decreases expression EXP 6480464 Streptozocin results in decreased expression of PKLR mRNA CTD PMID:20363216 Pklr Rat succimer multiple interactions ISO Pklr (Mus musculus) 6480464 [Succimer co-treated with Magnetite Nanoparticles] results in decreased expression of PKLR mRNA CTD PMID:26378955 Pklr Rat sucrose multiple interactions ISO Pklr (Mus musculus) 6480464 [lard co-treated with Cholesterol co-treated with Sucrose co-treated with Atrazine] results in increased expression of PKLR mRNA more ... CTD PMID:24440342 Pklr Rat sulforaphane multiple interactions EXP 6480464 [sulforaphane co-treated with Aflatoxin B1] affects the expression of PKLR mRNA CTD PMID:25450479 Pklr Rat sulprostone decreases expression ISO Pklr (Mus musculus) 6480464 sulprostone results in decreased expression of PKLR mRNA CTD PMID:10357836 Pklr Rat suxibuzone decreases activity EXP 6480464 suxibuzone results in decreased activity of PKLR protein CTD PMID:3107799 Pklr Rat tamoxifen decreases expression ISO Pklr (Mus musculus) 6480464 Tamoxifen results in decreased expression of PKLR mRNA CTD PMID:25123088 Pklr Rat tamoxifen decreases expression EXP 6480464 Tamoxifen results in decreased expression of PKLR mRNA CTD PMID:19224547 Pklr Rat tamoxifen affects expression ISO Pklr (Mus musculus) 6480464 Tamoxifen affects the expression of PKLR mRNA CTD PMID:17555576 and PMID:20937368 Pklr Rat taurine multiple interactions ISO Pklr (Mus musculus) 6480464 Taurine inhibits the reaction [Arsenic Trioxide results in decreased expression of PKLR mRNA] CTD PMID:30362509 Pklr Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of PKLR mRNA CTD PMID:17522070 more ... Pklr Rat tetrachloromethane decreases expression ISO Pklr (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of PKLR mRNA CTD PMID:31919559 Pklr Rat tetrachloromethane increases methylation EXP 6480464 Carbon Tetrachloride results in increased methylation of PKLR promoter CTD PMID:30690589 Pklr Rat tetracycline decreases expression EXP 6480464 Tetracycline results in decreased expression of PKLR mRNA CTD PMID:17522070 and PMID:19224547 Pklr Rat thapsigargin increases expression EXP 6480464 Thapsigargin results in increased expression of PKLR protein CTD PMID:35544339 Pklr Rat theophylline decreases expression EXP 6480464 Theophylline results in decreased expression of PKLR mRNA CTD PMID:17522070 Pklr Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of PKLR mRNA CTD PMID:19483382 Pklr Rat thioacetamide multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in decreased expression of PKLR mRNA CTD PMID:28943392 Pklr Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of PKLR mRNA CTD PMID:23411599 more ... Pklr Rat titanium dioxide multiple interactions ISO Pklr (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of PKLR mRNA CTD PMID:29950665 Pklr Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of PKLR mRNA CTD PMID:25729387 Pklr Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of PKLR mRNA CTD PMID:25729387 Pklr Rat triadimefon decreases expression EXP 6480464 triadimefon results in decreased expression of PKLR mRNA CTD PMID:19423681 Pklr Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of PKLR mRNA CTD PMID:33387578 Pklr Rat Triptolide decreases expression ISO Pklr (Mus musculus) 6480464 triptolide results in decreased expression of PKLR mRNA CTD PMID:32835833 Pklr Rat Triptolide decreases expression EXP 6480464 triptolide results in decreased expression of PKLR mRNA CTD PMID:23639586 Pklr Rat triptonide increases expression ISO Pklr (Mus musculus) 6480464 triptonide results in increased expression of PKLR mRNA CTD PMID:33045310 Pklr Rat troglitazone decreases expression EXP 6480464 troglitazone results in decreased expression of PKLR protein CTD PMID:21315101 Pklr Rat troglitazone decreases expression ISO PKLR (Homo sapiens) 6480464 troglitazone results in decreased expression of PKLR mRNA CTD PMID:25572481 Pklr Rat urethane decreases expression ISO PKLR (Homo sapiens) 6480464 Urethane results in decreased expression of PKLR mRNA CTD PMID:28818685 Pklr Rat ursodeoxycholic acid decreases expression EXP 6480464 Ursodeoxycholic Acid results in decreased expression of PKLR mRNA CTD PMID:15885361 Pklr Rat valdecoxib decreases expression EXP 6480464 valdecoxib results in decreased expression of PKLR mRNA CTD PMID:24136188 Pklr Rat valproic acid decreases expression ISO PKLR (Homo sapiens) 6480464 Valproic Acid results in decreased expression of PKLR mRNA and Valproic Acid results in decreased expression of PKLR protein CTD PMID:29154799 and PMID:29501571 Pklr Rat valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of PKLR mRNA CTD PMID:19224547 Pklr Rat valproic acid increases methylation ISO PKLR (Homo sapiens) 6480464 Valproic Acid results in increased methylation of PKLR gene CTD PMID:29154799
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(1->4)-beta-D-glucan (ISO) (S)-nicotine (ISO) 1,1-dichloroethene (ISO) 1,2-dichloroethane (ISO) 1-naphthyl isothiocyanate (EXP) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP,ISO) 2,2',5,5'-tetrachlorobiphenyl (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-trinitrobenzenesulfonic acid (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,4-dinitrotoluene (EXP) 2-butoxyethanol (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP,ISO) 3-chloropropane-1,2-diol (EXP) 3-phenylprop-2-enal (EXP) 3H-1,2-dithiole-3-thione (EXP) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxy-3-[4-(2-hydroxyphenyl)phenyl]-6-oxo-7H-thieno[2,3-b]pyridine-5-carbonitrile (EXP) 4-hydroxyphenyl retinamide (ISO) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP) 6-propyl-2-thiouracil (EXP) acetamide (EXP) aflatoxin B1 (EXP,ISO) aldehydo-D-glucose (EXP,ISO) all-trans-retinoic acid (ISO) aluminium atom (ISO) aluminium(0) (ISO) amiodarone (EXP) ammonium chloride (EXP) amphotericin B (ISO) aristolochic acid A (EXP) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) atorvastatin calcium (EXP) atrazine (ISO) Azoxymethane (ISO) benzbromarone (EXP) benzo[a]pyrene (ISO) bicalutamide (EXP) bifenthrin (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) bosentan (ISO) bromobenzene (EXP) buspirone (EXP) Butylbenzyl phthalate (ISO) cadmium atom (ISO) cadmium dichloride (EXP) calcium atom (EXP) calcium(0) (EXP) carbon nanotube (ISO) chlorothalonil (ISO) cholesterol (ISO) choline (ISO) clofibrate (EXP,ISO) cobalt dichloride (EXP) copper atom (EXP) copper(0) (EXP) cyclosporin A (EXP,ISO) cypermethrin (ISO) D-glucose (EXP,ISO) dextran sulfate (ISO) diarsenic trioxide (ISO) dibenz[a,h]anthracene (ISO) dibutyl phthalate (EXP) diclofenac (ISO) diethyl maleate (EXP) dihydroxyacetone (EXP) Diosbulbin B (ISO) diquat (ISO) disodium selenite (ISO) duvoglustat (ISO) endosulfan (EXP,ISO) epoxiconazole (ISO) erythromycin estolate (EXP) ethanol (ISO) fenofibrate (ISO) fenthion (ISO) flavonoids (EXP) flumequine (ISO) flutamide (EXP,ISO) fructose (EXP,ISO) furan (EXP) gentamycin (EXP) glucose (EXP,ISO) glyburide (EXP) glycerol (EXP,ISO) hexadecanoic acid (ISO) hydroxyurea (ISO) indometacin (EXP) isotretinoin (ISO) L-ethionine (EXP) L-methionine (ISO) Lasiocarpine (ISO) leflunomide (EXP) lipopolysaccharide (ISO) mercury atom (ISO) mercury(0) (ISO) metformin (EXP) methapyrilene (EXP) mono(2-ethylhexyl) phthalate (ISO) monosodium L-glutamate (EXP) N-[3,5-bis(trifluoromethyl)phenyl]-5-chloro-2-hydroxybenzamide (ISO) N-nitrosodiethylamine (EXP) N-nitrosodimethylamine (EXP) N-Nitrosopyrrolidine (ISO) naloxone (EXP) nefazodone (EXP) nickel atom (ISO) nicotine (ISO) nimesulide (EXP) nitrofen (EXP) nordihydroguaiaretic acid (EXP) O-methyleugenol (ISO) ochratoxin A (EXP) octadecanoic acid (ISO) oleic acid (ISO) omeprazole (EXP) oxaliplatin (EXP) ozone (EXP,ISO) p-anisidine (ISO) p-toluidine (EXP) paclitaxel (ISO) paracetamol (EXP,ISO) PCB138 (EXP) penconazole (ISO) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (EXP,ISO) perfluorooctanoic acid (EXP,ISO) permethrin (ISO) phenformin (EXP) phenobarbital (EXP,ISO) phenylephrine (EXP) piperonyl butoxide (EXP) pirinixic acid (EXP,ISO) pregnenolone 16alpha-carbonitrile (EXP,ISO) procymidone (ISO) propamocarb (ISO) propane-1,2-diol (ISO) propiconazole (EXP) Propiverine (EXP) prostaglandin E2 (ISO) quinidine (EXP) resveratrol (ISO) rifampicin (ISO) rotenone (EXP) S-(1,2-dichlorovinyl)-L-cysteine (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (EXP,ISO) sodium dichromate (EXP) streptozocin (EXP,ISO) succimer (ISO) sucrose (ISO) sulforaphane (EXP) sulprostone (ISO) suxibuzone (EXP) tamoxifen (EXP,ISO) taurine (ISO) tetrachloromethane (EXP,ISO) tetracycline (EXP) thapsigargin (EXP) theophylline (EXP) thioacetamide (EXP) titanium dioxide (ISO) topotecan (EXP) triadimefon (EXP) trichloroethene (EXP) Triptolide (EXP,ISO) triptonide (ISO) troglitazone (EXP,ISO) urethane (ISO) ursodeoxycholic acid (EXP) valdecoxib (EXP) valproic acid (EXP,ISO)
1.
Lack of association between PKLR rs3020781 and NOS1AP rs7538490 and type 2 diabetes, overweight, obesity and related metabolic phenotypes in a Danish large-scale study: case-control studies and analyses of quantitative traits.
Andreasen CH, etal., BMC Med Genet. 2008 Dec 26;9:118. doi: 10.1186/1471-2350-9-118.
2.
Tungstate is an effective antidiabetic agent in streptozotocin-induced diabetic rats: a long-term study.
Barbera A, etal., Diabetologia. 2001 Apr;44(4):507-13.
3.
Differential hepatic gene expression in a polygenic mouse model with insulin resistance and hyperglycemia: evidence for a combined transcriptional dysregulation of gluconeogenesis and fatty acid synthesis.
Becker W, etal., J Mol Endocrinol. 2004 Feb;32(1):195-208.
4.
Rat liver pyruvate kinase: influence of ligands on activity and fructose 1,6-bisphosphate binding.
Blair JB and Walker RG, Arch Biochem Biophys. 1984 Jul;232(1):202-13. doi: 10.1016/0003-9861(84)90536-8.
5.
Key enzymes of carbohydrate metabolism as targets of the 11.5-kDa Zn(2+)-binding protein (parathymosin).
Brand IA and Heinickel A, J Biol Chem. 1991 Nov 5;266(31):20984-9.
6.
Red blood cell PK deficiency: An update of PK-LR gene mutation database.
Canu G, etal., Blood Cells Mol Dis. 2016 Mar;57:100-9. doi: 10.1016/j.bcmd.2015.12.009. Epub 2016 Jan 12.
7.
Structure of the rat L-type pyruvate kinase gene.
Cognet M, etal., J Mol Biol 1987 Jul 5;196(1):11-25.
8.
Insulin and cyclic AMP act at different levels on transcription of the L-type pyruvate kinase gene.
Cuif MH, etal., FEBS Lett. 1997 Nov 3;417(1):81-4.
9.
Pyruvate kinase activation and lipoperoxidation after selective hepatic ischemia in Wistar rats.
de Faatima Santana Ferreira Boin I, etal., Acta Cir Bras. 2006;21 Suppl 1:19-23.
10.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
11.
Relationships between concentration of hepatic intermediary metabolites and induction of the key glycolytic enzymes in vivo.
Gunn JM and Taylor CB, Biochem J. 1973 Nov;136(3):455-65.
12.
Disordered expression of hepatic glycolytic and gluconeogenic enzymes in Otsuka Long-Evans Tokushima fatty rats with spontanteous long-term hyperglycemia.
Hotta K, etal., Biochim Biophys Acta. 1996 Feb 9;1289(1):145-9.
13.
Dietary lipoic acid-dependent changes in the activity and mRNA levels of hepatic lipogenic enzymes in rats.
Huong DT and Ide T, Br J Nutr. 2008 Jul;100(1):79-87. Epub 2007 Dec 7.
14.
Exogenous Mg-ATP induces a large inhibition of pyruvate kinase in intact rat hepatocytes.
Ichai C, etal., J Biol Chem. 2001 Mar 2;276(9):6398-403. Epub 2000 Dec 4.
15.
Complete amino acid sequence of rat L-type pyruvate kinase deduced from the cDNA sequence.
Inoue H, etal., Eur J Biochem 1986 Jan 15;154(2):465-9.
16.
Some kinetic properties of liver pyruvate kinase (type L). 3. Effect of monovalent cations on its allosteric behavior.
Jimenez de Asua L, etal., J Biol Chem. 1970 Aug 10;245(15):3901-5.
17.
Identical point mutations of the R-type pyruvate kinase (PK) cDNA found in unrelated PK variants associated with hereditary hemolytic anemia.
Kanno H, etal., Blood. 1992 Mar 1;79(5):1347-50.
18.
Molecular abnormality of erythrocyte pyruvate kinase deficiency in the Amish.
Kanno H, etal., Blood. 1994 Apr 15;83(8):2311-6.
19.
Hereditary hemolytic anemia caused by diverse point mutations of pyruvate kinase gene found in Japan and Hong Kong.
Kanno H, etal., Blood. 1994 Nov 15;84(10):3505-9.
20.
Primary structure of murine red blood cell-type pyruvate kinase (PK) and molecular characterization of PK deficiency identified in the CBA strain.
Kanno H, etal., Blood. 1995 Oct 15;86(8):3205-10.
21.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
22.
Fuel and hormone regulation of phospholipase C beta 1 and delta 1 overexpressed in RINm5F pancreatic beta cells.
Kelley GG, etal., Mol Cell Endocrinol. 2001 May 25;177(1-2):107-15.
23.
Cross-talk between the signals hypoxia and glucose at the glucose response element of the L-type pyruvate kinase gene.
Krones A, etal., Endocrinology 2001 Jun;142(6):2707-18.
24.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
25.
Improved radiation hybrid map of rat chromosome 2: colocalization of the genes encoding corticotropin-releasing hormone and IL6-receptor with quantitative trait loci regulating the inflammatory response.
Laes JF, etal., Cytogenet Cell Genet 2001;92(1-2):130-3.
26.
Complete nucleotide and deduced amino acid sequences of rat L-type pyruvate kinase.
Lone YC, etal., FEBS Lett 1986 Jan 20;195(1-2):97-100.
27.
Sequences complementary to the brain-specific "identifier" sequences exist in L-type pyruvate kinase mRNA (a liver-specific messenger) and in transcripts especially abundant in muscle.
Lone YC, etal., J Biol Chem 1986 Feb 5;261(4):1499-502.
28.
Malaria: looking for selection signatures in the human PKLR gene region.
Machado P, etal., Br J Haematol. 2010 Jun;149(5):775-84. doi: 10.1111/j.1365-2141.2010.08165.x. Epub 2010 Apr 4.
29.
A new PKLR gene mutation in the R-type promoter region affects the gene transcription causing pyruvate kinase deficiency.
Manco L, etal., Br J Haematol. 2000 Sep;110(4):993-7.
30.
Tissue-specific heterogeneity of the 3'-untranslated region of L-type pyruvate kinase mRNAs.
Marie J, etal., Eur J Biochem 1986 Jul 1;158(1):33-41.
31.
Rescue of pyruvate kinase deficiency in mice by gene therapy using the human isoenzyme.
Meza NW, etal., Mol Ther. 2009 Dec;17(12):2000-9. doi: 10.1038/mt.2009.200. Epub 2009 Sep 15.
32.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
33.
Pyruvate kinase deficiency in mice protects against malaria.
Min-Oo G, etal., Nat Genet. 2003 Dec;35(4):357-62. Epub 2003 Nov 2.
34.
In vivo effect of Trigonella foenum graecum on the expression of pyruvate kinase, phosphoenolpyruvate carboxykinase, and distribution of glucose transporter (GLUT4) in alloxan-diabetic rats.
Mohammad S, etal., Can J Physiol Pharmacol. 2006 Jun;84(6):647-54.
35.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
36.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
37.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
38.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
39.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
40.
Pyruvate kinase deficiency in France: a 3-year study reveals 27 new mutations.
Pissard S, etal., Br J Haematol. 2006 Jun;133(6):683-9.
41.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
42.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
43.
Overexpression of c-myc in the liver prevents obesity and insulin resistance.
Riu E, etal., FASEB J. 2003 Sep;17(12):1715-7. Epub 2003 Jul 18.
44.
Linkage disequilibrium of common Gaucher disease mutations with a polymorphic site in the pyruvate kinase (PKLR) gene.
Rockah R, etal., Am J Med Genet. 1998 Jul 7;78(3):233-6.
45.
Lithium's effects on rat liver glucose metabolism in vivo.
Rodriguez-Gil JE, etal., Arch Biochem Biophys. 2000 Mar 15;375(2):377-84.
46.
Molecular cloning and nucleotide sequence of the gene for pyruvate kinase of Bacillus stearothermophilus and the production of the enzyme in Escherichia coli. Evidence that the genes for phosphofructokinase and pyruvate kinase constitute an operon.
Sakai H and Ohta T, Eur J Biochem 1993 Feb 1;211(3):851-9.
47.
Modulation of gluconeogenesis by epinephrine in hepatocytes isolated from genetically obese (fa/fa) Zucker rats.
Sanchez-Gutierrez JC, etal., Arch Biochem Biophys. 2000 Jan 1;373(1):249-54.
48.
Effect of sesame seeds rich in sesamin and sesamolin on fatty acid oxidation in rat liver.
Sirato-Yasumoto S, etal., J Agric Food Chem. 2001 May;49(5):2647-51.
49.
Liver pyruvate kinase polymorphisms are associated with type 2 diabetes in northern European Caucasians.
Wang H, etal., Diabetes. 2002 Sep;51(9):2861-5.
50.
Induction and suppression of the key enzymes of glycolysis and gluconeogenesis in isolated perfused rat liver in response to glucose, fructose and lactate.
Wimhurst JM and Manchester KL, Biochem J. 1973 May;134(1):143-56.
51.
Regulation of rat hepatic L-pyruvate kinase promoter composition and activity by glucose, n-3 polyunsaturated fatty acids, and peroxisome proliferator-activated receptor-alpha agonist.
Xu J, etal., J Biol Chem. 2006 Jul 7;281(27):18351-62. Epub 2006 Apr 27.
52.
Effect of Creosote Bush-Derived NDGA on Expression of Genes Involved in Lipid Metabolism in Liver of High-Fructose Fed Rats: Relevance to NDGA Amelioration of Hypertriglyceridemia and Hepatic Steatosis.
Zhang H, etal., PLoS One. 2015 Sep 22;10(9):e0138203. doi: 10.1371/journal.pone.0138203. eCollection 2015.
53.
Effect of thermal injury on relative anaplerosis and gluconeogenesis in the rat during infusion of [U-13C] propionate.
Zhaofan X, etal., Burns. 2002 Nov;28(7):625-30.
Pklr Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 176,840,779 - 176,849,637 (+) NCBI GRCr8 mRatBN7.2 2 174,543,008 - 174,551,863 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 174,543,039 - 174,551,870 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 181,689,431 - 181,697,810 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 179,711,798 - 179,720,184 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 174,311,737 - 174,320,129 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 188,449,158 - 188,458,034 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 188,449,210 - 188,459,592 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 207,865,529 - 207,874,394 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 181,214,853 - 181,223,505 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 181,164,961 - 181,173,618 (+) NCBI Celera 2 168,486,468 - 168,494,841 (+) NCBI Celera RH 3.4 Map 2 1154.4 RGD Cytogenetic Map 2 q34 NCBI
PKLR Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 155,289,293 - 155,308,654 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 155,289,293 - 155,301,438 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 155,259,084 - 155,271,229 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 153,526,254 - 153,537,835 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 152,072,702 - 152,084,298 NCBI Celera 1 128,332,260 - 128,344,368 (-) NCBI Celera Cytogenetic Map 1 q22 NCBI HuRef 1 126,621,396 - 126,633,527 (-) NCBI HuRef CHM1_1 1 156,654,499 - 156,666,666 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 154,427,854 - 154,447,170 (-) NCBI T2T-CHM13v2.0
Pklr Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 89,043,429 - 89,054,122 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 89,043,449 - 89,054,091 (+) Ensembl GRCm39 Ensembl GRCm38 3 89,136,122 - 89,146,815 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 89,136,142 - 89,146,784 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 88,940,064 - 88,950,516 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 89,222,069 - 89,231,560 (+) NCBI MGSCv36 mm8 Celera 3 89,168,271 - 89,180,284 (+) NCBI Celera Cytogenetic Map 3 F1 NCBI cM Map 3 39.01 NCBI
Pklr Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955545 1,739,152 - 1,749,632 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955545 1,742,432 - 1,749,632 (-) NCBI ChiLan1.0 ChiLan1.0
PKLR Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 94,540,674 - 94,554,495 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 94,272,005 - 94,285,754 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 130,634,111 - 130,646,644 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 134,239,565 - 134,250,957 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 134,239,565 - 134,251,351 (-) Ensembl panpan1.1 panPan2
PKLR Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 7 42,263,899 - 42,272,770 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 7 42,263,761 - 42,272,755 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 7 41,754,768 - 41,762,716 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 7 42,132,983 - 42,141,903 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 7 42,133,018 - 42,141,000 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 7 41,912,888 - 41,920,846 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 7 41,966,693 - 41,974,641 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 7 42,250,696 - 42,258,642 (+) NCBI UU_Cfam_GSD_1.0
Pklr Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 25,740,581 - 25,749,528 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936580 4,767,109 - 4,779,916 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936580 4,770,977 - 4,799,316 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PKLR Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 94,537,019 - 94,546,555 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 94,536,978 - 94,546,561 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 103,324,615 - 103,327,436 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PKLR Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 8,540,228 - 8,547,184 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 8,540,763 - 8,545,884 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 7,877,122 - 7,888,169 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Pklr
.
Predicted Target Of
Count of predictions: 481 Count of miRNA genes: 183 Interacting mature miRNAs: 217 Transcripts: ENSRNOT00000027700, ENSRNOT00000065791 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
1578648 Bss11 Bone structure and strength QTL 11 4.7 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 2 114837527 211674221 Rat 1358356 Srcrt1 Stress Responsive Cort QTL1 3.66 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 2 161699179 222436696 Rat 1331734 Bp204 Blood pressure QTL 204 3.61192 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 168358098 223265385 Rat 1298074 Bp164 Blood pressure QTL 164 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 1354648 Bp239 Blood pressure QTL 239 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118463 226797303 Rat 1354649 Kidm17 Kidney mass QTL 17 2.9 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 2 81754530 227146641 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 1298076 Bp166 Blood pressure QTL 166 0.0009 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 136445150 202447032 Rat 61457 Niddm8 Non-insulin dependent diabetes mellitus QTL 8 4.1 0.01 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 2 174543008 175950118 Rat 152025245 Scl81 Serum cholesterol level QTL 81 3.49 blood cholesterol amount (VT:0000180) 2 122609194 206936711 Rat 70162 Bp63 Blood pressure QTL 63 5.64 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 2 169745596 214745596 Rat 1554319 Bmd2 Bone mineral density QTL 2 13.4 0.0001 lumbar vertebra area (VT:0010570) lumbar vertebra cross-sectional area (CMO:0001689) 2 114837675 212549332 Rat 12879836 Kidm61 Kidney mass QTL 61 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 152413072 185122374 Rat 1581569 Uae32 Urinary albumin excretion QTL 32 0.0001 urine protein amount (VT:0005160) urine albumin excretion rate (CMO:0000757) 2 78665619 219826953 Rat 10043136 Iddm54 Insulin dependent diabetes mellitus QTL 54 3.4 0.0001 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 2 143657411 190602963 Rat 12879837 Am2 Aortic mass QTL 2 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 2 152413072 185122374 Rat 12879838 Cm86 Cardiac mass QTL 86 0.002 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 2 152413072 185122374 Rat 1302793 Bw16 Body weight QTL 16 5 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 2 157142209 202446871 Rat 61467 Bp14 Blood pressure QTL 14 2.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 43154682 202446871 Rat 12879839 Cm85 Cardiac mass QTL 85 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 2 152413072 185122374 Rat 61469 Bp16 Blood pressure QTL 16 5.64 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 2 169745596 214745596 Rat 70175 BpQTLCluster3 Blood pressure QTL cluster 3 4.128 arterial blood pressure trait (VT:2000000) absolute change in systolic blood pressure (CMO:0000607) 2 135552573 202446871 Rat 1549833 Bp257 Blood pressure QTL 257 0.003 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 168354880 185122374 Rat 1358900 Bw48 Body weight QTL 48 4.88 body mass (VT:0001259) body weight (CMO:0000012) 2 157142078 211086598 Rat 12879845 Cm89 Cardiac mass QTL 89 0.008 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 2 152413072 175950118 Rat 61473 Bp19 Blood pressure QTL 19 6.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 172710921 175950118 Rat 1359030 Bp277 Blood pressure QTL 277 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 114837527 185876470 Rat 12879846 Cm90 Cardiac mass QTL 90 0.011 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 2 152413072 175950118 Rat 12879847 Am4 Aortic mass QTL 4 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 2 152413072 175950118 Rat 1331760 Bp206 Blood pressure QTL 206 3.62454 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 56043031 202447032 Rat 12879840 Bw179 Body weight QTL 179 0.005 body mass (VT:0001259) body weight (CMO:0000012) 2 152413072 185122374 Rat 1581502 Esta3 Estrogen-induced thymic atrophy QTL 3 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 2 136916935 189599348 Rat 1359032 Hrtrt18 Heart rate QTL 18 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 2 157142078 192625452 Rat 2301966 Bp322 Blood pressure QTL 322 3.58 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 150540301 202447032 Rat 1298080 Bp163 Blood pressure QTL 163 0.02 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118275 202447032 Rat 8662832 Vetf7 Vascular elastic tissue fragility QTL 7 3.5 aorta elastin amount (VT:0003905) aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002) 2 81689826 221035911 Rat 1298085 Bp165 Blood pressure QTL 165 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 1359022 Ppulsi1 Prepulse inhibition QTL 1 3.63 prepulse inhibition trait (VT:0003088) acoustic startle response measurement (CMO:0001519) 2 136916935 213594495 Rat 1641891 Alcrsp17 Alcohol response QTL 17 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 249053267 Rat 724534 Uae6 Urinary albumin excretion QTL 6 10 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 2 78665619 249053267 Rat 61374 Edpm2 Estrogen-dependent pituitary mass QTL 2 4.42 0.86 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 2 76539322 202447032 Rat 8662843 Vetf9 Vascular elastic tissue fragility QTL 9 2.05 thoracic aorta molecular composition trait (VT:0010568) aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003) 2 157142078 226277316 Rat 631501 Bp101 Blood pressure QTL 101 2.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 150341684 202446871 Rat 2301415 Cm67 Cardiac mass QTL 67 0.003 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 2 152413072 175950118 Rat 2307174 Activ3 Activity QTL 3 4.83 0.000058 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 2 168594495 213594495 Rat 1331794 Bp202 Blood pressure QTL 202 3.66819 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 141194931 223265385 Rat 71113 Cari2 Carrageenan-induced inflammation QTL 2 2.7 0.009 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 2 141596551 202447032 Rat 1331805 Cm29 Cardiac mass QTL 29 3.50746 heart mass (VT:0007028) heart wet weight (CMO:0000069) 2 141194931 223265385 Rat 11565180 Kidm56 Kidney mass QTL 56 0.003 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 152413072 175950118 Rat 634308 Sach6 Saccharin preference QTL 6 4.9 taste sensitivity trait (VT:0001986) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 2 112456140 212696837 Rat 1598805 Memor8 Memory QTL 8 3 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 2 150341585 189039377 Rat 11565181 Bw176 Body weight QTL 176 0.002 body mass (VT:0001259) body weight (CMO:0000012) 2 152413072 175950118 Rat 1358917 Cm42 Cardiac mass QTL 42 2.82 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 724568 Uae13 Urinary albumin excretion QTL 13 4.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 2 143157029 210020885 Rat 1358913 Cm41 Cardiac mass QTL 41 2.73 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 1300165 Rf9 Renal function QTL 9 3.28 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 2 133914684 202447032 Rat 61401 Niddm2 Non-insulin dependent diabetes mellitus QTL 2 4.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 144599348 189599348 Rat 631507 Bp105 Blood pressure QTL 105 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 112456140 212696837 Rat 1641925 Alcrsp2 Alcohol response QTL 2 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 221167075 Rat 1354609 Niddm62 Non-insulin dependent diabetes mellitus QTL 62 4.72 0.000006 insulin secretion trait (VT:0003564) plasma insulin level (CMO:0000342) 2 150540301 202447032 Rat 1598833 Bp295 Blood pressure QTL 295 3.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 147798556 192798556 Rat 1354622 Kidm16 Kidney mass QTL 16 3 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 2 81754530 222436696 Rat 631266 Bp132 Blood pressure QTL 132 0.0005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 46123260 202447032 Rat 631522 Bp74 Blood pressure QTL 74 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 172710921 184114403 Rat 7488927 Bp365 Blood pressure QTL 365 0.008 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 162765032 207765032 Rat 1598838 Bp290 Blood pressure QTL 290 1.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 166539266 211539266 Rat 7488925 Bp364 Blood pressure QTL 364 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 160564068 205564068 Rat 2293843 Kiddil6 Kidney dilation QTL 6 3.1 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 42804607 182042367 Rat 2306901 Bp337 Blood pressure QTL 337 0.01 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 164073756 227146641 Rat 1354605 Rf48 Renal function QTL 48 2.9 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 2 74786664 206665859 Rat 6903312 Bw112 Body weight QTL 112 3.2 0.0013 body mass (VT:0001259) body weight (CMO:0000012) 2 143657569 184114274 Rat 7488904 Bp363 Blood pressure QTL 363 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 172982062 175950118 Rat 1354601 Slep1 Serum leptin concentration QTL 1 5.39 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 2 43171017 184114403 Rat
D2Mit20
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 4 6,077,269 - 6,077,392 (+) Marker Load Pipeline mRatBN7.2 4 5,401,881 - 5,402,004 (-) MAPPER mRatBN7.2 Rnor_6.0 4 2,864,180 - 2,864,302 NCBI Rnor6.0 Rnor_5.0 4 2,914,519 - 2,914,621 NCBI Rnor5.0 RGSC_v3.4 4 638,592 - 638,715 RGD RGSC3.4 RGSC_v3.4 4 638,593 - 638,715 UniSTS RGSC3.4 RGSC_v3.1 4 638,593 - 638,715 RGD Celera 4 4,914,519 - 4,914,641 UniSTS RH 3.4 Map 2 1154.4 RGD RH 3.4 Map 2 1154.4 UniSTS RH 2.0 Map 2 881.7 RGD FHH x ACI Map 2 76.6299 RGD Cytogenetic Map 2 q34 UniSTS
D2Wox19
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 174,540,761 - 174,540,907 (+) MAPPER mRatBN7.2 Rnor_6.0 2 188,446,935 - 188,447,078 NCBI Rnor6.0 Rnor_5.0 2 207,863,301 - 207,863,444 UniSTS Rnor5.0 RGSC_v3.4 2 181,212,126 - 181,212,270 RGD RGSC3.4 RGSC_v3.4 2 181,212,127 - 181,212,270 UniSTS RGSC3.4 RGSC_v3.1 2 181,162,232 - 181,162,376 RGD Celera 2 168,483,756 - 168,483,887 UniSTS Cytogenetic Map 2 q34 UniSTS
D2Wox20
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 2 176,839,632 - 176,839,808 (+) Marker Load Pipeline mRatBN7.2 2 174,541,858 - 174,542,034 (+) MAPPER mRatBN7.2 Rnor_6.0 2 188,448,030 - 188,448,205 NCBI Rnor6.0 Rnor_5.0 2 207,864,396 - 207,864,571 UniSTS Rnor5.0 RGSC_v3.4 2 181,213,221 - 181,213,397 RGD RGSC3.4 RGSC_v3.4 2 181,213,222 - 181,213,397 UniSTS RGSC3.4 RGSC_v3.1 2 181,163,327 - 181,163,503 RGD Celera 2 168,484,839 - 168,485,012 UniSTS Cytogenetic Map 2 q34 UniSTS
D2Wox21
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 2 176,838,530 - 176,838,701 (+) Marker Load Pipeline mRatBN7.2 2 174,540,754 - 174,540,927 (+) MAPPER mRatBN7.2 Rnor_6.0 2 188,446,928 - 188,447,098 NCBI Rnor6.0 Rnor_5.0 2 207,863,294 - 207,863,464 UniSTS Rnor5.0 RGSC_v3.4 2 181,212,119 - 181,212,290 RGD RGSC3.4 RGSC_v3.4 2 181,212,120 - 181,212,290 UniSTS RGSC3.4 RGSC_v3.1 2 181,162,225 - 181,162,396 RGD Celera 2 168,483,749 - 168,483,907 UniSTS RH 3.4 Map 2 1157.4 RGD RH 3.4 Map 2 1157.4 UniSTS Cytogenetic Map 2 q34 UniSTS
D2Wox22
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 2 176,839,617 - 176,839,769 (+) Marker Load Pipeline mRatBN7.2 2 174,541,843 - 174,541,995 (+) MAPPER mRatBN7.2 Rnor_6.0 2 188,448,015 - 188,448,166 NCBI Rnor6.0 Rnor_5.0 2 207,864,381 - 207,864,532 UniSTS Rnor5.0 RGSC_v3.4 2 181,213,206 - 181,213,358 RGD RGSC3.4 RGSC_v3.4 2 181,213,207 - 181,213,358 UniSTS RGSC3.4 RGSC_v3.1 2 181,163,312 - 181,163,464 RGD Celera 2 168,484,824 - 168,484,973 UniSTS Cytogenetic Map 2 q34 UniSTS
D2Arb15
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 2 176,844,055 - 176,844,254 (+) Marker Load Pipeline mRatBN7.2 2 174,546,281 - 174,546,480 (+) MAPPER mRatBN7.2 Rnor_6.0 2 188,452,453 - 188,452,651 NCBI Rnor6.0 Rnor_5.0 2 207,868,819 - 207,869,017 UniSTS Rnor5.0 RGSC_v3.4 2 181,217,645 - 181,217,844 RGD RGSC3.4 RGSC_v3.4 2 181,217,646 - 181,217,844 UniSTS RGSC3.4 RGSC_v3.1 2 181,167,751 - 181,167,950 RGD Celera 2 168,489,260 - 168,489,458 UniSTS SHRSP x BN Map 2 71.2798 UniSTS SHRSP x BN Map 2 71.2798 RGD FHH x ACI Map 2 76.5599 RGD Cytogenetic Map 2 q34 UniSTS
D2Mgh28
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 174,546,354 - 174,546,494 (+) MAPPER mRatBN7.2 Rnor_6.0 2 188,452,526 - 188,452,665 NCBI Rnor6.0 Rnor_5.0 2 207,868,892 - 207,869,031 UniSTS Rnor5.0 RGSC_v3.4 2 181,217,719 - 181,217,858 UniSTS RGSC3.4 RGSC_v3.4 2 181,217,718 - 181,217,858 RGD RGSC3.4 RGSC_v3.1 2 181,167,824 - 181,167,964 RGD Celera 2 168,489,333 - 168,489,472 UniSTS RH 3.4 Map 2 1162.7 RGD RH 3.4 Map 2 1162.7 UniSTS RH 2.0 Map 2 888.4 RGD SHRSP x BN Map 2 71.5798 RGD FHH x ACI Map 2 76.5599 RGD Cytogenetic Map 2 q34 UniSTS
RH130560
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 174,551,638 - 174,551,835 (+) MAPPER mRatBN7.2 Rnor_6.0 2 188,457,810 - 188,458,006 NCBI Rnor6.0 Rnor_5.0 2 207,874,169 - 207,874,365 UniSTS Rnor5.0 RGSC_v3.4 2 181,223,281 - 181,223,477 UniSTS RGSC3.4 Celera 2 168,494,617 - 168,494,813 UniSTS RH 3.4 Map 2 1156.4 UniSTS Cytogenetic Map 2 q34 UniSTS
RH134398
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 174,551,207 - 174,551,395 (+) MAPPER mRatBN7.2 Rnor_6.0 2 188,457,379 - 188,457,566 NCBI Rnor6.0 Rnor_5.0 2 207,873,738 - 207,873,925 UniSTS Rnor5.0 RGSC_v3.4 2 181,222,850 - 181,223,037 UniSTS RGSC3.4 Celera 2 168,494,186 - 168,494,373 UniSTS RH 3.4 Map 2 1155.2 UniSTS Cytogenetic Map 2 q34 UniSTS
BE105864
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 174,552,112 - 174,552,267 (+) MAPPER mRatBN7.2 Rnor_6.0 2 188,458,284 - 188,458,438 NCBI Rnor6.0 Rnor_5.0 2 207,874,643 - 207,874,797 UniSTS Rnor5.0 RGSC_v3.4 2 181,223,755 - 181,223,909 UniSTS RGSC3.4 Celera 2 168,495,091 - 168,495,245 UniSTS RH 3.4 Map 2 1156.8 UniSTS Cytogenetic Map 2 q34 UniSTS
RH94486
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 174,550,715 - 174,550,884 (+) MAPPER mRatBN7.2 Rnor_6.0 2 188,456,887 - 188,457,055 NCBI Rnor6.0 Rnor_5.0 2 207,873,246 - 207,873,414 UniSTS Rnor5.0 RGSC_v3.4 2 181,222,358 - 181,222,526 UniSTS RGSC3.4 Celera 2 168,493,694 - 168,493,862 UniSTS RH 3.4 Map 2 1154.4 UniSTS Cytogenetic Map 2 q34 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
2
34
102
81
76
59
18
59
6
184
69
85
45
55
17
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000027700 ⟹ ENSRNOP00000027700
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 174,543,039 - 174,551,870 (+) Ensembl Rnor_6.0 Ensembl 2 188,449,210 - 188,456,759 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000065791 ⟹ ENSRNOP00000058886
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 174,543,535 - 174,551,870 (+) Ensembl Rnor_6.0 Ensembl 2 188,449,718 - 188,459,592 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000103387 ⟹ ENSRNOP00000093132
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 174,543,490 - 174,551,870 (+) Ensembl
RefSeq Acc Id:
NM_012624 ⟹ NP_036756
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 176,841,264 - 176,849,637 (+) NCBI mRatBN7.2 2 174,543,490 - 174,551,863 (+) NCBI Rnor_6.0 2 188,449,661 - 188,458,034 (+) NCBI Rnor_5.0 2 207,865,529 - 207,874,394 (+) NCBI RGSC_v3.4 2 181,214,853 - 181,223,505 (+) RGD Celera 2 168,486,468 - 168,494,841 (+) RGD
Sequence:
AAGCAACGTAGCAGCATGGAAGGGCCAGCGGGATACCTTCGACGTGCGAGTGTGGCTCAACTGACCCAGGAGCTGGGCACTGCCTTCTTCCAGCAGCAGCAACTGCCCGCAGCTATGGCGGACACCTT
hide sequence
RefSeq Acc Id:
XM_006232593 ⟹ XP_006232655
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 176,840,779 - 176,849,637 (+) NCBI mRatBN7.2 2 174,543,008 - 174,550,926 (+) NCBI Rnor_6.0 2 188,449,158 - 188,457,097 (+) NCBI Rnor_5.0 2 207,865,529 - 207,874,394 (+) NCBI
Sequence:
ACTCTCCTCCCAGTCTGCCGTTCTTGCAGACACAGTTCCACGCTTTGGAAGCATGTCTGTCCAGGAGAACACTCTACCCCAGCAGCTCTGGCCGTGGATCTTTAGGTCCCAAAAAGACTTGGCAAAGT
hide sequence
RefSeq Acc Id:
XM_039101740 ⟹ XP_038957668
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 176,841,182 - 176,849,637 (+) NCBI mRatBN7.2 2 174,543,408 - 174,550,926 (+) NCBI
RefSeq Acc Id:
XM_063281304 ⟹ XP_063137374
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 176,840,779 - 176,845,540 (+) NCBI
RefSeq Acc Id:
XM_063281305 ⟹ XP_063137375
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 176,840,779 - 176,845,552 (+) NCBI
RefSeq Acc Id:
XR_005500240
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 176,840,779 - 176,845,901 (+) NCBI mRatBN7.2 2 174,543,008 - 174,548,123 (+) NCBI
RefSeq Acc Id:
NP_036756 ⟸ NM_012624
- UniProtKB:
B1WBN9 (UniProtKB/TrEMBL), A0A0H2UI07 (UniProtKB/TrEMBL)
- Sequence:
MEGPAGYLRRASVAQLTQELGTAFFQQQQLPAAMADTFLEHLCLLDIDSQPVAARSTSIIATIGPASRSVDRLKEMIKAGMNIARLNFSHGSHEYHAESIANIREATESFATSPLSYRPVAIALDTKG
hide sequence
RefSeq Acc Id:
XP_006232655 ⟸ XM_006232593
- Peptide Label:
isoform X1
- UniProtKB:
P04763 (UniProtKB/Swiss-Prot), Q64618 (UniProtKB/Swiss-Prot), P12928 (UniProtKB/Swiss-Prot), A6J6C1 (UniProtKB/TrEMBL), A0A0H2UI07 (UniProtKB/TrEMBL)
- Sequence:
MSVQENTLPQQLWPWIFRSQKDLAKSALSGAPGGPAGYLRRASVAQLTQELGTAFFQQQQLPAA
hide sequence
Ensembl Acc Id:
ENSRNOP00000058886 ⟸ ENSRNOT00000065791
Ensembl Acc Id:
ENSRNOP00000027700 ⟸ ENSRNOT00000027700
RefSeq Acc Id:
XP_038957668 ⟸ XM_039101740
- Peptide Label:
isoform X2
- UniProtKB:
A0A0H2UI07 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000093132 ⟸ ENSRNOT00000103387
RefSeq Acc Id:
XP_063137375 ⟸ XM_063281305
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_063137374 ⟸ XM_063281304
- Peptide Label:
isoform X3
RGD ID: 13691457 Promoter ID: EPDNEW_R1982 Type: multiple initiation site Name: Pklr_1 Description: pyruvate kinase L/R SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 2 188,449,661 - 188,449,721 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2017-10-09
Pklr
pyruvate kinase L/R
Pklr
pyruvate kinase, liver and RBC
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-09-09
Pklr
pyruvate kinase, liver and RBC
Pklr
pyruvate kinase, liver and red blood cell
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-11-17
Pklr
pyruvate kinase, liver and red blood cell
Name updated
1299863 APPROVED
2002-06-10
Pklr
pyruvate kinase, liver and RBC
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_domains
contains an N-terminal phosphorylation site
633541
gene_expression
expressed in liver, kidney and small intestine
633544
gene_transcript
three mRNA species of 2kb, 2.2kb and 3.2kb due to alternate sites of endonucleolytic cleavage in the 3' non-translated region
633544
