Symbol:
Pfkl
Name:
phosphofructokinase, liver type
RGD ID:
3311
Description:
Enables several functions, including 6-phosphofructokinase activity; anion binding activity; and identical protein binding activity. Involved in fructose 1,6-bisphosphate metabolic process; fructose 6-phosphate metabolic process; and glycolytic process. Predicted to be located in cytosol. Predicted to be part of 6-phosphofructokinase complex. Predicted to be active in membrane. Orthologous to human PFKL (phosphofructokinase, liver type); PARTICIPATES IN glycolysis pathway; glycolysis/gluconeogenesis pathway; fructose and mannose metabolic pathway; INTERACTS WITH (-)-epigallocatechin 3-gallate; 17beta-estradiol; 2,2',4,4'-Tetrabromodiphenyl ether.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
6-phosphofructokinase type B; 6-phosphofructokinase, liver type; ATP-dependent 6-phosphofructokinase, liver type; ATP-PFK; PFK-B; PFK-L; phosphofructo-1-kinase isozyme B; phosphofructokinase 1; phosphofructokinase, liver; phosphofructokinase, liver, B-type; phosphohexokinase
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PFKL (phosphofructokinase, liver type) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Pfkl (phosphofructokinase, liver, B-type) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Pfkl (phosphofructokinase, liver type) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PFKL (phosphofructokinase, liver type) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PFKL (phosphofructokinase, liver type) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Pfkl (phosphofructokinase, liver type) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PFKL (phosphofructokinase, liver type) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PFKL (phosphofructokinase, liver type) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Pfkl (phosphofructokinase, liver type) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
PFKL (phosphofructokinase, liver type)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Pfkl (phosphofructokinase, liver, B-type)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
pfklb (phosphofructokinase, liver b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
pfkla (phosphofructokinase, liver a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
PFK1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Pfk
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
pfk-1.1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
pfk-1.2
Alliance
DIOPT (OrthoFinder|PANTHER|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):
PFK2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 10,663,907 - 10,685,967 (+) NCBI GRCr8 mRatBN7.2 20 10,664,285 - 10,686,324 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 10,664,272 - 10,686,315 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 11,363,758 - 11,385,830 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 10,724,657 - 10,746,730 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 11,196,584 - 11,218,579 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 11,393,860 - 11,415,889 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 11,393,877 - 11,415,882 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 13,563,748 - 13,585,941 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 11,009,359 - 11,032,511 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 11,009,585 - 11,032,737 (+) NCBI Celera 20 12,170,125 - 12,192,155 (+) NCBI Celera RH 3.4 Map 20 140.5 RGD Cytogenetic Map 20 p12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pfkl Rat (-)-epigallocatechin 3-gallate increases expression EXP 6480464 epigallocatechin gallate results in increased expression of PFKL mRNA CTD PMID:16988119 Pfkl Rat 1,2-dimethylhydrazine multiple interactions ISO Pfkl (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of PFKL mRNA CTD PMID:22206623 Pfkl Rat 1,4-benzoquinone increases expression ISO PFKL (Homo sapiens) 6480464 quinone results in increased expression of PFKL protein CTD PMID:30448556 Pfkl Rat 1,4-benzoquinone multiple interactions ISO PFKL (Homo sapiens) 6480464 [HIF1A protein co-treated with quinone] results in increased expression of PFKL protein CTD PMID:30448556 Pfkl Rat 1-[4,4-bis(4-fluorophenyl)butyl]-4-[4-chloro-3-(trifluoromethyl)phenyl]-4-piperidinol multiple interactions ISO PFKL (Homo sapiens) 6480464 Penfluridol binds to and results in decreased activity of PFKL protein more ... CTD PMID:35530161 Pfkl Rat 1-[4,4-bis(4-fluorophenyl)butyl]-4-[4-chloro-3-(trifluoromethyl)phenyl]-4-piperidinol increases response to substance ISO PFKL (Homo sapiens) 6480464 PFKL protein results in increased susceptibility to Penfluridol CTD PMID:35530161 Pfkl Rat 1-[4,4-bis(4-fluorophenyl)butyl]-4-[4-chloro-3-(trifluoromethyl)phenyl]-4-piperidinol decreases activity ISO PFKL (Homo sapiens) 6480464 Penfluridol results in decreased activity of PFKL protein CTD PMID:35530161 Pfkl Rat 1-chloro-2,4-dinitrobenzene affects binding ISO PFKL (Homo sapiens) 6480464 Dinitrochlorobenzene binds to PFKL protein CTD PMID:32991956 Pfkl Rat 17beta-estradiol affects expression EXP 6480464 Estradiol affects the expression of PFKL mRNA and Estradiol affects the expression of PFKL protein CTD PMID:32145629 Pfkl Rat 1H-pyrazole decreases expression ISO Pfkl (Mus musculus) 6480464 pyrazole results in decreased expression of PFKL mRNA CTD PMID:17945193 Pfkl Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression EXP 6480464 2 more ... CTD PMID:21394737 Pfkl Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 AHR protein alternative form affects the reaction [Tetrachlorodibenzodioxin results in decreased expression of PFKL mRNA] CTD PMID:21215274 Pfkl Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Pfkl (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of PFKL mRNA CTD PMID:15667827 more ... Pfkl Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Pfkl (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PFKL mRNA CTD PMID:21570461 Pfkl Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO PFKL (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of PFKL mRNA CTD PMID:20106945 and PMID:21632981 Pfkl Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PFKL mRNA CTD PMID:21215274 Pfkl Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of PFKL mRNA CTD PMID:21346803 Pfkl Rat 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3 more ... CTD PMID:23196670 Pfkl Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of PFKL mRNA CTD PMID:36041667 Pfkl Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of PFKL mRNA CTD PMID:24780913 Pfkl Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of PFKL mRNA CTD PMID:28959563 and PMID:31644924 Pfkl Rat acrylamide decreases expression ISO PFKL (Homo sapiens) 6480464 Acrylamide results in decreased expression of PFKL mRNA CTD PMID:32763439 Pfkl Rat aflatoxin B1 decreases expression ISO Pfkl (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of PFKL mRNA CTD PMID:19770486 Pfkl Rat Aflatoxin B2 alpha increases methylation ISO PFKL (Homo sapiens) 6480464 aflatoxin B2 results in increased methylation of PFKL intron CTD PMID:30157460 Pfkl Rat aluminium phosphide decreases activity EXP 6480464 aluminum phosphide results in decreased activity of PFKL protein CTD PMID:20929055 Pfkl Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PFKL mRNA CTD PMID:16483693 Pfkl Rat aristolochic acid A decreases expression ISO PFKL (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of PFKL mRNA CTD PMID:33212167 Pfkl Rat aristolochic acid A decreases expression ISO Pfkl (Mus musculus) 6480464 aristolochic acid I results in decreased expression of PFKL mRNA CTD PMID:31009690 Pfkl Rat arsane multiple interactions ISO Pfkl (Mus musculus) 6480464 [Cadmium co-treated with Arsenic co-treated with Mercury co-treated with Diclofenac co-treated with flumequine] results in increased expression of PFKL mRNA and Sodium Selenite inhibits the reaction [[Cadmium co-treated with Arsenic co-treated with Mercury co-treated with Diclofenac co-treated with flumequine] results in increased expression of PFKL mRNA] CTD PMID:38945390 Pfkl Rat arsane multiple interactions ISO PFKL (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PFKL mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of PFKL mRNA CTD PMID:39836092 Pfkl Rat arsenic atom multiple interactions ISO PFKL (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PFKL mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of PFKL mRNA CTD PMID:39836092 Pfkl Rat arsenic atom multiple interactions ISO Pfkl (Mus musculus) 6480464 [Cadmium co-treated with Arsenic co-treated with Mercury co-treated with Diclofenac co-treated with flumequine] results in increased expression of PFKL mRNA and Sodium Selenite inhibits the reaction [[Cadmium co-treated with Arsenic co-treated with Mercury co-treated with Diclofenac co-treated with flumequine] results in increased expression of PFKL mRNA] CTD PMID:38945390 Pfkl Rat benzo[a]pyrene multiple interactions ISO Pfkl (Mus musculus) 6480464 AHR protein affects the reaction [Benzo(a)pyrene affects the expression of PFKL mRNA] CTD PMID:22228805 Pfkl Rat benzo[a]pyrene decreases expression ISO Pfkl (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of PFKL mRNA CTD PMID:19770486 and PMID:22228805 Pfkl Rat benzo[e]pyrene increases methylation ISO PFKL (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of PFKL intron CTD PMID:30157460 Pfkl Rat beta-naphthoflavone multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of PFKL mRNA CTD PMID:18164116 Pfkl Rat bis(2-chloroethyl) sulfide affects expression EXP 6480464 Mustard Gas affects the expression of PFKL mRNA CTD PMID:15651846 Pfkl Rat bis(2-ethylhexyl) phthalate decreases expression ISO Pfkl (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of PFKL mRNA CTD PMID:34319233 Pfkl Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PFKL mRNA CTD PMID:25181051 Pfkl Rat bisphenol A increases expression ISO PFKL (Homo sapiens) 6480464 bisphenol A results in increased expression of PFKL protein CTD PMID:37567409 Pfkl Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of PFKL mRNA CTD PMID:36041667 Pfkl Rat bisphenol A decreases methylation ISO PFKL (Homo sapiens) 6480464 bisphenol A results in decreased methylation of PFKL gene CTD PMID:31601247 Pfkl Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of PFKL mRNA and bisphenol A affects the expression of PFKL protein CTD PMID:32145629 Pfkl Rat bisphenol A decreases expression ISO Pfkl (Mus musculus) 6480464 bisphenol A results in decreased expression of PFKL mRNA CTD PMID:30245210 Pfkl Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PFKL mRNA CTD PMID:30816183 Pfkl Rat bisphenol A affects expression ISO PFKL (Homo sapiens) 6480464 bisphenol A affects the expression of PFKL mRNA CTD PMID:30903817 Pfkl Rat bisphenol AF increases expression ISO PFKL (Homo sapiens) 6480464 bisphenol AF results in increased expression of PFKL protein CTD PMID:34186270 Pfkl Rat Bisphenol B increases expression ISO PFKL (Homo sapiens) 6480464 bisphenol B results in increased expression of PFKL protein CTD PMID:34186270 Pfkl Rat bisphenol F increases expression ISO PFKL (Homo sapiens) 6480464 bisphenol F results in increased expression of PFKL protein CTD PMID:34186270 Pfkl Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of PFKL mRNA CTD PMID:36041667 Pfkl Rat cadmium atom multiple interactions ISO Pfkl (Mus musculus) 6480464 [Cadmium co-treated with Arsenic co-treated with Mercury co-treated with Diclofenac co-treated with flumequine] results in increased expression of PFKL mRNA and Sodium Selenite inhibits the reaction [[Cadmium co-treated with Arsenic co-treated with Mercury co-treated with Diclofenac co-treated with flumequine] results in increased expression of PFKL mRNA] CTD PMID:38945390 Pfkl Rat cadmium atom multiple interactions ISO PFKL (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PFKL mRNA CTD PMID:35301059 Pfkl Rat cadmium dichloride multiple interactions ISO PFKL (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PFKL mRNA CTD PMID:35301059 Pfkl Rat captan increases expression ISO Pfkl (Mus musculus) 6480464 Captan results in increased expression of PFKL mRNA CTD PMID:31558096 Pfkl Rat carbon nanotube increases expression ISO Pfkl (Mus musculus) 6480464 Nanotubes and Carbon analog results in increased expression of PFKL mRNA CTD PMID:25554681 Pfkl Rat chlordecone increases expression ISO Pfkl (Mus musculus) 6480464 Chlordecone results in increased expression of PFKL mRNA CTD PMID:33711761 Pfkl Rat chlorpyrifos increases expression ISO Pfkl (Mus musculus) 6480464 Chlorpyrifos results in increased expression of PFKL mRNA CTD PMID:37019170 Pfkl Rat cisplatin multiple interactions ISO PFKL (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of PFKL mRNA CTD PMID:27392435 Pfkl Rat clofibrate decreases expression ISO Pfkl (Mus musculus) 6480464 Clofibrate results in decreased expression of PFKL mRNA CTD PMID:17585979 Pfkl Rat cobalt dichloride increases expression EXP 6480464 cobaltous chloride results in increased expression of PFKL mRNA and cobaltous chloride results in increased expression of PFKL protein CTD PMID:24386269 Pfkl Rat cocaine affects expression EXP 6480464 Cocaine affects the expression of PFKL mRNA CTD PMID:20187946 Pfkl Rat copper(II) sulfate decreases expression ISO PFKL (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of PFKL mRNA CTD PMID:19549813 Pfkl Rat corticosterone increases expression EXP 6480464 Corticosterone results in increased expression of PFKL mRNA CTD PMID:15755911 Pfkl Rat coumestrol multiple interactions ISO PFKL (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of PFKL mRNA CTD PMID:19167446 Pfkl Rat cyclosporin A decreases expression ISO PFKL (Homo sapiens) 6480464 Cyclosporine results in decreased expression of PFKL mRNA CTD PMID:20106945 and PMID:21632981 Pfkl Rat deguelin decreases expression ISO PFKL (Homo sapiens) 6480464 deguelin results in decreased expression of PFKL mRNA CTD PMID:33512557 Pfkl Rat dexamethasone decreases expression EXP 6480464 Dexamethasone results in decreased expression of PFKL mRNA CTD PMID:20032058 Pfkl Rat dexamethasone multiple interactions EXP 6480464 Testosterone inhibits the reaction [Dexamethasone results in decreased expression of PFKL mRNA] CTD PMID:20032058 Pfkl Rat diclofenac multiple interactions ISO Pfkl (Mus musculus) 6480464 [Cadmium co-treated with Arsenic co-treated with Mercury co-treated with Diclofenac co-treated with flumequine] results in increased expression of PFKL mRNA and Sodium Selenite inhibits the reaction [[Cadmium co-treated with Arsenic co-treated with Mercury co-treated with Diclofenac co-treated with flumequine] results in increased expression of PFKL mRNA] CTD PMID:38945390 Pfkl Rat Diosbulbin B decreases expression ISO Pfkl (Mus musculus) 6480464 diosbulbin B results in decreased expression of PFKL mRNA CTD PMID:32148032 Pfkl Rat dioxygen increases expression ISO Pfkl (Mus musculus) 6480464 Oxygen deficiency results in increased expression of PFKL mRNA CTD PMID:20880076 Pfkl Rat disodium selenite multiple interactions ISO Pfkl (Mus musculus) 6480464 Sodium Selenite inhibits the reaction [[Cadmium co-treated with Arsenic co-treated with Mercury co-treated with Diclofenac co-treated with flumequine] results in increased expression of PFKL mRNA] CTD PMID:38945390 Pfkl Rat doxorubicin decreases expression ISO PFKL (Homo sapiens) 6480464 Doxorubicin results in decreased expression of PFKL mRNA CTD PMID:29803840 Pfkl Rat elemental selenium increases expression ISO PFKL (Homo sapiens) 6480464 Selenium results in increased expression of PFKL mRNA CTD PMID:19244175 Pfkl Rat Enterolactone multiple interactions ISO PFKL (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of PFKL mRNA CTD PMID:19167446 Pfkl Rat ethanol increases expression ISO Pfkl (Mus musculus) 6480464 Ethanol results in increased expression of PFKL mRNA CTD PMID:19167417 Pfkl Rat ethanol affects splicing ISO Pfkl (Mus musculus) 6480464 Ethanol affects the splicing of PFKL mRNA CTD PMID:30319688 Pfkl Rat ethanol multiple interactions ISO Pfkl (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in increased expression of PFKL mRNA CTD PMID:30517762 Pfkl Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of PFKL protein CTD PMID:19609968 Pfkl Rat flumequine multiple interactions ISO Pfkl (Mus musculus) 6480464 [Cadmium co-treated with Arsenic co-treated with Mercury co-treated with Diclofenac co-treated with flumequine] results in increased expression of PFKL mRNA and Sodium Selenite inhibits the reaction [[Cadmium co-treated with Arsenic co-treated with Mercury co-treated with Diclofenac co-treated with flumequine] results in increased expression of PFKL mRNA] CTD PMID:38945390 Pfkl Rat fluoranthene multiple interactions ISO Pfkl (Mus musculus) 6480464 [1-methylanthracene co-treated with fluoranthene] results in decreased expression of PFKL mRNA CTD PMID:28329830 Pfkl Rat flutamide decreases expression ISO Pfkl (Mus musculus) 6480464 Flutamide analog results in decreased expression of PFKL mRNA CTD PMID:17702527 Pfkl Rat folic acid multiple interactions ISO Pfkl (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of PFKL mRNA CTD PMID:22206623 Pfkl Rat folpet increases expression ISO Pfkl (Mus musculus) 6480464 folpet results in increased expression of PFKL mRNA CTD PMID:31558096 Pfkl Rat fructose increases expression EXP 6480464 Fructose results in increased expression of PFKL mRNA CTD PMID:18346472 Pfkl Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of PFKL mRNA CTD PMID:33387578 Pfkl Rat ivermectin decreases expression ISO Pfkl (Mus musculus) 6480464 Ivermectin results in decreased expression of PFKL mRNA CTD PMID:28942281 Pfkl Rat ivermectin decreases expression ISO PFKL (Homo sapiens) 6480464 Ivermectin results in decreased expression of PFKL protein CTD PMID:32959892 Pfkl Rat lipopolysaccharide multiple interactions EXP 6480464 [Lipopolysaccharides co-treated with Ranitidine] results in increased expression of PFKL mRNA CTD PMID:16415329 Pfkl Rat manganese atom multiple interactions ISO PFKL (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PFKL mRNA CTD PMID:39836092 Pfkl Rat manganese(0) multiple interactions ISO PFKL (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PFKL mRNA CTD PMID:39836092 Pfkl Rat manganese(II) chloride multiple interactions ISO PFKL (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PFKL mRNA CTD PMID:39836092 Pfkl Rat mercury atom multiple interactions ISO Pfkl (Mus musculus) 6480464 [Cadmium co-treated with Arsenic co-treated with Mercury co-treated with Diclofenac co-treated with flumequine] results in increased expression of PFKL mRNA and Sodium Selenite inhibits the reaction [[Cadmium co-treated with Arsenic co-treated with Mercury co-treated with Diclofenac co-treated with flumequine] results in increased expression of PFKL mRNA] CTD PMID:38945390 Pfkl Rat mercury(0) multiple interactions ISO Pfkl (Mus musculus) 6480464 [Cadmium co-treated with Arsenic co-treated with Mercury co-treated with Diclofenac co-treated with flumequine] results in increased expression of PFKL mRNA and Sodium Selenite inhibits the reaction [[Cadmium co-treated with Arsenic co-treated with Mercury co-treated with Diclofenac co-treated with flumequine] results in increased expression of PFKL mRNA] CTD PMID:38945390 Pfkl Rat methapyrilene increases methylation ISO PFKL (Homo sapiens) 6480464 Methapyrilene results in increased methylation of PFKL intron CTD PMID:30157460 Pfkl Rat mono(2-ethylhexyl) phthalate decreases expression ISO PFKL (Homo sapiens) 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of PFKL mRNA CTD PMID:38685446 Pfkl Rat Muraglitazar increases expression EXP 6480464 muraglitazar results in increased expression of PFKL mRNA CTD PMID:21515302 Pfkl Rat N-methyl-4-phenylpyridinium decreases expression ISO Pfkl (Mus musculus) 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of PFKL mRNA CTD PMID:17475336 and PMID:22776087 Pfkl Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of PFKL mRNA CTD PMID:18164116 Pfkl Rat N1'-[2-[[5-[(dimethylamino)methyl]-2-furanyl]methylthio]ethyl]-N1-methyl-2-nitroethene-1,1-diamine multiple interactions EXP 6480464 [Lipopolysaccharides co-treated with Ranitidine] results in increased expression of PFKL mRNA CTD PMID:16415329 Pfkl Rat nickel dichloride increases expression ISO Pfkl (Mus musculus) 6480464 nickel chloride results in increased expression of PFKL mRNA CTD PMID:12426141 more ... Pfkl Rat nickel dichloride multiple interactions ISO Pfkl (Mus musculus) 6480464 HIF1A affects the reaction [nickel chloride results in increased expression of PFKL mRNA] CTD PMID:12426141 and PMID:12729255 Pfkl Rat nickel subsulfide affects expression ISO Pfkl (Mus musculus) 6480464 nickel subsulfide affects the expression of PFKL mRNA CTD PMID:12729255 Pfkl Rat nitrates multiple interactions ISO Pfkl (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of PFKL mRNA CTD PMID:35964746 Pfkl Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of PFKL mRNA CTD PMID:33484710 Pfkl Rat ochratoxin A decreases expression ISO PFKL (Homo sapiens) 6480464 ochratoxin A results in decreased expression of PFKL mRNA CTD PMID:19287073 Pfkl Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of PFKL mRNA CTD PMID:25729387 Pfkl Rat ozone multiple interactions ISO PFKL (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of PFKL mRNA CTD PMID:35430440 Pfkl Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of PFKL mRNA CTD PMID:33387578 Pfkl Rat perfluorooctane-1-sulfonic acid affects expression ISO Pfkl (Mus musculus) 6480464 perfluorooctane sulfonic acid affects the expression of PFKL mRNA CTD PMID:19429403 Pfkl Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Pfkl (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of PFKL mRNA CTD PMID:36331819 Pfkl Rat perfluorooctanoic acid affects expression ISO Pfkl (Mus musculus) 6480464 perfluorooctanoic acid affects the expression of PFKL mRNA CTD PMID:19429403 Pfkl Rat perfluorooctanoic acid increases expression ISO Pfkl (Mus musculus) 6480464 perfluorooctanoic acid results in increased expression of PFKL protein CTD PMID:37422089 Pfkl Rat perfluorooctanoic acid increases activity ISO Pfkl (Mus musculus) 6480464 perfluorooctanoic acid results in increased activity of PFKL protein CTD PMID:28947262 Pfkl Rat phenylephrine increases expression EXP 6480464 Phenylephrine results in increased expression of PFKL mRNA CTD PMID:18158353 Pfkl Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of PFKL mRNA CTD PMID:19162173 Pfkl Rat pirinixic acid increases expression ISO Pfkl (Mus musculus) 6480464 pirinixic acid results in increased expression of PFKL mRNA CTD PMID:17426115 Pfkl Rat propiconazole decreases expression ISO Pfkl (Mus musculus) 6480464 propiconazole results in decreased expression of PFKL mRNA CTD PMID:21278054 Pfkl Rat ranitidine multiple interactions EXP 6480464 [Lipopolysaccharides co-treated with Ranitidine] results in increased expression of PFKL mRNA CTD PMID:16415329 Pfkl Rat rotenone decreases expression ISO Pfkl (Mus musculus) 6480464 Rotenone results in decreased expression of PFKL mRNA CTD PMID:17702527 Pfkl Rat SB 431542 multiple interactions ISO PFKL (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of PFKL protein CTD PMID:37664457 Pfkl Rat selenium atom increases expression ISO PFKL (Homo sapiens) 6480464 Selenium results in increased expression of PFKL mRNA CTD PMID:19244175 Pfkl Rat silicon dioxide decreases expression ISO PFKL (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of PFKL mRNA CTD PMID:25895662 Pfkl Rat sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of PFKL mRNA and sodium arsenite results in decreased expression of PFKL protein CTD PMID:29459688 and PMID:35314868 Pfkl Rat sodium arsenite multiple interactions ISO PFKL (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PFKL mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of PFKL mRNA CTD PMID:39836092 Pfkl Rat sodium arsenite increases expression ISO PFKL (Homo sapiens) 6480464 sodium arsenite results in increased expression of PFKL mRNA CTD PMID:34032870 Pfkl Rat sodium arsenite decreases expression ISO PFKL (Homo sapiens) 6480464 sodium arsenite results in decreased expression of PFKL mRNA CTD PMID:38568856 Pfkl Rat sodium dichromate increases expression ISO Pfkl (Mus musculus) 6480464 sodium bichromate results in increased expression of PFKL mRNA CTD PMID:31558096 Pfkl Rat tert-butyl hydroperoxide increases expression ISO Pfkl (Mus musculus) 6480464 tert-Butylhydroperoxide results in increased expression of PFKL mRNA CTD PMID:15003993 Pfkl Rat Tesaglitazar increases expression EXP 6480464 tesaglitazar results in increased expression of PFKL mRNA CTD PMID:21515302 Pfkl Rat testosterone multiple interactions EXP 6480464 Testosterone inhibits the reaction [Dexamethasone results in decreased expression of PFKL mRNA] CTD PMID:20032058 Pfkl Rat testosterone enanthate affects expression ISO PFKL (Homo sapiens) 6480464 testosterone enanthate affects the expression of PFKL mRNA CTD PMID:17440010 Pfkl Rat tetrachloromethane multiple interactions ISO Pfkl (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in increased expression of PFKL mRNA CTD PMID:30517762 Pfkl Rat thapsigargin increases expression EXP 6480464 Thapsigargin results in increased expression of PFKL protein CTD PMID:35544339 Pfkl Rat titanium dioxide decreases methylation ISO Pfkl (Mus musculus) 6480464 titanium dioxide results in decreased methylation of PFKL gene and titanium dioxide results in decreased methylation of PFKL promoter CTD PMID:35295148 Pfkl Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of PFKL mRNA CTD PMID:25729387 Pfkl Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of PFKL mRNA CTD PMID:33387578 Pfkl Rat trimellitic anhydride increases expression ISO Pfkl (Mus musculus) 6480464 trimellitic anhydride results in increased expression of PFKL mRNA CTD PMID:19042947 Pfkl Rat triphenyl phosphate affects expression ISO PFKL (Homo sapiens) 6480464 triphenyl phosphate affects the expression of PFKL mRNA CTD PMID:37042841 Pfkl Rat troglitazone decreases expression EXP 6480464 troglitazone results in decreased expression of PFKL mRNA CTD PMID:21515302 Pfkl Rat valproic acid decreases expression ISO PFKL (Homo sapiens) 6480464 Valproic Acid results in decreased expression of PFKL mRNA CTD PMID:29154799 Pfkl Rat vitamin E increases expression ISO PFKL (Homo sapiens) 6480464 Vitamin E results in increased expression of PFKL mRNA CTD PMID:19244175 Pfkl Rat Yessotoxin increases expression ISO PFKL (Homo sapiens) 6480464 yessotoxin analog results in increased expression of PFKL mRNA CTD PMID:30679557 Pfkl Rat zearalenone decreases expression ISO Pfkl (Mus musculus) 6480464 Zearalenone results in decreased expression of PFKL protein CTD PMID:36252740 Pfkl Rat zinc atom decreases expression EXP 6480464 Zinc results in decreased expression of PFKL mRNA CTD PMID:17074742 Pfkl Rat zinc sulfate decreases expression EXP 6480464 Zinc Sulfate results in decreased expression of PFKL mRNA CTD PMID:17074742 Pfkl Rat zinc(0) decreases expression EXP 6480464 Zinc results in decreased expression of PFKL mRNA CTD PMID:17074742
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(-)-epigallocatechin 3-gallate (EXP) 1,2-dimethylhydrazine (ISO) 1,4-benzoquinone (ISO) 1-[4,4-bis(4-fluorophenyl)butyl]-4-[4-chloro-3-(trifluoromethyl)phenyl]-4-piperidinol (ISO) 1-chloro-2,4-dinitrobenzene (ISO) 17beta-estradiol (EXP) 1H-pyrazole (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,6-dinitrotoluene (EXP) 3,3',4,4',5-pentachlorobiphenyl (EXP) 4,4'-sulfonyldiphenol (EXP) 6-propyl-2-thiouracil (EXP) acrylamide (EXP,ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) aluminium phosphide (EXP) ammonium chloride (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) beta-naphthoflavone (EXP) bis(2-chloroethyl) sulfide (EXP) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (EXP,ISO) cadmium atom (ISO) cadmium dichloride (ISO) captan (ISO) carbon nanotube (ISO) chlordecone (ISO) chlorpyrifos (ISO) cisplatin (ISO) clofibrate (ISO) cobalt dichloride (EXP) cocaine (EXP) copper(II) sulfate (ISO) corticosterone (EXP) coumestrol (ISO) cyclosporin A (ISO) deguelin (ISO) dexamethasone (EXP) diclofenac (ISO) Diosbulbin B (ISO) dioxygen (ISO) disodium selenite (ISO) doxorubicin (ISO) elemental selenium (ISO) Enterolactone (ISO) ethanol (EXP,ISO) flumequine (ISO) fluoranthene (ISO) flutamide (ISO) folic acid (ISO) folpet (ISO) fructose (EXP) gentamycin (EXP) ivermectin (ISO) lipopolysaccharide (EXP) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) mercury atom (ISO) mercury(0) (ISO) methapyrilene (ISO) mono(2-ethylhexyl) phthalate (ISO) Muraglitazar (EXP) N-methyl-4-phenylpyridinium (ISO) N-nitrosodiethylamine (EXP) N1'-[2-[[5-[(dimethylamino)methyl]-2-furanyl]methylthio]ethyl]-N1-methyl-2-nitroethene-1,1-diamine (EXP) nickel dichloride (ISO) nickel subsulfide (ISO) nitrates (ISO) nitrofen (EXP) ochratoxin A (ISO) oxaliplatin (EXP) ozone (ISO) paracetamol (EXP) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenylephrine (EXP) pirinixic acid (EXP,ISO) propiconazole (ISO) ranitidine (EXP) rotenone (ISO) SB 431542 (ISO) selenium atom (ISO) silicon dioxide (ISO) sodium arsenite (EXP,ISO) sodium dichromate (ISO) tert-butyl hydroperoxide (ISO) Tesaglitazar (EXP) testosterone (EXP) testosterone enanthate (ISO) tetrachloromethane (ISO) thapsigargin (EXP) titanium dioxide (ISO) topotecan (EXP) trichloroethene (EXP) trimellitic anhydride (ISO) triphenyl phosphate (ISO) troglitazone (EXP) valproic acid (ISO) vitamin E (ISO) Yessotoxin (ISO) zearalenone (ISO) zinc atom (EXP) zinc sulfate (EXP) zinc(0) (EXP)
Biological Process
canonical glycolysis (IBA) fructose 1,6-bisphosphate metabolic process (IBA,IDA,IEA,ISO) fructose 6-phosphate metabolic process (IBA,IDA,IEA,ISO) glycolytic process (IDA,IEA,ISO) glycolytic process through fructose-6-phosphate (IEA,ISO) negative regulation of insulin secretion (IEA,ISO) response to glucose (IEA,ISO,ISS)
Molecular Function
6-phosphofructokinase activity (IBA,IDA,IEA,ISO,TAS) ATP binding (IDA,IEA,ISO) catalytic activity (IEA) fructose binding (IEA,ISO) fructose-2,6-bisphosphate 2-phosphatase activity (TAS) fructose-6-phosphate binding (IBA,IDA,IEA,ISO) identical protein binding (IEA,IPI,ISO) kinase activity (IEA) kinase binding (IEA,ISO) metal ion binding (IEA) monosaccharide binding (IDA) nucleotide binding (IEA) protein binding (ISO) transferase activity (IEA)
1.
Key enzymes of carbohydrate metabolism as targets of the 11.5-kDa Zn(2+)-binding protein (parathymosin).
Brand IA and Heinickel A, J Biol Chem. 1991 Nov 5;266(31):20984-9.
2.
Inactivation of phosphofructokinase by glucagon in rat hepatocytes.
Castano JG, etal., J Biol Chem. 1979 Jul 10;254(13):5576-9.
3.
Quantification of liver and kidney phosphofructokinase by radioimmunoassay in fed, starved and alloxan-diabetic rats.
Donofrio JC, etal., Biochem J. 1984 Dec 1;224(2):541-7.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
6.
Critical switch of the metabolic fluxes by phosphofructo-2-kinase:fructose-2,6-bisphosphatase. A kinetic model.
Goldstein BN and Maevsky AA, FEBS Lett 2002 Dec 18;532(3):295-9.
7.
Relationships between concentration of hepatic intermediary metabolites and induction of the key glycolytic enzymes in vivo.
Gunn JM and Taylor CB, Biochem J. 1973 Nov;136(3):455-65.
8.
Rat-liver-type phosphofructokinase mRNA. Structure, tissue distribution and regulation.
Hotta K, etal., Eur J Biochem 1991 Dec 5;202(2):293-8.
9.
Stimulation of glycolysis and accumulation of a stimulator of phosphofructokinase in hepatocytes incubated with vasopressin.
Hue L, etal., Biochem J. 1981 Mar 15;194(3):1023-6.
10.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
11.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
12.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
13.
Control in vivo of rat liver phosphofructokinase by glucagon and nutritional changes.
Nieto A and Castano JG, Biochem J. 1980 Mar 15;186(3):953-7.
14.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
15.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
16.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
17.
GOA pipeline
RGD automated data pipeline
18.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
19.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
20.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
21.
PROPERTIES OF PHOSPHOFRUCTOKINASE FROM RAT LIVER AND THEIR RELATION TO THE CONTROL OF GLYCOLYSIS AND GLUCONEOGENESIS.
UNDERWOOD AH and NEWSHOLME EA, Biochem J. 1965 Jun;95:868-75.
22.
Isoenzymes of phosphofructokinase in the rat. Demonstration of the three non-identical subunits by biochemical, immunochemical and kinetic studies.
Vora S, etal., Biochem J. 1985 Jul 15;229(2):333-41.
23.
Induction and suppression of the key enzymes of glycolysis and gluconeogenesis in isolated perfused rat liver in response to glucose, fructose and lactate.
Wimhurst JM and Manchester KL, Biochem J. 1973 May;134(1):143-56.
Pfkl Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 10,663,907 - 10,685,967 (+) NCBI GRCr8 mRatBN7.2 20 10,664,285 - 10,686,324 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 10,664,272 - 10,686,315 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 11,363,758 - 11,385,830 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 10,724,657 - 10,746,730 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 11,196,584 - 11,218,579 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 11,393,860 - 11,415,889 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 11,393,877 - 11,415,882 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 13,563,748 - 13,585,941 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 11,009,359 - 11,032,511 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 11,009,585 - 11,032,737 (+) NCBI Celera 20 12,170,125 - 12,192,155 (+) NCBI Celera RH 3.4 Map 20 140.5 RGD Cytogenetic Map 20 p12 NCBI
PFKL Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 21 44,300,053 - 44,327,373 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 21 44,300,051 - 44,327,376 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 21 45,719,936 - 45,747,256 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 21 44,544,358 - 44,571,689 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 21 44,544,357 - 44,571,684 NCBI Celera 21 30,825,177 - 30,852,489 (+) NCBI Celera Cytogenetic Map 21 q22.3 NCBI HuRef 21 31,062,995 - 31,117,561 (+) NCBI HuRef CHM1_1 21 45,280,766 - 45,308,102 (+) NCBI CHM1_1 T2T-CHM13v2.0 21 42,654,110 - 42,681,430 (+) NCBI T2T-CHM13v2.0
Pfkl Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 77,822,781 - 77,845,641 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 77,822,781 - 77,845,917 (-) Ensembl GRCm39 Ensembl GRCm38 10 77,986,947 - 78,009,807 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 77,986,947 - 78,010,083 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 77,449,692 - 77,472,541 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 77,390,400 - 77,412,878 (-) NCBI MGSCv36 mm8 Celera 10 79,025,947 - 79,048,797 (-) NCBI Celera Cytogenetic Map 10 C1 NCBI cM Map 10 39.72 NCBI
Pfkl Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955407 41,131,022 - 41,145,394 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955407 41,131,022 - 41,145,392 (-) NCBI ChiLan1.0 ChiLan1.0
PFKL Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 22 40,307,925 - 40,334,593 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 21 35,158,060 - 35,184,538 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 21 30,557,576 - 30,584,231 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 21 43,857,293 - 43,878,380 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 21 43,857,052 - 43,878,380 (+) Ensembl panpan1.1 panPan2
PFKL Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 31 38,153,638 - 38,178,741 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 31 38,156,451 - 38,178,507 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 31 37,313,615 - 37,335,899 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 31 37,703,738 - 37,726,021 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 31 37,703,734 - 37,726,017 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 31 37,570,896 - 37,593,253 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 31 37,551,678 - 37,573,926 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 31 38,049,651 - 38,071,966 (+) NCBI UU_Cfam_GSD_1.0
Pfkl
PFKL Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 207,167,281 - 207,191,671 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 207,167,287 - 207,191,688 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 217,047,266 - 217,071,450 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PFKL Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 2 88,035,409 - 88,063,376 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 2 88,035,347 - 88,063,442 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666054 16,150,512 - 16,178,473 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Pfkl
.
Predicted Target Of
Count of predictions: 66 Count of miRNA genes: 56 Interacting mature miRNAs: 65 Transcripts: ENSRNOT00000001625 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1641915 Colcr9 Colorectal carcinoma resistance QTL 9 2.97 0.0024 intestine integrity trait (VT:0010554) benign colorectal tumor number (CMO:0001795) 20 1530655 46530655 Rat 2317057 Aia27 Adjuvant induced arthritis QTL 27 2.83 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 20 2892597 26381954 Rat 7387283 Uae44 Urinary albumin excretion QTL 44 0.1712 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 20 1 26123605 Rat 4889870 Pur30 Proteinuria QTL 30 19 0.005 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 20 8042410 29322208 Rat 7411668 Foco32 Food consumption QTL 32 8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 1 36600972 Rat 2305926 Iddm37 Insulin dependent diabetes mellitus QTL 37 6 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 20 1527842 46527842 Rat 1354642 Despr15 Despair related QTL 15 0.0027 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 20 1 24159021 Rat 1600382 Edcs3 Endometrial carcinoma susceptibility QTL3 3.5 0.003 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 20 1 25159026 Rat 1558640 Prcs2 Prostate cancer susceptibility QTL 2 3.3 prostate integrity trait (VT:0010571) percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943) 20 4606607 17617956 Rat 631265 Iresp1 Immunoglobin response QTL1 8.3 blood anti-double stranded DNA antibody amount (VT:0004762) serum anti-DNA antibody level (CMO:0001533) 20 9039719 13461775 Rat 8694189 Bw153 Body weight QTL 153 3.13 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 20 1 29191651 Rat 4889857 Pur27 Proteinuria QTL 27 12.2 0.001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 20 4606607 17617956 Rat 70154 Insul2 Insulin level QTL 2 3.75 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 20 6691706 17489458 Rat 9590109 Sffal8 Serum free fatty acids level QTL 8 5.32 0.01 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 20 1 29191651 Rat 9590275 Scort15 Serum corticosterone level QTL 15 3.48 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 20 1 29191651 Rat 9589155 Insul32 Insulin level QTL 32 6.38 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 20 1 29191651 Rat 1581577 Pur15 Proteinuria QTL 15 4.38 0.0002 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 20 8042410 17617956 Rat 7411650 Foco23 Food consumption QTL 23 20.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 1 29191651 Rat 2317851 Alcrsp22 Alcohol response QTL 22 3.2 0.05 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 20 1 27339237 Rat 1598816 Memor12 Memory QTL 12 2.4 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 20 2606836 47606836 Rat 61432 Cia1 Collagen induced arthritis QTL 1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 20 3621656 14101050 Rat 1641893 Alcrsp7 Alcohol response QTL 7 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 20 1 27339237 Rat 6893685 Bw111 Body weight QTL 111 2.7 0.004 body mass (VT:0001259) body weight (CMO:0000012) 20 1 32578807 Rat 9590252 Scort12 Serum corticosterone level QTL 12 20.46 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 20 1 36600972 Rat
RH94598
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 20 10,686,160 - 10,686,250 (+) MAPPER mRatBN7.2 Rnor_6.0 20 11,415,726 - 11,415,815 NCBI Rnor6.0 Rnor_5.0 20 13,585,778 - 13,585,867 UniSTS Rnor5.0 RGSC_v3.4 20 11,032,357 - 11,032,446 UniSTS RGSC3.4 Celera 20 12,192,001 - 12,192,090 UniSTS RH 3.4 Map 20 140.5 UniSTS Cytogenetic Map 20 p12 UniSTS
RH130425
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 20 10,685,680 - 10,685,884 (+) Marker Load Pipeline mRatBN7.2 20 10,686,036 - 10,686,240 (+) MAPPER mRatBN7.2 Rnor_6.0 20 11,415,603 - 11,415,805 NCBI Rnor6.0 Rnor_5.0 20 13,585,655 - 13,585,857 UniSTS Rnor5.0 RGSC_v3.4 20 11,032,233 - 11,032,436 UniSTS RGSC3.4 Celera 20 12,191,876 - 12,192,080 UniSTS Cytogenetic Map 20 p12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000001625 ⟹ ENSRNOP00000001625
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 10,664,272 - 10,686,315 (+) Ensembl Rnor_6.0 Ensembl 20 11,393,877 - 11,415,882 (+) Ensembl
RefSeq Acc Id:
NM_013190 ⟹ NP_037322
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 10,663,965 - 10,685,958 (+) NCBI mRatBN7.2 20 10,664,318 - 10,686,315 (+) NCBI Rnor_6.0 20 11,393,887 - 11,415,880 (+) NCBI Rnor_5.0 20 13,563,748 - 13,585,941 (+) NCBI RGSC_v3.4 20 11,009,359 - 11,032,511 (+) RGD Celera 20 12,170,125 - 12,192,155 (+) RGD
Sequence:
GGCGACAGCCGCGCGGAACGCAGAGCGGCGGGAGAGGAGCTCGGGCTCCTGGTCTCTGCTGCCGTCATGGCTACCGTGGACCTGGAGAAGTTGCGGATGTCGGGGGCTGGCAAGGCCATCGGAGTGCT
hide sequence
RefSeq Acc Id:
XM_008772798 ⟹ XP_008771020
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 10,663,907 - 10,685,967 (+) NCBI mRatBN7.2 20 10,664,286 - 10,686,324 (+) NCBI Rnor_6.0 20 11,393,860 - 11,415,889 (+) NCBI
Sequence:
CACAGGCAGCGGCACGGGGCGGGGACAGGCGACAGCCGCGCGGAACGCAGAGCGGCGGGAGAGGAGCTCGGGCTCCTGGTCTCTGCTGCCGTCATGGCTACCGTGGACCTGGAGAAGTTGCGGATGTC
hide sequence
RefSeq Acc Id:
NP_037322 ⟸ NM_013190
- UniProtKB:
P30835 (UniProtKB/Swiss-Prot), Q6P783 (UniProtKB/TrEMBL)
- Sequence:
MATVDLEKLRMSGAGKAIGVLTSGGDAQGMNAAVRAVTRMGIYVGAKVFLIYEGYEGLVEGGENIKPANWLSVSNIIQLGGTIIGSARCKAFTTREGRLAAAYNLLQHGITNLCVIGGDGSLTGANIF
hide sequence
RefSeq Acc Id:
XP_008771020 ⟸ XM_008772798
- Peptide Label:
isoform X1
- UniProtKB:
Q6P783 (UniProtKB/TrEMBL)
- Sequence:
MATVDLEKLRMSGAGKAIGVLTSGGDAQGMNAAVRAVTRMGIYVGAKVFLIYEAYVQAERHIRK
hide sequence
Ensembl Acc Id:
ENSRNOP00000001625 ⟸ ENSRNOT00000001625
RGD ID: 13701491 Promoter ID: EPDNEW_R12014 Type: initiation region Name: Pfkl_1 Description: phosphofructokinase, liver type SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 20 11,393,886 - 11,393,946 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-17
Pfkl
phosphofructokinase, liver type
Pfkl
phosphofructokinase, liver
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-10-17
Pfkl
phosphofructokinase, liver
Pfkl
phosphofructokinase, liver, B-type
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Pfkl
Phosphofructokinase, liver, B-type
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_domains
homodimer with each of its subunits contains an N-terminal kinase domain and a C-terminal bisphosphatase domain
633699
gene_regulation
regulated by cyclic AMP-dependent protein kinase (cAMP-PK)
633699
