Symbol:
Pgm1
Name:
phosphoglucomutase 1
RGD ID:
3316
Description:
Enables phosphoglucomutase activity. Involved in cellular response to magnetism and glucose metabolic process. Located in Z disc. Human ortholog(s) of this gene implicated in congenital disorder of glycosylation It; endometrial cancer; and teratoma. Orthologous to human PGM1 (phosphoglucomutase 1); PARTICIPATES IN congenital sucrase-isomaltase deficiency pathway; fructose-1,6-bisphosphatase deficiency pathway; galactokinase deficiency pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2-methoxyethanol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
glucose phosphomutase 1; PGM 1; phosphoglucomutase-1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PGM1 (phosphoglucomutase 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Panther
Mus musculus (house mouse):
Pgm1 (phosphoglucomutase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Pgm1 (phosphoglucomutase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PGM1 (phosphoglucomutase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PGM1 (phosphoglucomutase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Pgm1 (phosphoglucomutase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PGM1 (phosphoglucomutase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PGM1 (phosphoglucomutase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Pgm1 (phosphoglucomutase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Pgm1 (phosphoglucomutase 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
PGM1 (phosphoglucomutase 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Danio rerio (zebrafish):
pgm1 (phosphoglucomutase 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
R05F9.6
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
PGM1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
PGM2
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Pgm1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
pgm1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 119,710,734 - 119,770,159 (+) NCBI GRCr8 mRatBN7.2 5 114,595,298 - 114,654,728 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 114,595,293 - 114,654,728 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 117,151,682 - 117,211,109 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 118,877,005 - 118,936,428 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 118,939,539 - 118,998,971 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 118,743,632 - 118,803,055 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 118,743,632 - 118,803,055 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 122,648,579 - 122,708,212 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 120,595,650 - 120,655,915 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 5 113,142,712 - 113,202,105 (+) NCBI Celera RH 3.4 Map 5 RGD Cytogenetic Map 5 q33 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pgm1 Rat (-)-demecolcine decreases expression ISO PGM1 (Homo sapiens) 6480464 Demecolcine results in decreased expression of PGM1 mRNA CTD PMID:23649840 Pgm1 Rat (1->4)-beta-D-glucan multiple interactions ISO Pgm1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PGM1 mRNA CTD PMID:36331819 Pgm1 Rat 1,2-dimethylhydrazine decreases expression ISO Pgm1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of PGM1 mRNA CTD PMID:22206623 Pgm1 Rat 17alpha-ethynylestradiol increases expression ISO Pgm1 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of PGM1 mRNA CTD PMID:17942748 Pgm1 Rat 17alpha-ethynylestradiol multiple interactions ISO Pgm1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PGM1 mRNA CTD PMID:17942748 Pgm1 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of PGM1 protein CTD PMID:32145629 Pgm1 Rat 17beta-estradiol decreases expression ISO Pgm1 (Mus musculus) 6480464 Estradiol results in decreased expression of PGM1 mRNA CTD PMID:39298647 Pgm1 Rat 1H-pyrazole increases expression ISO Pgm1 (Mus musculus) 6480464 pyrazole results in increased expression of PGM1 mRNA CTD PMID:17945193 Pgm1 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Pgm1 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Pgm1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Pgm1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PGM1 mRNA CTD PMID:17942748 Pgm1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Pgm1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of PGM1 mRNA CTD PMID:27562557 Pgm1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO PGM1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of PGM1 mRNA CTD PMID:23152189 Pgm1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO PGM1 (Homo sapiens) 6480464 2-methyl-2H-pyrazole-3-carboxylic acid (2-methyl-4-o-tolylazophenyl)amide inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of PGM1 mRNA] and alpha-naphthoflavone inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of PGM1 mRNA] CTD PMID:23152189 Pgm1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of PGM1 mRNA CTD PMID:22298810 Pgm1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PGM1 mRNA CTD PMID:18796159 more ... Pgm1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Pgm1 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Pgm1 Rat 2,6-dimethoxyphenol multiple interactions ISO PGM1 (Homo sapiens) 6480464 [pyrogallol 1 and 3-dimethyl ether co-treated with Furaldehyde] results in increased expression of and affects the localization of PGM1 protein CTD PMID:38598786 Pgm1 Rat 2-hydroxypropanoic acid decreases expression ISO PGM1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of PGM1 mRNA CTD PMID:30851411 Pgm1 Rat 2-methoxyethanol decreases expression EXP 6480464 methyl cellosolve results in decreased expression of PGM1 protein CTD PMID:15928459 Pgm1 Rat 4,4'-sulfonyldiphenol increases expression ISO Pgm1 (Mus musculus) 6480464 bisphenol S results in increased expression of PGM1 mRNA CTD PMID:39298647 Pgm1 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of PGM1 mRNA CTD PMID:36041667 Pgm1 Rat 4,4'-sulfonyldiphenol increases expression ISO PGM1 (Homo sapiens) 6480464 bisphenol S results in increased expression of PGM1 protein CTD PMID:34186270 Pgm1 Rat 4-hydroxyphenyl retinamide decreases expression ISO Pgm1 (Mus musculus) 6480464 Fenretinide results in decreased expression of PGM1 mRNA CTD PMID:28973697 Pgm1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of PGM1 mRNA CTD PMID:36843608 Pgm1 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of PGM1 mRNA CTD PMID:28959563 Pgm1 Rat acrylamide decreases expression ISO PGM1 (Homo sapiens) 6480464 Acrylamide results in decreased expression of PGM1 mRNA CTD PMID:32763439 Pgm1 Rat aflatoxin B1 decreases expression ISO PGM1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of PGM1 mRNA CTD PMID:27153756 Pgm1 Rat all-trans-retinoic acid increases expression ISO PGM1 (Homo sapiens) 6480464 Tretinoin results in increased expression of PGM1 mRNA CTD PMID:21934132 and PMID:33167477 Pgm1 Rat alpha-naphthoflavone increases expression ISO PGM1 (Homo sapiens) 6480464 alpha-naphthoflavone results in increased expression of PGM1 mRNA CTD PMID:23152189 Pgm1 Rat alpha-naphthoflavone multiple interactions ISO PGM1 (Homo sapiens) 6480464 alpha-naphthoflavone inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of PGM1 mRNA] CTD PMID:23152189 Pgm1 Rat alpha-Zearalanol decreases expression EXP 6480464 Zeranol results in decreased expression of PGM1 mRNA CTD PMID:35163327 Pgm1 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of PGM1 mRNA CTD PMID:35163327 Pgm1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PGM1 mRNA CTD PMID:16483693 Pgm1 Rat arsenous acid increases expression ISO PGM1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of PGM1 mRNA and Arsenic Trioxide results in increased expression of PGM1 protein CTD PMID:20458559 and PMID:25419056 Pgm1 Rat arsenous acid decreases expression ISO PGM1 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of PGM1 mRNA and Arsenic Trioxide results in decreased expression of PGM1 protein CTD PMID:38160894 Pgm1 Rat arsenous acid multiple interactions ISO PGM1 (Homo sapiens) 6480464 [Ascorbic Acid co-treated with Arsenic Trioxide] results in decreased expression of PGM1 protein more ... CTD PMID:26598702 and PMID:38160894 Pgm1 Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of PGM1 gene CTD PMID:35440735 Pgm1 Rat Azoxymethane multiple interactions ISO Pgm1 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of PGM1 mRNA CTD PMID:29950665 Pgm1 Rat benzo[a]pyrene affects methylation ISO PGM1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of PGM1 promoter CTD PMID:27901495 Pgm1 Rat benzo[a]pyrene decreases expression ISO PGM1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of PGM1 mRNA CTD PMID:32234424 Pgm1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Pgm1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of PGM1 mRNA CTD PMID:34319233 Pgm1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PGM1 mRNA CTD PMID:25181051 Pgm1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of PGM1 mRNA CTD PMID:36041667 Pgm1 Rat bisphenol A decreases expression ISO PGM1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of PGM1 protein CTD PMID:34186270 Pgm1 Rat bisphenol A affects expression ISO PGM1 (Homo sapiens) 6480464 bisphenol A affects the expression of PGM1 mRNA CTD PMID:30903817 Pgm1 Rat bisphenol A increases expression ISO PGM1 (Homo sapiens) 6480464 bisphenol A results in increased expression of PGM1 mRNA and bisphenol A results in increased expression of PGM1 protein CTD PMID:29275510 and PMID:37567409 Pgm1 Rat bisphenol AF increases expression ISO PGM1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of PGM1 protein CTD PMID:34186270 Pgm1 Rat Bisphenol B increases expression ISO PGM1 (Homo sapiens) 6480464 bisphenol B results in increased expression of PGM1 protein CTD PMID:34186270 Pgm1 Rat bisphenol F increases expression ISO Pgm1 (Mus musculus) 6480464 bisphenol F results in increased expression of PGM1 mRNA CTD PMID:38685157 Pgm1 Rat bisphenol F increases expression ISO PGM1 (Homo sapiens) 6480464 bisphenol F results in increased expression of PGM1 protein CTD PMID:34186270 Pgm1 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of PGM1 mRNA CTD PMID:36041667 Pgm1 Rat Brodifacoum increases expression EXP 6480464 bromfenacoum results in increased expression of PGM1 protein CTD PMID:28903499 Pgm1 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of PGM1 mRNA CTD PMID:33453195 Pgm1 Rat cadmium dichloride decreases expression ISO PGM1 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of PGM1 mRNA CTD PMID:38568856 Pgm1 Rat caffeine decreases phosphorylation ISO PGM1 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of PGM1 protein CTD PMID:35688186 Pgm1 Rat capsaicin increases expression ISO PGM1 (Homo sapiens) 6480464 Capsaicin results in increased expression of PGM1 mRNA and Capsaicin results in increased expression of PGM1 protein CTD PMID:19891501 Pgm1 Rat capsaicin decreases expression EXP 6480464 Capsaicin results in decreased expression of PGM1 mRNA CTD PMID:20349343 Pgm1 Rat carbon nanotube increases expression ISO Pgm1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Pgm1 Rat CGP 52608 multiple interactions ISO PGM1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to PGM1 gene] CTD PMID:28238834 Pgm1 Rat chloropicrin decreases expression ISO PGM1 (Homo sapiens) 6480464 chloropicrin results in decreased expression of PGM1 mRNA CTD PMID:26352163 Pgm1 Rat clofibric acid affects expression EXP 6480464 Clofibric Acid affects the expression of PGM1 mRNA CTD PMID:17602206 Pgm1 Rat cobalt dichloride multiple interactions ISO PGM1 (Homo sapiens) 6480464 zinc chloride inhibits the reaction [cobaltous chloride results in increased expression of PGM1 mRNA] CTD PMID:22202117 Pgm1 Rat cobalt dichloride increases expression ISO PGM1 (Homo sapiens) 6480464 cobaltous chloride results in increased expression of PGM1 mRNA CTD PMID:22202117 Pgm1 Rat cobalt dichloride increases expression EXP 6480464 cobaltous chloride results in increased expression of PGM1 mRNA CTD PMID:24386269 Pgm1 Rat coumarin increases phosphorylation ISO PGM1 (Homo sapiens) 6480464 coumarin results in increased phosphorylation of PGM1 protein CTD PMID:35688186 Pgm1 Rat cyclosporin A decreases expression ISO PGM1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of PGM1 mRNA CTD PMID:20106945 more ... Pgm1 Rat deguelin increases expression ISO PGM1 (Homo sapiens) 6480464 deguelin results in increased expression of PGM1 mRNA CTD PMID:33512557 Pgm1 Rat dexamethasone decreases expression ISO Pgm1 (Mus musculus) 6480464 Dexamethasone results in decreased expression of PGM1 protein CTD PMID:33567340 Pgm1 Rat dextran sulfate multiple interactions ISO Pgm1 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of PGM1 mRNA CTD PMID:29950665 Pgm1 Rat diarsenic trioxide increases expression ISO PGM1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of PGM1 mRNA and Arsenic Trioxide results in increased expression of PGM1 protein CTD PMID:20458559 and PMID:25419056 Pgm1 Rat diarsenic trioxide decreases expression ISO PGM1 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of PGM1 mRNA and Arsenic Trioxide results in decreased expression of PGM1 protein CTD PMID:38160894 Pgm1 Rat diarsenic trioxide multiple interactions ISO PGM1 (Homo sapiens) 6480464 [Ascorbic Acid co-treated with Arsenic Trioxide] results in decreased expression of PGM1 protein more ... CTD PMID:26598702 and PMID:38160894 Pgm1 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of PGM1 mRNA CTD PMID:21266533 Pgm1 Rat dinophysistoxin 1 decreases expression ISO PGM1 (Homo sapiens) 6480464 dinophysistoxin 1 results in decreased expression of PGM1 mRNA CTD PMID:28939011 Pgm1 Rat dioxygen increases expression ISO PGM1 (Homo sapiens) 6480464 Oxygen deficiency results in increased expression of PGM1 mRNA CTD PMID:24236059 and PMID:26516004 Pgm1 Rat dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate increases expression ISO PGM1 (Homo sapiens) 6480464 Antimony Potassium Tartrate results in increased expression of PGM1 mRNA CTD PMID:28713220 Pgm1 Rat disodium selenite increases expression ISO PGM1 (Homo sapiens) 6480464 Sodium Selenite results in increased expression of PGM1 mRNA CTD PMID:18175754 Pgm1 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of PGM1 mRNA CTD PMID:25152437 Pgm1 Rat dorsomorphin multiple interactions ISO PGM1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Pgm1 Rat doxorubicin increases expression ISO PGM1 (Homo sapiens) 6480464 Doxorubicin results in increased expression of PGM1 mRNA CTD PMID:29803840 Pgm1 Rat entinostat increases expression ISO PGM1 (Homo sapiens) 6480464 entinostat results in increased expression of PGM1 mRNA CTD PMID:26272509 Pgm1 Rat entinostat multiple interactions ISO PGM1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PGM1 mRNA CTD PMID:27188386 Pgm1 Rat ethanol affects splicing ISO Pgm1 (Mus musculus) 6480464 Ethanol affects the splicing of PGM1 mRNA CTD PMID:30319688 Pgm1 Rat ethyl methanesulfonate decreases expression ISO PGM1 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in decreased expression of PGM1 mRNA CTD PMID:23649840 Pgm1 Rat fenofibrate increases expression ISO PGM1 (Homo sapiens) 6480464 Fenofibrate results in increased expression of PGM1 mRNA CTD PMID:24752549 Pgm1 Rat folic acid decreases expression ISO Pgm1 (Mus musculus) 6480464 Folic Acid results in decreased expression of PGM1 mRNA CTD PMID:25629700 Pgm1 Rat fonofos increases methylation ISO PGM1 (Homo sapiens) 6480464 Fonofos results in increased methylation of PGM1 promoter CTD PMID:22847954 Pgm1 Rat formaldehyde decreases expression ISO PGM1 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of PGM1 mRNA CTD PMID:23649840 Pgm1 Rat FR900359 increases phosphorylation ISO PGM1 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of PGM1 protein CTD PMID:37730182 Pgm1 Rat furfural multiple interactions ISO PGM1 (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Pgm1 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of PGM1 protein CTD PMID:22061828 Pgm1 Rat hydralazine multiple interactions ISO PGM1 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of PGM1 mRNA CTD PMID:17183730 Pgm1 Rat inulin multiple interactions ISO Pgm1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of PGM1 mRNA CTD PMID:36331819 Pgm1 Rat isotretinoin decreases expression ISO PGM1 (Homo sapiens) 6480464 Isotretinoin results in decreased expression of PGM1 mRNA CTD PMID:20436886 Pgm1 Rat ivermectin decreases expression ISO PGM1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of PGM1 protein CTD PMID:32959892 Pgm1 Rat L-ascorbic acid decreases expression ISO PGM1 (Homo sapiens) 6480464 Ascorbic Acid results in decreased expression of PGM1 mRNA and Ascorbic Acid results in decreased expression of PGM1 protein CTD PMID:38160894 Pgm1 Rat L-ascorbic acid multiple interactions ISO PGM1 (Homo sapiens) 6480464 [Ascorbic Acid co-treated with Arsenic Trioxide] results in decreased expression of PGM1 protein more ... CTD PMID:38160894 Pgm1 Rat lactucin affects binding ISO PGM1 (Homo sapiens) 6480464 lactucin binds to PGM1 protein CTD PMID:36364182 Pgm1 Rat lead(0) affects expression ISO PGM1 (Homo sapiens) 6480464 Lead affects the expression of PGM1 mRNA CTD PMID:28903495 Pgm1 Rat linalool increases expression ISO PGM1 (Homo sapiens) 6480464 linalool results in increased expression of PGM1 mRNA CTD PMID:24752549 Pgm1 Rat methidathion decreases expression ISO Pgm1 (Mus musculus) 6480464 methidathion results in decreased expression of PGM1 mRNA CTD PMID:34813904 Pgm1 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of PGM1 gene CTD PMID:35440735 Pgm1 Rat methyl methanesulfonate decreases expression ISO PGM1 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of PGM1 mRNA CTD PMID:23649840 Pgm1 Rat methylmercury chloride decreases expression ISO PGM1 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of PGM1 mRNA CTD PMID:23179753 and PMID:27188386 Pgm1 Rat N-nitrosodiethylamine increases expression ISO Pgm1 (Mus musculus) 6480464 Diethylnitrosamine results in increased expression of PGM1 mRNA CTD PMID:24535843 Pgm1 Rat N-nitrosomorpholine affects expression EXP 6480464 N-nitrosomorpholine affects the expression of PGM1 protein CTD PMID:19716841 Pgm1 Rat nickel dichloride affects expression EXP 6480464 nickel chloride affects the expression of PGM1 mRNA CTD PMID:22110744 Pgm1 Rat nickel sulfate decreases expression ISO PGM1 (Homo sapiens) 6480464 nickel sulfate results in decreased expression of PGM1 mRNA CTD PMID:22714537 Pgm1 Rat obeticholic acid decreases expression ISO PGM1 (Homo sapiens) 6480464 obeticholic acid results in decreased expression of PGM1 mRNA CTD PMID:27939613 Pgm1 Rat ozone multiple interactions ISO Pgm1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of Ozone] which results in increased expression of PGM1 mRNA CTD PMID:34911549 Pgm1 Rat panobinostat multiple interactions ISO PGM1 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PGM1 mRNA CTD PMID:27188386 Pgm1 Rat panobinostat increases expression ISO PGM1 (Homo sapiens) 6480464 panobinostat results in increased expression of PGM1 mRNA CTD PMID:26272509 Pgm1 Rat paracetamol affects expression ISO Pgm1 (Mus musculus) 6480464 Acetaminophen affects the expression of PGM1 mRNA CTD PMID:17562736 Pgm1 Rat paracetamol decreases expression ISO PGM1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of PGM1 mRNA CTD PMID:21420995 Pgm1 Rat parathion increases methylation ISO PGM1 (Homo sapiens) 6480464 Parathion results in increased methylation of PGM1 promoter CTD PMID:22847954 Pgm1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Pgm1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PGM1 mRNA and [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of PGM1 mRNA CTD PMID:36331819 Pgm1 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of PGM1 mRNA CTD PMID:35163327 Pgm1 Rat perfluorooctanoic acid increases expression ISO Pgm1 (Mus musculus) 6480464 perfluorooctanoic acid results in increased expression of PGM1 protein CTD PMID:37422089 Pgm1 Rat phenobarbital decreases expression ISO PGM1 (Homo sapiens) 6480464 Phenobarbital results in decreased expression of PGM1 protein CTD PMID:35881160 Pgm1 Rat phenobarbital affects expression ISO Pgm1 (Mus musculus) 6480464 Phenobarbital affects the expression of PGM1 protein CTD PMID:35881160 Pgm1 Rat picoxystrobin increases expression ISO PGM1 (Homo sapiens) 6480464 picoxystrobin results in increased expression of PGM1 mRNA CTD PMID:33512557 Pgm1 Rat propiconazole increases expression ISO Pgm1 (Mus musculus) 6480464 propiconazole results in increased expression of PGM1 mRNA CTD PMID:21278054 Pgm1 Rat Propiverine affects binding EXP 6480464 propiverine binds to PGM1 protein CTD PMID:29273565 Pgm1 Rat prostaglandin A1 increases metabolic processing ISO Pgm1 (Mus musculus) 6480464 prostaglandin A1 analog results in increased metabolism of PGM1 protein CTD PMID:19800325 Pgm1 Rat quercetin decreases expression ISO PGM1 (Homo sapiens) 6480464 Quercetin results in decreased expression of PGM1 mRNA CTD PMID:21632981 Pgm1 Rat rac-lactic acid decreases expression ISO PGM1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of PGM1 mRNA CTD PMID:30851411 Pgm1 Rat rotenone increases expression ISO PGM1 (Homo sapiens) 6480464 Rotenone results in increased expression of PGM1 mRNA CTD PMID:29955902 and PMID:33512557 Pgm1 Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of PGM1 protein CTD PMID:35544339 Pgm1 Rat SB 431542 multiple interactions ISO PGM1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Pgm1 Rat sodium arsenite increases expression ISO PGM1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of PGM1 mRNA CTD PMID:23648393 and PMID:28713220 Pgm1 Rat sodium arsenite decreases expression ISO PGM1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of PGM1 mRNA CTD PMID:38568856 Pgm1 Rat sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of PGM1 protein CTD PMID:29459688 Pgm1 Rat sodium chloride multiple interactions ISO PGM1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of PGM1 protein CTD PMID:38598786 Pgm1 Rat tamoxifen increases expression ISO Pgm1 (Mus musculus) 6480464 Tamoxifen results in increased expression of PGM1 mRNA CTD PMID:25123088 Pgm1 Rat terbufos increases methylation ISO PGM1 (Homo sapiens) 6480464 terbufos results in increased methylation of PGM1 promoter CTD PMID:22847954 Pgm1 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of PGM1 mRNA CTD PMID:31150632 Pgm1 Rat tetrachloromethane decreases expression ISO Pgm1 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of PGM1 mRNA CTD PMID:31919559 Pgm1 Rat thimerosal decreases expression ISO PGM1 (Homo sapiens) 6480464 Thimerosal results in decreased expression of PGM1 mRNA CTD PMID:27188386 Pgm1 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of PGM1 mRNA CTD PMID:34492290 Pgm1 Rat thiram decreases expression ISO PGM1 (Homo sapiens) 6480464 Thiram results in decreased expression of PGM1 mRNA CTD PMID:38568856 Pgm1 Rat titanium dioxide decreases expression ISO Pgm1 (Mus musculus) 6480464 titanium dioxide results in decreased expression of PGM1 mRNA CTD PMID:29264374 Pgm1 Rat titanium dioxide increases methylation ISO Pgm1 (Mus musculus) 6480464 titanium dioxide results in increased methylation of PGM1 gene CTD PMID:35295148 Pgm1 Rat titanium dioxide decreases methylation ISO Pgm1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of PGM1 gene CTD PMID:35295148 Pgm1 Rat titanium dioxide multiple interactions ISO Pgm1 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of PGM1 mRNA CTD PMID:29950665 Pgm1 Rat tolcapone increases expression EXP 6480464 tolcapone results in increased expression of PGM1 mRNA CTD PMID:24136188 Pgm1 Rat trichostatin A increases expression ISO PGM1 (Homo sapiens) 6480464 trichostatin A results in increased expression of PGM1 mRNA CTD PMID:24935251 and PMID:26272509 Pgm1 Rat trichostatin A multiple interactions ISO PGM1 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PGM1 mRNA CTD PMID:27188386 Pgm1 Rat triclosan decreases expression ISO PGM1 (Homo sapiens) 6480464 Triclosan results in decreased expression of PGM1 mRNA CTD PMID:30510588 Pgm1 Rat triphenyl phosphate affects expression ISO PGM1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of PGM1 mRNA CTD PMID:37042841 Pgm1 Rat trovafloxacin decreases expression EXP 6480464 trovafloxacin results in decreased expression of PGM1 mRNA CTD PMID:24136188 Pgm1 Rat urethane decreases expression ISO PGM1 (Homo sapiens) 6480464 Urethane results in decreased expression of PGM1 mRNA CTD PMID:28818685 Pgm1 Rat valproic acid multiple interactions ISO PGM1 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of PGM1 mRNA more ... CTD PMID:17183730 and PMID:27188386 Pgm1 Rat valproic acid increases expression ISO PGM1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of PGM1 mRNA CTD PMID:23179753 more ... Pgm1 Rat valproic acid affects expression ISO PGM1 (Homo sapiens) 6480464 Valproic Acid affects the expression of PGM1 mRNA CTD PMID:25979313 Pgm1 Rat vancomycin decreases expression ISO Pgm1 (Mus musculus) 6480464 Vancomycin results in decreased expression of PGM1 mRNA CTD PMID:18930951 Pgm1 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of PGM1 mRNA CTD PMID:20566332 Pgm1 Rat vincristine decreases expression ISO PGM1 (Homo sapiens) 6480464 Vincristine results in decreased expression of PGM1 mRNA CTD PMID:23649840 Pgm1 Rat zinc dichloride multiple interactions ISO PGM1 (Homo sapiens) 6480464 zinc chloride inhibits the reaction [cobaltous chloride results in increased expression of PGM1 mRNA] CTD PMID:22202117
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(-)-demecolcine (ISO) (1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 1H-pyrazole (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,6-dimethoxyphenol (ISO) 2-hydroxypropanoic acid (ISO) 2-methoxyethanol (EXP) 4,4'-sulfonyldiphenol (EXP,ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (EXP,ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-naphthoflavone (ISO) alpha-Zearalanol (EXP) ammonium chloride (EXP) arsenous acid (ISO) atrazine (EXP) Azoxymethane (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (EXP,ISO) Brodifacoum (EXP) cadmium dichloride (EXP,ISO) caffeine (ISO) capsaicin (EXP,ISO) carbon nanotube (ISO) CGP 52608 (ISO) chloropicrin (ISO) clofibric acid (EXP) cobalt dichloride (EXP,ISO) coumarin (ISO) cyclosporin A (ISO) deguelin (ISO) dexamethasone (ISO) dextran sulfate (ISO) diarsenic trioxide (ISO) dibutyl phthalate (EXP) dinophysistoxin 1 (ISO) dioxygen (ISO) dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate (ISO) disodium selenite (ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) entinostat (ISO) ethanol (ISO) ethyl methanesulfonate (ISO) fenofibrate (ISO) folic acid (ISO) fonofos (ISO) formaldehyde (ISO) FR900359 (ISO) furfural (ISO) gentamycin (EXP) hydralazine (ISO) inulin (ISO) isotretinoin (ISO) ivermectin (ISO) L-ascorbic acid (ISO) lactucin (ISO) lead(0) (ISO) linalool (ISO) methidathion (ISO) methoxychlor (EXP) methyl methanesulfonate (ISO) methylmercury chloride (ISO) N-nitrosodiethylamine (ISO) N-nitrosomorpholine (EXP) nickel dichloride (EXP) nickel sulfate (ISO) obeticholic acid (ISO) ozone (ISO) panobinostat (ISO) paracetamol (ISO) parathion (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP,ISO) phenobarbital (ISO) picoxystrobin (ISO) propiconazole (ISO) Propiverine (EXP) prostaglandin A1 (ISO) quercetin (ISO) rac-lactic acid (ISO) rotenone (EXP,ISO) SB 431542 (ISO) sodium arsenite (EXP,ISO) sodium chloride (ISO) tamoxifen (ISO) terbufos (ISO) tetrachloromethane (EXP,ISO) thimerosal (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) tolcapone (EXP) trichostatin A (ISO) triclosan (ISO) triphenyl phosphate (ISO) trovafloxacin (EXP) urethane (ISO) valproic acid (ISO) vancomycin (ISO) vinclozolin (EXP) vincristine (ISO) zinc dichloride (ISO)
1.
Impaired binding of ZASP/Cypher with phosphoglucomutase 1 is associated with dilated cardiomyopathy.
Arimura T, etal., Cardiovasc Res. 2009 Jul 1;83(1):80-8. doi: 10.1093/cvr/cvp119. Epub 2009 Apr 17.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
4.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
5.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
6.
Gene loss in human teratomas.
Linder D, Proc Natl Acad Sci U S A. 1969 Jul;63(3):699-704.
7.
Isoenzymes of hexokinase, 6-phosphogluconate dehydrogenase, phosphoglucomutase and lactate dehydrogenase in uterine cancer.
Marshall MJ, etal., Br J Cancer. 1979 Sep;40(3):380-90.
8.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
9.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
10.
Long-term alcohol intake enhances ADP-ribosylation of the multifunctional enzyme, phosphoglucomutase, in rat liver.
Nomura F, etal., Hepatology 1996 Nov;24(5):1246-9.
11.
Isolation and immunohistochemical localization of a chondroitin sulfate proteoglycan from adult rat brain.
Normand G, etal., J Neurochem. 1988 Sep;51(3):665-76.
12.
Differentiation of chromaffin cells elicited by ELF MF modifies gene expression pattern.
Olivares-Banuelos T, etal., Cell Biol Int. 2004;28(4):273-9.
13.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
14.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
15.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
16.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
17.
GOA pipeline
RGD automated data pipeline
18.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
19.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
20.
Comprehensive gene review and curation
RGD comprehensive gene curation
21.
Isolation and expression of a rat liver cDNA encoding phosphoglucomutase.
Rivera AA, etal., Gene 1993 Nov 15;133(2):261-6.
22.
A phylogenetic approach to the identification of phosphoglucomutase genes.
Whitehouse DB, etal., Mol Biol Evol. 1998 Apr;15(4):456-62.
Pgm1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 119,710,734 - 119,770,159 (+) NCBI GRCr8 mRatBN7.2 5 114,595,298 - 114,654,728 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 114,595,293 - 114,654,728 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 117,151,682 - 117,211,109 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 118,877,005 - 118,936,428 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 118,939,539 - 118,998,971 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 118,743,632 - 118,803,055 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 118,743,632 - 118,803,055 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 122,648,579 - 122,708,212 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 120,595,650 - 120,655,915 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 5 113,142,712 - 113,202,105 (+) NCBI Celera RH 3.4 Map 5 RGD Cytogenetic Map 5 q33 NCBI
PGM1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 63,593,411 - 63,660,245 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 63,593,411 - 63,660,245 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 64,059,082 - 64,125,916 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 63,831,535 - 63,898,504 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 63,770,967 - 63,837,935 NCBI Celera 1 62,348,856 - 62,415,793 (+) NCBI Celera Cytogenetic Map 1 p31.3 NCBI HuRef 1 62,166,918 - 62,233,884 (+) NCBI HuRef CHM1_1 1 64,174,737 - 64,241,622 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 63,469,205 - 63,536,042 (+) NCBI T2T-CHM13v2.0
Pgm1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 99,786,648 - 99,844,491 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 99,786,611 - 99,844,491 (+) Ensembl GRCm39 Ensembl GRCm38 4 99,929,451 - 99,987,294 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 99,929,414 - 99,987,294 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 99,602,056 - 99,659,899 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 99,427,439 - 99,485,223 (+) NCBI MGSCv36 mm8 Celera 4 98,273,961 - 98,332,209 (+) NCBI Celera Cytogenetic Map 4 C6 NCBI cM Map 4 45.71 NCBI
Pgm1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955423 26,408,595 - 26,437,527 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955423 26,408,775 - 26,437,527 (-) NCBI ChiLan1.0 ChiLan1.0
PGM1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 163,193,482 - 163,262,694 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 162,344,100 - 162,411,352 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 62,849,451 - 62,916,359 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 64,658,599 - 64,725,496 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 64,658,599 - 64,725,496 (+) Ensembl panpan1.1 panPan2
PGM1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 46,444,433 - 46,577,621 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 46,515,295 - 46,577,622 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 46,505,433 - 46,638,431 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 46,624,512 - 46,757,954 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 46,672,266 - 46,757,997 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 46,586,542 - 46,719,720 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 46,532,568 - 46,666,112 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 46,790,338 - 46,923,562 (-) NCBI UU_Cfam_GSD_1.0
Pgm1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 76,845,424 - 76,905,846 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936692 1,160,623 - 1,221,746 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936692 1,160,836 - 1,221,270 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PGM1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 148,851,183 - 148,994,952 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 148,851,183 - 148,918,891 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 137,171,270 - 137,233,581 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PGM1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 69,391,487 - 69,495,156 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 69,428,996 - 69,466,191 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 47,968,869 - 48,035,370 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Pgm1
.
Predicted Target Of
Count of predictions: 72 Count of miRNA genes: 69 Interacting mature miRNAs: 69 Transcripts: ENSRNOT00000013785 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1331796 Thshl2 Thyroid stimulating hormone level QTL 2 2.3 blood thyroid-stimulating hormone amount (VT:0005119) serum thyroid stimulating hormone level (CMO:0001248) 5 97059760 147465714 Rat 7794743 Bp373 Blood pressure QTL 373 0.0058 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 112175546 116047089 Rat 1549845 Scl44 Serum cholesterol level QTL 44 6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 40128307 148607290 Rat 8552960 Pigfal15 Plasma insulin-like growth factor 1 level QTL 15 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 111416838 156416838 Rat 70212 Niddm25 Non-insulin dependent diabetes mellitus QTL 25 3.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 1 131345958 Rat 1298070 Scl18 Serum cholesterol level QTL 18 3.7 blood LDL cholesterol amount (VT:0000181) calculated plasma low density lipoprotein cholesterol level (CMO:0001245) 5 79584860 124584860 Rat 61452 Ciaa5 CIA Autoantibody QTL 5 3.5 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 5 94858972 143070159 Rat 1331801 Rf33 Renal function QTL 33 4.149 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 5 43726656 129132602 Rat 7411582 Foco3 Food consumption QTL 3 7.5 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 5 87468046 132468046 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 1598859 Cm66 Cardiac mass QTL 66 2 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 79584860 124584860 Rat 7207486 Bss109 Bone structure and strength QTL 109 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 5 106906205 151906205 Rat 7207481 Bss106 Bone structure and strength QTL 106 7.9 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 106906205 151906205 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 1549838 Bss4 Bone structure and strength QTL 4 9.2 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 5 106906205 151906205 Rat 2317753 Glom24 Glomerulus QTL 24 3.1 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 5 97570330 136479578 Rat 1582212 Livw2 Liver weight QTL 2 3.5 0.0004 liver mass (VT:0003402) liver weight to body weight ratio (CMO:0000633) 5 99016066 119085810 Rat 7411564 Bw135 Body weight QTL 135 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 87468046 132468046 Rat 8657050 Bw146 Body weight QTL 146 19.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 108938288 153938288 Rat 1576312 Emca8 Estrogen-induced mammary cancer QTL 8 4.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 50328551 141643988 Rat 7411601 Foco12 Food consumption QTL 12 19.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 5 87468046 132468046 Rat 1641912 Alcrsp18 Alcohol response QTL 18 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 5 35189153 141643988 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 2317056 Wbc3 White blood cell count QTL 3 2.51 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 5 105999803 150999803 Rat 1598846 Bp293 Blood pressure QTL 293 3.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 79584860 124584860 Rat 1598847 Cm62 Cardiac mass QTL 62 3.4 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 108845856 153845856 Rat 1358909 Kidm25 Kidney mass QTL 25 1.87 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 5 90067849 128034027 Rat 1578673 Bmd13 Bone mineral density QTL 13 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 5 103689353 148689353 Rat 70189 Mcs5 Mammary carcinoma susceptibility QTL 5 10.51 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 55805606 132207589 Rat 7207488 Bss110 Bone structure and strength QTL 1 8.4 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 5 106906205 151906205 Rat 8694441 Bw169 Body weight QTL 169 17.61 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 5 111416838 156416838 Rat 631527 Tls1 T-lymphoma susceptibility QTL 1 0 0.001 thymus integrity trait (VT:0010555) post-insult time to onset of T-cell lymphoma (CMO:0001907) 5 90450144 135450144 Rat 7207491 Bss112 Bone structure and strength QTL 112 7 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 5 106906205 151906205 Rat 8694389 Bw160 Body weight QTL 160 6.17 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 5 111416838 156416838 Rat 2290448 Scl54 Serum cholesterol level QTL 54 2.93 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 31663789 131345958 Rat 61426 Scl2 Serum cholesterol level QTL 2 7.3 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 59793399 143070159 Rat 1354598 Srn6 Serum renin concentration QTL 6 3.8 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 5 69540295 151018848 Rat 8694198 Abfw3 Abdominal fat weight QTL 3 16.13 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 5 111416838 156416838 Rat 1298086 Bp156 Blood pressure QTL 156 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 84132602 129132602 Rat 2306971 Anxrr21 Anxiety related response QTL 21 9.47 fear/anxiety-related behavior trait (VT:1000241) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 5 66174080 124160948 Rat 1298089 Scl14 Serum cholesterol level QTL 14 5.8 0.0004 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 108845856 153845856 Rat 1358895 Bp254 Blood pressure QTL 254 3.6 0.0003 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 5 58829236 128034027 Rat 6903316 Bw113 Body weight QTL 113 2 0.0103 body mass (VT:0001259) body weight (CMO:0000012) 5 87765973 132765973 Rat 1358889 Bp261 Blood pressure QTL 261 2.86 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 5 90067849 128034027 Rat 1358187 Emca1 Estrogen-induced mammary cancer QTL 1 4.4 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 5 99216724 148607142 Rat
D5Rhm1
No map positions available.
D5Rhm2
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 5 119,774,989 - 119,775,157 (+) Marker Load Pipeline mRatBN7.2 5 114,659,557 - 114,659,726 (+) MAPPER mRatBN7.2 Rnor_6.0 5 118,807,885 - 118,808,053 NCBI Rnor6.0 Rnor_5.0 5 122,713,042 - 122,713,210 UniSTS Rnor5.0 RGSC_v3.4 5 120,660,745 - 120,660,913 UniSTS RGSC3.4 Celera 5 113,206,935 - 113,207,103 UniSTS Cytogenetic Map 5 q33 UniSTS
BF386789
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 114,594,795 - 114,594,990 (+) MAPPER mRatBN7.2 Rnor_6.0 5 118,743,130 - 118,743,324 NCBI Rnor6.0 Rnor_5.0 5 122,648,077 - 122,648,271 UniSTS Rnor5.0 RGSC_v3.4 5 120,595,148 - 120,595,342 UniSTS RGSC3.4 Celera 5 113,142,210 - 113,142,404 UniSTS RH 3.4 Map 5 791.3 UniSTS Cytogenetic Map 5 q33 UniSTS
RH142295
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 5 119,742,627 - 119,743,215 (+) Marker Load Pipeline mRatBN7.2 5 114,627,194 - 114,627,782 (+) MAPPER mRatBN7.2 Rnor_6.0 5 118,775,524 - 118,776,111 NCBI Rnor6.0 Rnor_5.0 5 122,680,510 - 122,681,097 UniSTS Rnor5.0 RGSC_v3.4 5 120,628,325 - 120,628,912 UniSTS RGSC3.4 Celera 5 113,174,572 - 113,175,159 UniSTS RH 3.4 Map 5 791.3 UniSTS Cytogenetic Map 5 q33 UniSTS
RH141738
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 114,654,451 - 114,654,660 (+) MAPPER mRatBN7.2 Rnor_6.0 5 118,802,779 - 118,802,987 NCBI Rnor6.0 Rnor_5.0 5 122,707,936 - 122,708,144 UniSTS Rnor5.0 RGSC_v3.4 5 120,655,639 - 120,655,847 UniSTS RGSC3.4 Celera 5 113,201,829 - 113,202,037 UniSTS RH 3.4 Map 5 793.1 UniSTS Cytogenetic Map 5 q33 UniSTS
ha2531
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 136,958,572 - 136,959,506 (+) MAPPER mRatBN7.2 mRatBN7.2 5 114,606,869 - 114,607,662 (+) MAPPER mRatBN7.2 Rnor_6.0 5 118,755,205 - 118,755,997 NCBI Rnor6.0 Rnor_6.0 2 142,094,995 - 142,095,928 NCBI Rnor6.0 Rnor_5.0 5 122,660,152 - 122,660,944 UniSTS Rnor5.0 Rnor_5.0 2 161,781,593 - 161,782,526 UniSTS Rnor5.0 RGSC_v3.4 2 141,796,704 - 141,797,637 UniSTS RGSC3.4 RGSC_v3.4 5 120,607,223 - 120,608,015 UniSTS RGSC3.4 Celera 5 113,154,160 - 113,154,952 UniSTS Celera 2 131,456,163 - 131,457,096 UniSTS Cytogenetic Map 5 q33 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000013785 ⟹ ENSRNOP00000013785
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 114,595,293 - 114,654,727 (+) Ensembl Rnor_6.0 Ensembl 5 118,743,632 - 118,803,055 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000103908 ⟹ ENSRNOP00000097832
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 114,619,959 - 114,654,728 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000118798 ⟹ ENSRNOP00000081014
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 114,621,360 - 114,654,728 (+) Ensembl
RefSeq Acc Id:
NM_017033 ⟹ NP_058729
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 119,710,734 - 119,770,159 (+) NCBI mRatBN7.2 5 114,595,298 - 114,654,728 (+) NCBI Rnor_6.0 5 118,743,632 - 118,803,055 (+) NCBI Rnor_5.0 5 122,648,579 - 122,708,212 (+) NCBI RGSC_v3.4 5 120,595,650 - 120,655,915 (+) RGD Celera 5 113,142,712 - 113,202,105 (+) RGD
Sequence:
CCTGAGCCCTCTGCAGCAGCCAGAGCCGCAGCTTCTGTCGCCCCGCAGCCCGTCGCCACCATGGTGAAGATCGTGACAGTGAAGACGCAGGCATATCCGGATCAGAAGCCGGGCACCAGCGGGTTGCG
hide sequence
RefSeq Acc Id:
XM_006238442 ⟹ XP_006238504
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 119,736,187 - 119,770,159 (+) NCBI mRatBN7.2 5 114,620,858 - 114,654,728 (+) NCBI Rnor_6.0 5 118,769,155 - 118,803,055 (+) NCBI Rnor_5.0 5 122,648,579 - 122,708,212 (+) NCBI
Sequence:
GCTTGACCTTTTATTTGCTCAGTGGCTCCAAGCAACTTTAGCTGCAGACAGCCCAGCGGCTCCA
hide sequence
RefSeq Acc Id:
NP_058729 ⟸ NM_017033
- UniProtKB:
P38652 (UniProtKB/Swiss-Prot), Q499Q4 (UniProtKB/TrEMBL), A6JRM5 (UniProtKB/TrEMBL), F7F2L9 (UniProtKB/TrEMBL)
- Sequence:
MVKIVTVKTQAYPDQKPGTSGLRKRVKVFQGNANYAENFIQSIVSTVEPALRQEATLVVGGDGRFYMTEAIQLIVRIAAANGIGRLVIGQNGILSTPAVSCIIRKIKAIGGIILTASHNPGGPNGDFG
hide sequence
RefSeq Acc Id:
XP_006238504 ⟸ XM_006238442
- Peptide Label:
isoform X1
- Sequence:
MSDFEEWISGTYRRTEEGPLPLLTFATVPYHDQKPGTSGLRKNTYYFEEKPCYLENFIQSIFFS
hide sequence
Ensembl Acc Id:
ENSRNOP00000013785 ⟸ ENSRNOT00000013785
Ensembl Acc Id:
ENSRNOP00000097832 ⟸ ENSRNOT00000103908
Ensembl Acc Id:
ENSRNOP00000081014 ⟸ ENSRNOT00000118798
RGD ID: 13693856 Promoter ID: EPDNEW_R4381 Type: initiation region Name: Pgm1_1 Description: phosphoglucomutase 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 118,743,600 - 118,743,660 EPDNEW
BioCyc Gene G2FUF-40563 BioCyc
BioCyc Pathway PWY-5941 [glycogen degradation II] BioCyc
PWY-7343 [UDP-alpha-D-glucose biosynthesis] BioCyc
BioCyc Pathway Image PWY-5941 BioCyc
PWY-7343 BioCyc
Ensembl Genes ENSRNOG00000009889 Ensembl, ENTREZGENE
Ensembl Transcript ENSRNOT00000013785 ENTREZGENE
ENSRNOT00000103908 ENTREZGENE
Gene3D-CATH Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 UniProtKB/Swiss-Prot
Alpha-D-phosphohexomutase, C-terminal domain UniProtKB/Swiss-Prot
IMAGE_CLONE IMAGE:7937943 IMAGE-MGC_LOAD
IMAGE:8367784 IMAGE-MGC_LOAD
InterPro A-D-PHexomutase_a/b/a-I UniProtKB/Swiss-Prot
A-D-PHexomutase_a/b/a-I/II/III UniProtKB/Swiss-Prot
A-D-PHexomutase_a/b/a-II UniProtKB/Swiss-Prot
A-D-PHexomutase_a/b/a-III UniProtKB/Swiss-Prot
A-D-PHexomutase_C_sf UniProtKB/Swiss-Prot
A-D-PHexomutase_CS UniProtKB/Swiss-Prot
Alpha-D-phosphohexomutase_SF UniProtKB/Swiss-Prot
PGM UniProtKB/Swiss-Prot
MGC_CLONE MGC:124624 IMAGE-MGC_LOAD
MGC:156500 IMAGE-MGC_LOAD
NCBI Gene 24645 ENTREZGENE
PANTHER PHOSPHOGLUCOMUTASE-1 UniProtKB/Swiss-Prot
PTHR22573 UniProtKB/Swiss-Prot
Pfam PGM_PMM_I UniProtKB/Swiss-Prot
PGM_PMM_II UniProtKB/Swiss-Prot
PGM_PMM_III UniProtKB/Swiss-Prot
PhenoGen Pgm1 PhenoGen
PRINTS PGMPMM UniProtKB/Swiss-Prot
PROSITE PGM_PMM UniProtKB/Swiss-Prot
RatGTEx ENSRNOG00000009889 RatGTEx
Superfamily-SCOP SSF53738 UniProtKB/Swiss-Prot
SSF55957 UniProtKB/Swiss-Prot
UniProt A0A8I5ZRI9 ENTREZGENE, UniProtKB/TrEMBL
A0A8I6AV00 ENTREZGENE, UniProtKB/TrEMBL
A1A5L2_RAT UniProtKB/TrEMBL
A6JRM5 ENTREZGENE, UniProtKB/TrEMBL
F7F2L9 ENTREZGENE, UniProtKB/TrEMBL
P38652 ENTREZGENE, UniProtKB/Swiss-Prot
Q499Q4 ENTREZGENE
Q62752_RAT UniProtKB/TrEMBL
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-06-10
Pgm1
Phosphoglucomutase 1
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_protein
58 kDa
724639
gene_regulation
substrate for Ca2+/calmodulindependent protein kinase; ADP-ribosylation increased in liver by long-term alcohol intake
724639
