Symbol:
Pak1
Name:
p21 (RAC1) activated kinase 1
RGD ID:
3250
Description:
Enables protein kinase binding activity and protein serine/threonine kinase activity. Involved in several processes, including nervous system development; positive regulation of cell migration; and regulation of cell growth. Located in several cellular components, including Z disc; intercalated disc; and ruffle. Biomarker of brain ischemia. Human ortholog(s) of this gene implicated in breast cancer; renal cell carcinoma; and schizophrenia. Orthologous to human PAK1 (p21 (RAC1) activated kinase 1); PARTICIPATES IN adenosine signaling pathway; ephrin - ephrin receptor bidirectional signaling axis; epidermal growth factor/neuregulin signaling pathway; INTERACTS WITH (+)-schisandrin B; (S)-amphetamine; 1-octadec-9-enoylglycero-3-phosphate.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
alpha-PAK; p21 (CDKN1A)-activated kinase 1; p21 protein (Cdc42/Rac)-activated kinase 1; p21-activated kinase 1; p21/Cdc42/Rac1-activated kinase 1 (yeast Ste20-related); p68-PAK; PAK-1; protein kinase MUK2; serine/threonine-protein kinase PAK 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 161,522,399 - 161,637,623 (+) NCBI GRCr8 mRatBN7.2 1 152,111,172 - 152,226,390 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 152,111,188 - 152,226,383 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 160,098,178 - 160,212,347 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 167,278,365 - 167,392,536 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 160,151,847 - 160,266,019 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 162,768,156 - 162,883,356 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 162,768,156 - 162,883,355 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 168,974,734 - 169,090,326 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 155,057,622 - 155,174,714 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 155,136,027 - 155,253,120 (+) NCBI Celera 1 150,203,043 - 150,317,598 (+) NCBI Celera Cytogenetic Map 1 q32 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pak1 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of PAK1 mRNA] CTD PMID:31150632 Pak1 Rat (1->4)-beta-D-glucan multiple interactions ISO Pak1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PAK1 mRNA CTD PMID:36331819 Pak1 Rat (S)-amphetamine increases phosphorylation EXP 6480464 Dextroamphetamine results in increased phosphorylation of PAK1 protein CTD PMID:18991853 Pak1 Rat (S)-amphetamine increases expression EXP 6480464 Dextroamphetamine results in increased expression of PAK1 protein CTD PMID:18991853 Pak1 Rat 1,2-dichloroethane decreases expression ISO Pak1 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of PAK1 mRNA CTD PMID:28960355 Pak1 Rat 1,2-dimethylhydrazine multiple interactions ISO Pak1 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of PAK1 mRNA] CTD PMID:22206623 Pak1 Rat 1,2-dimethylhydrazine increases expression ISO Pak1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of PAK1 mRNA CTD PMID:22206623 Pak1 Rat 1-octadec-9-enoylglycero-3-phosphate increases activity EXP 6480464 lysophosphatidic acid results in increased activity of PAK1 protein CTD PMID:11855845 Pak1 Rat 1-octadec-9-enoylglycero-3-phosphate multiple interactions EXP 6480464 4-amino-5-(4-methylphenyl)-7-(tert-butyl)pyrazolo(3 more ... CTD PMID:11855845 Pak1 Rat 17alpha-ethynylestradiol affects expression ISO Pak1 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of PAK1 mRNA CTD PMID:17555576 Pak1 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of PAK1 mRNA CTD PMID:16174780 Pak1 Rat 17beta-estradiol multiple interactions ISO PAK1 (Homo sapiens) 6480464 IGF1R mutant form inhibits the reaction [Estradiol results in decreased expression of PAK1 mRNA] CTD PMID:23094148 Pak1 Rat 17beta-estradiol increases expression ISO PAK1 (Homo sapiens) 6480464 Estradiol results in increased expression of PAK1 protein CTD PMID:33181973 Pak1 Rat 17beta-estradiol decreases expression ISO PAK1 (Homo sapiens) 6480464 Estradiol results in decreased expression of PAK1 mRNA CTD PMID:23094148 Pak1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PAK1 mRNA CTD PMID:16960034 and PMID:33387578 Pak1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PAK1 mRNA CTD PMID:32109520 Pak1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Pak1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of PAK1 mRNA CTD PMID:19465110 more ... Pak1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Pak1 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Pak1 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of PAK1 mRNA CTD PMID:21346803 Pak1 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of PAK1 mRNA CTD PMID:21346803 Pak1 Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:23196670 Pak1 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of PAK1 protein CTD PMID:34915118 Pak1 Rat 4,4'-sulfonyldiphenol increases expression ISO PAK1 (Homo sapiens) 6480464 bisphenol S results in increased expression of PAK1 protein CTD PMID:33181973 Pak1 Rat 4-hydroxyphenyl retinamide increases expression ISO Pak1 (Mus musculus) 6480464 Fenretinide results in increased expression of PAK1 mRNA CTD PMID:28973697 Pak1 Rat 5-azacytidine increases expression ISO PAK1 (Homo sapiens) 6480464 Azacitidine results in increased expression of PAK1 mRNA CTD PMID:20823114 Pak1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of PAK1 mRNA CTD PMID:24780913 Pak1 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of PAK1 mRNA CTD PMID:31881176 Pak1 Rat all-trans-retinoic acid increases expression ISO PAK1 (Homo sapiens) 6480464 Tretinoin results in increased expression of PAK1 mRNA CTD PMID:15498508 and PMID:33167477 Pak1 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of PAK1 mRNA CTD PMID:35163327 Pak1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PAK1 mRNA CTD PMID:16483693 Pak1 Rat atrazine decreases expression EXP 6480464 Atrazine results in decreased expression of PAK1 mRNA CTD PMID:36841081 Pak1 Rat axitinib multiple interactions ISO PAK1 (Homo sapiens) 6480464 axitinib inhibits the reaction [VEGFA protein results in increased phosphorylation of PAK1 protein] CTD PMID:27044328 Pak1 Rat benzo[a]pyrene increases expression ISO Pak1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of PAK1 mRNA CTD PMID:22228805 Pak1 Rat benzo[a]pyrene affects methylation ISO PAK1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of PAK1 5' UTR CTD PMID:27901495 Pak1 Rat benzo[a]pyrene decreases methylation ISO PAK1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of PAK1 promoter CTD PMID:27901495 Pak1 Rat benzo[a]pyrene diol epoxide I decreases expression ISO PAK1 (Homo sapiens) 6480464 7 more ... CTD PMID:30011042 Pak1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PAK1 mRNA CTD PMID:25181051 Pak1 Rat bisphenol A increases methylation ISO PAK1 (Homo sapiens) 6480464 bisphenol A results in increased methylation of PAK1 gene CTD PMID:31601247 Pak1 Rat bisphenol A decreases expression ISO PAK1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of PAK1 mRNA CTD PMID:29275510 Pak1 Rat bisphenol A decreases methylation EXP 6480464 bisphenol A results in decreased methylation of PAK1 gene CTD PMID:28505145 Pak1 Rat cadmium atom increases expression ISO PAK1 (Homo sapiens) 6480464 Cadmium results in increased expression of PAK1 mRNA CTD PMID:22562489 Pak1 Rat caffeine decreases expression EXP 6480464 Caffeine results in decreased expression of PAK1 mRNA CTD PMID:29343424 Pak1 Rat caffeine increases phosphorylation ISO PAK1 (Homo sapiens) 6480464 Caffeine results in increased phosphorylation of PAK1 protein CTD PMID:35688186 Pak1 Rat choline multiple interactions ISO Pak1 (Mus musculus) 6480464 [Choline deficiency co-treated with Folic Acid deficiency co-treated with Methionine deficiency] results in increased expression of PAK1 mRNA and [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of PAK1 mRNA CTD PMID:20938992 and PMID:29127188 Pak1 Rat ciguatoxin CTX1B affects expression ISO Pak1 (Mus musculus) 6480464 Ciguatoxins affects the expression of PAK1 mRNA CTD PMID:18353800 Pak1 Rat cisplatin increases expression ISO PAK1 (Homo sapiens) 6480464 Cisplatin results in increased expression of PAK1 mRNA CTD PMID:27594783 Pak1 Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of PAK1 mRNA CTD PMID:24386269 Pak1 Rat copper atom multiple interactions ISO PAK1 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of PAK1 mRNA CTD PMID:20971185 Pak1 Rat copper(0) multiple interactions ISO PAK1 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of PAK1 mRNA CTD PMID:20971185 Pak1 Rat cyclosporin A affects expression ISO Pak1 (Mus musculus) 6480464 Cyclosporine affects the expression of PAK1 mRNA CTD PMID:19770486 Pak1 Rat cyclosporin A increases expression ISO PAK1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of PAK1 mRNA CTD PMID:25562108 Pak1 Rat D-gluconic acid multiple interactions EXP 6480464 [gluconic acid co-treated with Deoxycholic Acid] results in increased expression of PAK1 mRNA CTD PMID:16556975 Pak1 Rat DDE increases expression ISO PAK1 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of PAK1 mRNA CTD PMID:38568856 Pak1 Rat decabromodiphenyl ether decreases expression EXP 6480464 decabromobiphenyl ether results in decreased expression of PAK1 mRNA CTD PMID:23640034 Pak1 Rat deoxycholic acid multiple interactions EXP 6480464 [gluconic acid co-treated with Deoxycholic Acid] results in increased expression of PAK1 mRNA CTD PMID:16556975 Pak1 Rat diallyl disulfide decreases expression ISO PAK1 (Homo sapiens) 6480464 diallyl disulfide results in decreased expression of PAK1 protein CTD PMID:36793247 Pak1 Rat diallyl disulfide multiple interactions ISO PAK1 (Homo sapiens) 6480464 ARHGDIB protein inhibits the reaction [diallyl disulfide results in decreased expression of PAK1 protein] CTD PMID:36793247 Pak1 Rat dibenziodolium multiple interactions EXP 6480464 diphenyleneiodonium inhibits the reaction [lysophosphatidic acid results in increased activity of PAK1 protein] CTD PMID:11855845 Pak1 Rat Dibutyl phosphate affects expression ISO PAK1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of PAK1 mRNA CTD PMID:37042841 Pak1 Rat dichlorine multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in decreased expression of PAK1 mRNA CTD PMID:18636392 Pak1 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of PAK1 mRNA CTD PMID:21551480 Pak1 Rat dorsomorphin multiple interactions ISO PAK1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Pak1 Rat doxorubicin decreases expression ISO PAK1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of PAK1 mRNA CTD PMID:29803840 Pak1 Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of PAK1 protein CTD PMID:20829428 Pak1 Rat ethanol affects splicing ISO Pak1 (Mus musculus) 6480464 Ethanol affects the splicing of PAK1 mRNA CTD PMID:30319688 Pak1 Rat folic acid multiple interactions ISO Pak1 (Mus musculus) 6480464 [Choline deficiency co-treated with Folic Acid deficiency co-treated with Methionine deficiency] results in increased expression of PAK1 mRNA more ... CTD PMID:20938992 more ... Pak1 Rat fonofos increases methylation ISO PAK1 (Homo sapiens) 6480464 Fonofos results in increased methylation of PAK1 promoter CTD PMID:22847954 Pak1 Rat FR900359 affects phosphorylation ISO PAK1 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of PAK1 protein CTD PMID:37730182 Pak1 Rat genistein multiple interactions EXP 6480464 Genistein inhibits the reaction [lysophosphatidic acid results in increased activity of PAK1 protein] CTD PMID:11855845 Pak1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of PAK1 mRNA CTD PMID:33387578 Pak1 Rat glyphosate increases expression ISO PAK1 (Homo sapiens) 6480464 Glyphosate results in increased expression of PAK1 mRNA CTD PMID:31295307 Pak1 Rat hydrogen peroxide affects expression ISO PAK1 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of PAK1 protein CTD PMID:21179406 Pak1 Rat hydrogen peroxide multiple interactions ISO Pak1 (Mus musculus) 6480464 [Hydrogen Peroxide co-treated with N-(oxo-5 more ... CTD PMID:31494107 Pak1 Rat ivermectin decreases expression ISO PAK1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of PAK1 protein CTD PMID:32959892 Pak1 Rat L-methionine multiple interactions ISO Pak1 (Mus musculus) 6480464 [Choline deficiency co-treated with Folic Acid deficiency co-treated with Methionine deficiency] results in increased expression of PAK1 mRNA and [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of PAK1 mRNA CTD PMID:20938992 and PMID:29127188 Pak1 Rat methylmercury chloride decreases expression ISO PAK1 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of PAK1 mRNA CTD PMID:28001369 Pak1 Rat microcystin-LR increases expression ISO Pak1 (Mus musculus) 6480464 cyanoginosin LR results in increased expression of PAK1 mRNA CTD PMID:17654400 Pak1 Rat monosodium L-glutamate decreases expression EXP 6480464 Sodium Glutamate results in decreased expression of PAK1 mRNA CTD PMID:28954212 Pak1 Rat N-formyl-L-methionyl-L-leucyl-L-phenylalanine multiple interactions EXP 6480464 2-benzyl-3-(4-hydroxymethylphenyl)indazole inhibits the reaction [N-Formylmethionine Leucyl-Phenylalanine affects the localization of and results in increased phosphorylation of PAK1 protein] more ... CTD PMID:19445920 Pak1 Rat N-methyl-4-phenylpyridinium affects expression ISO PAK1 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium affects the expression of PAK1 mRNA CTD PMID:12710931 Pak1 Rat N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of PAK1 CTD PMID:17055752 Pak1 Rat N-nitrosodiethylamine increases expression ISO Pak1 (Mus musculus) 6480464 Diethylnitrosamine results in increased expression of PAK1 mRNA CTD PMID:24535843 Pak1 Rat nickel atom decreases expression ISO PAK1 (Homo sapiens) 6480464 Nickel results in decreased expression of PAK1 mRNA CTD PMID:23195993 Pak1 Rat nickel atom increases expression ISO PAK1 (Homo sapiens) 6480464 Nickel results in increased expression of PAK1 mRNA CTD PMID:23195993 and PMID:25583101 Pak1 Rat ozone multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in decreased expression of PAK1 mRNA CTD PMID:18636392 Pak1 Rat paracetamol decreases expression ISO PAK1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of PAK1 mRNA CTD PMID:29067470 Pak1 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of PAK1 mRNA CTD PMID:18198484 Pak1 Rat parathion increases methylation ISO PAK1 (Homo sapiens) 6480464 Parathion results in increased methylation of PAK1 promoter CTD PMID:22847954 Pak1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Pak1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PAK1 mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in increased expression of PAK1 mRNA CTD PMID:36331819 Pak1 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of PAK1 mRNA CTD PMID:35163327 Pak1 Rat phenylmercury acetate decreases expression ISO PAK1 (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of PAK1 mRNA CTD PMID:26272509 Pak1 Rat phenylmercury acetate multiple interactions ISO PAK1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PAK1 mRNA CTD PMID:27188386 Pak1 Rat pirinixic acid increases expression ISO Pak1 (Mus musculus) 6480464 pirinixic acid results in increased expression of PAK1 mRNA CTD PMID:23811191 Pak1 Rat quercetin decreases phosphorylation ISO PAK1 (Homo sapiens) 6480464 Quercetin results in decreased phosphorylation of PAK1 protein CTD PMID:25971889 Pak1 Rat reactive oxygen species multiple interactions ISO PAK1 (Homo sapiens) 6480464 PAK1 protein promotes the reaction [VEGFA protein results in increased abundance of Reactive Oxygen Species] CTD PMID:12855698 Pak1 Rat resveratrol increases phosphorylation ISO PAK1 (Homo sapiens) 6480464 resveratrol results in increased phosphorylation of PAK1 protein CTD PMID:23298290 Pak1 Rat resveratrol multiple interactions ISO PAK1 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of PAK1 mRNA CTD PMID:23557933 Pak1 Rat resveratrol decreases expression ISO PAK1 (Homo sapiens) 6480464 resveratrol results in decreased expression of PAK1 protein CTD PMID:20133117 Pak1 Rat resveratrol decreases activity ISO PAK1 (Homo sapiens) 6480464 resveratrol results in decreased activity of PAK1 protein CTD PMID:20133117 Pak1 Rat rotenone increases expression ISO Pak1 (Mus musculus) 6480464 Rotenone results in increased expression of PAK1 mRNA CTD PMID:32937126 Pak1 Rat SB 431542 multiple interactions ISO PAK1 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 and PMID:37664457 Pak1 Rat sodium arsenate increases expression ISO Pak1 (Mus musculus) 6480464 sodium arsenate results in increased expression of PAK1 mRNA CTD PMID:30953684 Pak1 Rat sodium arsenite decreases expression ISO PAK1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of PAK1 mRNA CTD PMID:32844245 Pak1 Rat streptozocin multiple interactions ISO Pak1 (Mus musculus) 6480464 [Streptozocin co-treated with Dietary Fats] results in increased expression of PAK1 mRNA CTD PMID:29127188 Pak1 Rat sulfates multiple interactions ISO PAK1 (Homo sapiens) 6480464 [Soot co-treated with Sulfates] affects the methylation of PAK1 promoter CTD PMID:25395096 Pak1 Rat sunitinib decreases expression ISO PAK1 (Homo sapiens) 6480464 Sunitinib results in decreased expression of PAK1 mRNA CTD PMID:31533062 Pak1 Rat tamibarotene increases expression ISO PAK1 (Homo sapiens) 6480464 tamibarotene results in increased expression of PAK1 mRNA CTD PMID:15498508 Pak1 Rat tamoxifen affects response to substance ISO PAK1 (Homo sapiens) 6480464 PAK1 affects the susceptibility to Tamoxifen CTD PMID:20179234 Pak1 Rat tamoxifen affects expression ISO Pak1 (Mus musculus) 6480464 Tamoxifen affects the expression of PAK1 mRNA CTD PMID:17555576 Pak1 Rat tebuconazole decreases expression ISO PAK1 (Homo sapiens) 6480464 tebuconazole results in decreased expression of PAK1 mRNA CTD PMID:30458266 Pak1 Rat terbufos increases methylation ISO PAK1 (Homo sapiens) 6480464 terbufos results in increased methylation of PAK1 promoter CTD PMID:22847954 Pak1 Rat testosterone decreases expression ISO Pak1 (Mus musculus) 6480464 Testosterone results in decreased expression of PAK1 mRNA CTD PMID:20403060 Pak1 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of PAK1 mRNA] CTD PMID:31150632 Pak1 Rat tetrachloromethane increases expression ISO Pak1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of PAK1 mRNA CTD PMID:29987408 Pak1 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of PAK1 mRNA CTD PMID:31150632 Pak1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of PAK1 mRNA CTD PMID:22659510 more ... Pak1 Rat triphenyl phosphate affects expression ISO PAK1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of PAK1 mRNA CTD PMID:37042841 Pak1 Rat valproic acid increases methylation ISO PAK1 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of PAK1 gene CTD PMID:29154799 Pak1 Rat valproic acid affects expression ISO PAK1 (Homo sapiens) 6480464 Valproic Acid affects the expression of PAK1 mRNA CTD PMID:25979313 Pak1 Rat valproic acid decreases expression ISO PAK1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of PAK1 mRNA CTD PMID:23179753 and PMID:24935251 Pak1 Rat valproic acid increases expression ISO PAK1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of PAK1 mRNA CTD PMID:24383497 and PMID:26272509 Pak1 Rat valproic acid multiple interactions ISO PAK1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PAK1 mRNA CTD PMID:27188386
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(+)-schisandrin B (EXP) (1->4)-beta-D-glucan (ISO) (S)-amphetamine (EXP) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 1-octadec-9-enoylglycero-3-phosphate (EXP) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3-chloropropane-1,2-diol (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 5-azacytidine (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) ammonium chloride (EXP) atrazine (EXP) axitinib (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bisphenol A (EXP,ISO) cadmium atom (ISO) caffeine (EXP,ISO) choline (ISO) ciguatoxin CTX1B (ISO) cisplatin (ISO) cobalt dichloride (EXP) copper atom (ISO) copper(0) (ISO) cyclosporin A (ISO) D-gluconic acid (EXP) DDE (ISO) decabromodiphenyl ether (EXP) deoxycholic acid (EXP) diallyl disulfide (ISO) dibenziodolium (EXP) Dibutyl phosphate (ISO) dichlorine (EXP) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) ethanol (EXP,ISO) folic acid (ISO) fonofos (ISO) FR900359 (ISO) genistein (EXP) gentamycin (EXP) glyphosate (ISO) hydrogen peroxide (ISO) ivermectin (ISO) L-methionine (ISO) methylmercury chloride (ISO) microcystin-LR (ISO) monosodium L-glutamate (EXP) N-formyl-L-methionyl-L-leucyl-L-phenylalanine (EXP) N-methyl-4-phenylpyridinium (ISO) N-nitrosodiethylamine (EXP,ISO) nickel atom (ISO) ozone (EXP) paracetamol (ISO) paraquat (EXP) parathion (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP) phenylmercury acetate (ISO) pirinixic acid (ISO) quercetin (ISO) reactive oxygen species (ISO) resveratrol (ISO) rotenone (ISO) SB 431542 (ISO) sodium arsenate (ISO) sodium arsenite (ISO) streptozocin (ISO) sulfates (ISO) sunitinib (ISO) tamibarotene (ISO) tamoxifen (ISO) tebuconazole (ISO) terbufos (ISO) testosterone (ISO) tetrachloromethane (EXP,ISO) thioacetamide (EXP) triphenyl phosphate (ISO) valproic acid (ISO)
Biological Process
actin cytoskeleton organization (IEA,ISO,ISS) amygdala development (ISO) apoptotic process (IEA) branching morphogenesis of an epithelial tube (IEA,ISO,ISS) cell migration (IBA,IEA,ISO) cellular response to insulin stimulus (IDA) cellular response to starvation (IBA) cerebellum development (IEP) chromatin remodeling (IEA,ISO,ISS) dendrite development (ISO) dendritic spine development (ISO) DNA damage response (IEA,ISO,ISS) establishment of cell polarity (IMP) exocytosis (IEA) gamma-aminobutyric acid secretion, neurotransmission (ISO) glutamate secretion, neurotransmission (ISO) hepatocyte growth factor receptor signaling pathway (IEA,ISO) intracellular signal transduction (IBA,TAS) MAPK cascade (IEA,ISO) negative regulation of cell growth involved in cardiac muscle cell development (IMP) negative regulation of cell proliferation involved in contact inhibition (IEA,ISO,ISS) neuromuscular junction development (ISO) neuron projection morphogenesis (IMP) observational learning (ISO) positive regulation of axon extension (IMP) positive regulation of cell migration (IEA,ISO,ISS) positive regulation of cell population proliferation (IEA,ISO) positive regulation of fibroblast migration (IDA) positive regulation of insulin receptor signaling pathway (IMP) positive regulation of intracellular estrogen receptor signaling pathway (IEA,ISO,ISS) positive regulation of microtubule nucleation (IEA,ISO,ISS) positive regulation of microtubule polymerization (IEA,ISO) positive regulation of peptidyl-serine phosphorylation (IMP) positive regulation of protein targeting to membrane (IMP) positive regulation of stress fiber assembly (IEA,ISO,ISS) positive regulation of vascular associated smooth muscle cell migration (IMP) positive regulation of vascular associated smooth muscle cell proliferation (IMP) protein autophosphorylation (IDA) protein localization to cytoplasmic stress granule (IEA,ISO,ISS) protein phosphorylation (IDA) receptor clustering (ISO) regulation of actin cytoskeleton organization (IBA,IMP) regulation of axonogenesis (IBA) regulation of gene expression (ISO) regulation of long-term synaptic potentiation (ISO) regulation of MAPK cascade (IBA,ISO) regulation of trans-synaptic signaling by endocannabinoid, modulating synaptic transmission (ISO) response to hypoxia (IDA) small GTPase-mediated signal transduction (TAS) transmission of nerve impulse (ISO) wound healing (IEA,ISO,ISS)
Cellular Component
actin filament (IEA,ISO) anchoring junction (IEA) axon (IDA,ISO) cell projection (IEA) cell-cell junction (IEA,ISO,ISS) centrosome (IEA) chromosome (IEA) cytoplasm (IBA,IEA,ISO,ISS) cytoskeleton (IEA) cytosol (IEA,ISO) dendrite (IDA,ISO) focal adhesion (IEA) GABA-ergic synapse (ISO) glutamatergic synapse (ISO) growth cone (ISO) intercalated disc (IDA) lamellipodium (IDA,IEA) membrane (IEA) nuclear membrane (IDA) nucleoplasm (IEA,ISO,ISS) nucleus (IEA,ISO) plasma membrane (IEA,ISO,ISS) postsynaptic density (ISO) presynapse (IEA) protein-containing complex (IEA,ISO) ruffle (IDA,IEA,ISO,ISS) ruffle membrane (IEA) Z disc (IDA)
Molecular Function
ATP binding (IEA) catalytic activity (IEA) collagen binding (IEA,ISO,ISS) gamma-tubulin binding (IEA,ISO,ISS) identical protein binding (ISO) kinase activity (IEA) MAP kinase kinase kinase activity (TAS) nucleotide binding (IEA) protein binding (IPI,ISO) protein kinase activity (IDA,IEA,ISO,ISS) protein kinase binding (IPI) protein serine kinase activity (IEA) protein serine/threonine kinase activity (IBA,IDA,IEA,ISO) small GTPase binding (IEA,ISO) transferase activity (IEA)
1.
Changes in WT1 splicing are associated with a specific gene expression profile in Wilms' tumour.
Baudry D, etal., Oncogene. 2002 Aug 15;21(36):5566-73.
2.
Amplification of CCND1 and PAK1 as predictors of recurrence and tamoxifen resistance in postmenopausal breast cancer.
Bostner J, etal., Oncogene. 2007 Oct 25;26(49):6997-7005. Epub 2007 May 7.
3.
Human Ste20 homologue hPAK1 links GTPases to the JNK MAP kinase pathway.
Brown JL, etal., Curr Biol. 1996 May 1;6(5):598-605.
4.
Activation of p21-activated protein kinase alpha (alpha PAK) by hyperosmotic shock in neonatal ventricular myocytes.
Clerk A and Sugden PH, FEBS Lett. 1997 Feb 10;403(1):23-5.
5.
Membrane targeting of p21-activated kinase 1 (PAK1) induces neurite outgrowth from PC12 cells.
Daniels RH, etal., EMBO J. 1998 Feb 2;17(3):754-64.
6.
A FOXO-Pak1 transcriptional pathway controls neuronal polarity.
de la Torre-Ubieta L, etal., Genes Dev. 2010 Apr 15;24(8):799-813. doi: 10.1101/gad.1880510.
7.
Novel role of proline-rich nonreceptor tyrosine kinase 2 in vascular wall remodeling after balloon injury.
Gadepalli R, etal., Arterioscler Thromb Vasc Biol. 2012 Nov;32(11):2652-61. doi: 10.1161/ATVBAHA.112.253112. Epub 2012 Aug 23.
8.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
9.
Phosphorylation and reorganization of vimentin by p21-activated kinase (PAK).
Goto H, etal., Genes Cells. 2002 Feb;7(2):91-7.
10.
Scaffolding function of PAK in the PDK1-Akt pathway.
Higuchi M, etal., Nat Cell Biol. 2008 Nov;10(11):1356-64. doi: 10.1038/ncb1795. Epub 2008 Oct 19.
11.
p21-activated kinase 1 participates in vascular remodeling in vitro and in vivo.
Hinoki A, etal., Hypertension. 2010 Jan;55(1):161-5. doi: 10.1161/HYPERTENSIONAHA.109.143057. Epub 2009 Nov 9.
12.
Activation of the JNK pathway by distantly related protein kinases, MEKK and MUK.
Hirai S, etal., Oncogene 1996 Feb 1;12(3):641-50.
13.
Association between Pak1 expression and subcellular localization and tamoxifen resistance in breast cancer patients.
Holm C, etal., J Natl Cancer Inst. 2006 May 17;98(10):671-80.
14.
Localized activation of p21-activated kinase controls neuronal polarity and morphology.
Jacobs T, etal., J Neurosci. 2007 Aug 8;27(32):8604-15.
15.
Intracellular localization and functional effects of P21-activated kinase-1 (Pak1) in cardiac myocytes.
Ke Y, etal., Circ Res. 2004 Feb 6;94(2):194-200. Epub 2003 Dec 11.
16.
Expression of mitogen-activated protein kinase pathways during postnatal development of rat heart.
Kim SO, etal., J Cell Biochem 1998 Nov 1;71(2):286-301.
17.
Pak1 as a novel therapeutic target for antihypertrophic treatment in the heart.
Liu W, etal., Circulation. 2011 Dec 13;124(24):2702-15. doi: 10.1161/CIRCULATIONAHA.111.048785. Epub 2011 Nov 14.
18.
p21-activated kinase-aberrant activation and translocation in Alzheimer disease pathogenesis.
Ma QL, etal., J Biol Chem. 2008 May 16;283(20):14132-43. Epub 2008 Mar 17.
19.
PAK kinases are directly coupled to the PIX family of nucleotide exchange factors.
Manser E, etal., Mol Cell 1998 Jan;1(2):183-92.
20.
A brain serine/threonine protein kinase activated by Cdc42 and Rac1.
Manser E, etal., Nature 1994 Jan 6;367(6458):40-6.
21.
Regulation of Akt/PKB activity by P21-activated kinase in cardiomyocytes.
Mao K, etal., J Mol Cell Cardiol. 2008 Feb;44(2):429-34. Epub 2007 Dec 3.
22.
A novel serine kinase activated by rac1/CDC42Hs-dependent autophosphorylation is related to PAK65 and STE20.
Martin GA, etal., EMBO J 1995 May 1;14(9):1970-8.
23.
Analysis of gene amplification and prognostic markers in ovarian cancer using comparative genomic hybridization for microarrays and immunohistochemical analysis for tissue microarrays.
Mayr D, etal., Am J Clin Pathol. 2006 Jul;126(1):101-9.
24.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
25.
A microarray study of gene and protein regulation in human and rat brain following middle cerebral artery occlusion.
Mitsios N, etal., BMC Neurosci. 2007 Nov 12;8:93.
26.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
27.
Modulation of p21-activated kinase 1 alters the behavior of renal cell carcinoma.
O'Sullivan GC, etal., Int J Cancer. 2007 Nov 1;121(9):1930-40.
28.
A domain containing the Cdc42/Rac interactive binding (CRIB) region of p65PAK inhibits transcriptional activation and cell transformation mediated by the Ras-Rac pathway.
Osada S, etal., FEBS Lett 1997 Mar 10;404(2-3):227-33.
29.
YSK1, a novel mammalian protein kinase structurally related to Ste20 and SPS1, but is not involved in the known MAPK pathways.
Osada S, etal., Oncogene 1997 May 1;14(17):2047-57.
30.
The Shank family of postsynaptic density proteins interacts with and promotes synaptic accumulation of the beta PIX guanine nucleotide exchange factor for Rac1 and Cdc42.
Park E, etal., J Biol Chem. 2003 May 23;278(21):19220-9. Epub 2003 Mar 7.
31.
Dissecting activation of the PAK1 kinase at protrusions in living cells.
Parrini MC, etal., J Biol Chem. 2009 Sep 4;284(36):24133-43. doi: 10.1074/jbc.M109.015271. Epub 2009 Jul 1.
32.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
33.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
34.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
35.
GOA pipeline
RGD automated data pipeline
36.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
37.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
38.
Abnormalities of the Duo/Ras-related C3 botulinum toxin substrate 1/p21-activated kinase 1 pathway drive myosin light chain phosphorylation in frontal cortex in schizophrenia.
Rubio MD, etal., Biol Psychiatry. 2012 May 15;71(10):906-14. doi: 10.1016/j.biopsych.2012.02.006. Epub 2012 Mar 27.
39.
Synapsin I is phosphorylated at Ser603 by p21-activated kinases (PAKs) in vitro and in PC12 cells stimulated with bradykinin.
Sakurada K, etal., J Biol Chem 2002 Nov 22;277(47):45473-9.
40.
Rho GTPases in insulin-stimulated glucose uptake.
Satoh T Small GTPases. 2014;5:e28102. doi: 10.4161/sgtp.28102. Epub 2014 Mar 10.
41.
Lysophosphatidic acid stimulates p21-activated kinase in vascular smooth muscle cells.
Schmitz U, etal., Biochem Biophys Res Commun. 2002 Mar 1;291(3):687-91.
42.
Hypoxia and hypoxia/reoxygenation activate p65PAK, p38 mitogen-activated protein kinase (MAPK), and stress-activated protein kinase (SAPK) in cultured rat cardiac myocytes.
Seko Y, etal., Biochem Biophys Res Commun. 1997 Oct 29;239(3):840-4.
43.
Deleted in colorectal cancer binding netrin-1 mediates cell substrate adhesion and recruits Cdc42, Rac1, Pak1, and N-WASP into an intracellular signaling complex that promotes growth cone expansion.
Shekarabi M, etal., J Neurosci. 2005 Mar 23;25(12):3132-41.
44.
Adhesion stimulates direct PAK1/ERK2 association and leads to ERK-dependent PAK1 Thr212 phosphorylation.
Sundberg-Smith LJ, etal., J Biol Chem. 2005 Jan 21;280(3):2055-64. Epub 2004 Nov 12.
45.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
46.
Conversion of a signal into forces for axon outgrowth through Pak1-mediated shootin1 phosphorylation.
Toriyama M, etal., Curr Biol. 2013 Mar 18;23(6):529-34. doi: 10.1016/j.cub.2013.02.017. Epub 2013 Feb 28.
47.
Insulin activates a p21-activated kinase in muscle cells via phosphatidylinositol 3-kinase.
Tsakiridis T, etal., J Biol Chem. 1996 Aug 16;271(33):19664-7.
48.
Signaling of the p21-activated kinase (PAK1) coordinates insulin-stimulated actin remodeling and glucose uptake in skeletal muscle cells.
Tunduguru R, etal., Biochem Pharmacol. 2014 Nov 15;92(2):380-8. doi: 10.1016/j.bcp.2014.08.033. Epub 2014 Sep 6.
49.
A role for Gab1/SHP2 in thrombin activation of PAK1: gene transfer of kinase-dead PAK1 inhibits injury-induced restenosis.
Wang D, etal., Circ Res. 2009 May 8;104(9):1066-75. doi: 10.1161/CIRCRESAHA.109.196691. Epub 2009 Apr 9.
50.
Rat thy-1 antigens from thymus and brain: their tissue distribution, purification, and chemical composition.
Williams AF, etal., Cold Spring Harb Symp Quant Biol 1977;41 Pt 1:51-61.
51.
Zhonghua zhong liu za zhi [Chinese journal of oncology]
Xie D, etal., Zhonghua Zhong Liu Za Zhi. 2006 Dec;28(12):911-4.
52.
MicroRNA-494 inhibits breast cancer progression by directly targeting PAK1.
Zhan MN, etal., Cell Death Dis. 2017 Jan 5;8(1):e2529. doi: 10.1038/cddis.2016.440.
53.
Genomewide analysis of DNA methylation in rat lungs with lipopolysaccharideinduced acute lung injury.
Zhang XQ, etal., Mol Med Rep. 2013 May;7(5):1417-24. doi: 10.3892/mmr.2013.1405. Epub 2013 Mar 28.
54.
[The clinico-pathological significance of protein expression of PAK1 in bladder transitional cell carcinoma]
Zhang YH, etal., Zhonghua Yi Xue Za Zhi. 2007 Oct 16;87(38):2710-3.
55.
Neuroimmune modulation following traumatic stress in rats: evidence for an immunoregulatory cascade mediated by c-Src, miRNA222 and PAK1.
Zhao H, etal., J Neuroinflammation. 2011 Nov 14;8:159. doi: 10.1186/1742-2094-8-159.
Pak1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 161,522,399 - 161,637,623 (+) NCBI GRCr8 mRatBN7.2 1 152,111,172 - 152,226,390 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 152,111,188 - 152,226,383 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 160,098,178 - 160,212,347 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 167,278,365 - 167,392,536 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 160,151,847 - 160,266,019 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 162,768,156 - 162,883,356 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 162,768,156 - 162,883,355 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 168,974,734 - 169,090,326 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 155,057,622 - 155,174,714 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 155,136,027 - 155,253,120 (+) NCBI Celera 1 150,203,043 - 150,317,598 (+) NCBI Celera Cytogenetic Map 1 q32 NCBI
PAK1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 77,322,017 - 77,530,009 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 77,322,017 - 77,474,635 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 77,033,062 - 77,185,139 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 76,710,708 - 76,862,581 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 76,710,708 - 76,862,581 NCBI Celera 11 74,340,698 - 74,492,467 (-) NCBI Celera Cytogenetic Map 11 q13.5-q14.1 NCBI HuRef 11 73,331,052 - 73,483,383 (-) NCBI HuRef CHM1_1 11 76,916,194 - 77,068,127 (-) NCBI CHM1_1 T2T-CHM13v2.0 11 77,254,590 - 77,463,028 (-) NCBI T2T-CHM13v2.0
Pak1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 97,437,748 - 97,561,588 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 97,437,748 - 97,561,588 (+) Ensembl GRCm39 Ensembl GRCm38 7 97,788,541 - 97,912,381 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 97,788,541 - 97,912,381 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 104,991,449 - 105,060,891 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 97,718,162 - 97,786,524 (+) NCBI MGSCv36 mm8 Celera 7 98,163,397 - 98,233,432 (+) NCBI Celera Cytogenetic Map 7 E1 NCBI cM Map 7 53.57 NCBI
Pak1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955414 14,365,157 - 14,450,611 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955414 14,365,325 - 14,447,470 (+) NCBI ChiLan1.0 ChiLan1.0
PAK1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 78,241,183 - 78,393,005 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 79,289,592 - 79,441,441 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 72,372,577 - 72,524,817 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 76,014,744 - 76,166,503 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 76,015,998 - 76,104,197 (-) Ensembl panpan1.1 panPan2
PAK1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 21 21,341,530 - 21,409,535 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 21 21,265,484 - 21,408,416 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 21 21,157,810 - 21,301,590 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 21 21,465,428 - 21,609,203 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 21 21,463,819 - 21,609,213 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 21 21,241,163 - 21,385,037 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 21 21,457,239 - 21,600,991 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 21 21,380,679 - 21,525,504 (+) NCBI UU_Cfam_GSD_1.0
Pak1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 64,401,523 - 64,536,045 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936498 6,001,014 - 6,086,614 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936498 6,001,126 - 6,135,663 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PAK1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 11,830,095 - 12,020,415 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 11,830,095 - 11,973,074 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 12,979,543 - 13,123,587 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PAK1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 1 68,530,037 - 68,679,413 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 1 68,529,571 - 68,617,092 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666043 57,091,179 - 57,240,461 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Pak1
.
Predicted Target Of
Count of predictions: 53 Count of miRNA genes: 51 Interacting mature miRNAs: 53 Transcripts: ENSRNOT00000049321 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
61442 Strs1 Sensitivity to stroke QTL 1 7.4 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 1 121767634 166767634 Rat 1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 49393172 159356837 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 1598866 Bp287 Blood pressure QTL 287 5.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 121006655 166006655 Rat 1578770 Stresp23 Stress response QTL 23 kidney sympathetic nerve activity (VT:0004050) stimulated renal sympathetic nerve activity to basal renal sympathetic nerve activity ratio (CMO:0001786) 1 123350408 182418476 Rat 70160 Bw18 Body weight QTL 18 5.7 body mass (VT:0001259) body weight (CMO:0000012) 1 144267353 196383668 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 631199 Cm23 Cardiac mass QTL 23 4.6 0.0004 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 115585465 172949803 Rat 1354636 Lmblg1 Limb length QTL 1 6.4 tibia length (VT:0004357) tibia length (CMO:0000450) 1 151162512 201278233 Rat 1598850 Bp297 Blood pressure QTL 297 2.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 121006655 166006655 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1598853 Memor3 Memory QTL 3 4.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 1 143506580 212458660 Rat 1354634 Kidm12 Kidney mass QTL 12 3.9 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 1 151162512 201278233 Rat 152025232 Bw192 Body weight QTL 192 3.93 body mass (VT:0001259) 1 117917486 196963478 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 61343 Bp28 Blood pressure QTL 28 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 151646613 196646613 Rat 724521 Uae1 Urinary albumin excretion QTL 1 3.8 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 90508614 173018436 Rat 1358902 Bw47 Body weight QTL 47 1.67 body mass (VT:0001259) body weight (CMO:0000012) 1 90508614 180359386 Rat 61348 Bp30 Blood pressure QTL 30 2.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 144017057 197814409 Rat 8655649 Arrd1 Age-related retinal degeneration QTL 1 4.89 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 100357752 183970443 Rat 7771612 Cm80 Cardiac mass QTL 80 8.4 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 1 149448574 221264292 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 631202 Gluco13 Glucose level QTL 13 0.0001 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 131763437 159756369 Rat 631205 Bp196 Blood pressure QTL 196 4 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118944897 199050459 Rat 1300158 Bp173 Blood pressure QTL 173 3.48 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 1 115540693 185145286 Rat 631206 Niddm40 Non-insulin dependent diabetes mellitus QTL 40 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 136745990 163747690 Rat 737828 Hcas3 Hepatocarcinoma susceptibility QTL 3 4.9 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 1 144267353 222987745 Rat 1331749 Hrtrt11 Heart rate QTL 11 2.973 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 94494440 198211706 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1358886 Bp260 Blood pressure QTL 260 3.67 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 151162766 225824951 Rat 1331751 Bp199 Blood pressure QTL 199 3.60022 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 94494440 181830018 Rat 9685799 Bp375 Blood pressure QTL 375 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 170611501 Rat 2293140 Bp313 Blood pressure QTL 313 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 121833674 166833674 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 9685802 Bp376 Blood pressure QTL 376 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 126540680 171540680 Rat 1641895 Bp298 Blood pressure QTL 298 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 123350408 182418476 Rat 70209 Niddm23 Non-insulin dependent diabetes mellitus QTL 23 2.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 94494440 198324465 Rat 634315 Niddm45 Non-insulin dependent diabetes mellitus QTL 45 7.16 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 144267916 172949660 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 61379 Bp44 Blood pressure QTL 44 19.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 144267916 174133260 Rat 1331793 Bp200 Blood pressure QTL 200 3.71601 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94494440 172949803 Rat 2313060 Bss71 Bone structure and strength QTL 71 2.6 0.0001 long bone metaphysis morphology trait (VT:0000133) tibia midshaft total cross-sectional area (CMO:0001715) 1 118944747 163944747 Rat 6893347 Bw98 Body weight QTL 98 0.2 0.53 body mass (VT:0001259) body weight (CMO:0000012) 1 133680936 178680936 Rat 1354591 Cm36 Cardiac mass QTL 36 4.1 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 102813953 201278233 Rat 724550 Thym3 Thymus enlargement QTL 3 7.82 0.001 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 136829932 181829932 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 71118 Thym1 Thymus enlargement QTL 1 10.17 0.001 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 136829932 181829932 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 631519 Pia11 Pristane induced arthritis QTL 11 5.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 1 136830018 181830018 Rat 6893361 Bw104 Body weight QTL 104 0.59 0.27 body mass (VT:0001259) body weight (CMO:0000012) 1 133680936 178680936 Rat 738006 Anxrr14 Anxiety related response QTL 14 4 0.00035 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 130636910 175636910 Rat 1558645 Bw55 Body weight QTL 55 3.2 0.004 body mass (VT:0001259) body weight (CMO:0000012) 1 133680936 178680936 Rat 1354615 Cm32 Cardiac mass QTL 32 5.2 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 102813953 201278233 Rat 634348 Bp138 Blood pressure QTL 138 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 168883176 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 738028 Anxrr12 Anxiety related response QTL 12 4.9 0.00001 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 130636910 175636910 Rat 1354620 Kidm19 Kidney mass QTL 19 4 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 201278233 Rat 8693608 Alc24 Alcohol consumption QTL 24 2.3 0.74 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 1 150452391 168228760 Rat 631654 Bp107 Blood pressure QTL 107 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 170611501 Rat 631544 Bp84 Blood pressure QTL 84 5.6 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350408 181759564 Rat 152025212 Bw190 Body weight QTL 190 5.7 body mass (VT:0001259) 1 123556856 196963478 Rat 631549 Bp89 Blood pressure QTL 89 5.7 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350581 201284552 Rat 1358189 Cstrr1 Cold stress response QTL 1 0.0001 catecholamine amount (VT:0010543) urine norepinephrine level (CMO:0001629) 1 123350408 182418476 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat 1354602 Bw35 Body weight QTL 35 12.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 201278233 Rat
AI072234
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 1 251,733,586 - 251,733,790 (+) Marker Load Pipeline mRatBN7.2 1 152,225,115 - 152,225,321 (+) MAPPER mRatBN7.2 Rnor_6.0 1 162,882,082 - 162,882,287 NCBI Rnor6.0 Rnor_5.0 1 169,089,052 - 169,089,257 UniSTS Rnor5.0 RGSC_v3.4 1 155,174,111 - 155,174,316 UniSTS RGSC3.4 Celera 1 150,316,995 - 150,317,200 UniSTS RH 3.4 Map 1 1166.1 UniSTS Cytogenetic Map 1 q32 UniSTS
PMC140666P2
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 152,203,571 - 152,203,651 (+) MAPPER mRatBN7.2 Rnor_6.0 1 162,860,538 - 162,860,617 NCBI Rnor6.0 Rnor_5.0 1 169,067,508 - 169,067,587 UniSTS Rnor5.0 RGSC_v3.4 1 155,152,567 - 155,152,646 UniSTS RGSC3.4 Celera 1 150,295,462 - 150,295,541 UniSTS Cytogenetic Map 1 q32 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000049321 ⟹ ENSRNOP00000045832
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 152,111,188 - 152,226,383 (+) Ensembl Rnor_6.0 Ensembl 1 162,768,156 - 162,882,685 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000091952 ⟹ ENSRNOP00000073036
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 152,111,188 - 152,226,383 (+) Ensembl Rnor_6.0 Ensembl 1 162,817,611 - 162,883,355 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000104124 ⟹ ENSRNOP00000085225
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 152,111,762 - 152,225,269 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000108538 ⟹ ENSRNOP00000095378
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 152,111,188 - 152,226,383 (+) Ensembl
RefSeq Acc Id:
NM_017198 ⟹ NP_058894
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 161,522,450 - 161,636,952 (+) NCBI mRatBN7.2 1 152,111,210 - 152,225,719 (+) NCBI Rnor_6.0 1 162,768,156 - 162,882,685 (+) NCBI Rnor_5.0 1 168,974,734 - 169,090,326 (+) NCBI RGSC_v3.4 1 155,057,622 - 155,174,714 (+) RGD Celera 1 150,203,043 - 150,317,598 (+) RGD
Sequence:
CCCGGGCGGAAGGTACCGCCGCACGGTGGGCGCTCCTCACCGCTTCCCCACACCTCCCAGTCCCACTGCACCTCTAGGCTGCGCGGAGTCCTCTCGGCTATTACCGGCTCTTTGGAGCCGCCTGTGCC
hide sequence
RefSeq Acc Id:
XM_006229752 ⟹ XP_006229814
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 161,571,780 - 161,637,623 (+) NCBI mRatBN7.2 1 152,160,621 - 152,226,390 (+) NCBI Rnor_6.0 1 162,817,582 - 162,883,356 (+) NCBI Rnor_5.0 1 168,974,734 - 169,090,326 (+) NCBI
Sequence:
TTCACTGAGCTTCTGTGTCTTTGCTGCCGCCCTATGTGGGCCTGAGTGTGCTGCGCCTCAGGAACTGGGTGGCTGCGCTTCAGCGCTTAGCCGAATCCAGCCTGTCAGGCTGGTTCAGCCCGGGCTTT
hide sequence
RefSeq Acc Id:
XM_006229753 ⟹ XP_006229815
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 161,571,848 - 161,637,623 (+) NCBI mRatBN7.2 1 152,160,620 - 152,226,390 (+) NCBI Rnor_6.0 1 162,817,582 - 162,883,356 (+) NCBI Rnor_5.0 1 168,974,734 - 169,090,326 (+) NCBI
Sequence:
TTCACTGAGCTTCTGTGTCTTTGCTGCCGCCCTATGTGGGCCTGAGTGTGCTGCGCCTCAGGAACTGGGTGGCTGCGCTTCAGCGCTTAGCCGAATCCAGCCTGTCAGGCTGGTTCAGCCCGGGCTTT
hide sequence
RefSeq Acc Id:
XM_006229754 ⟹ XP_006229816
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 161,554,535 - 161,637,623 (+) NCBI mRatBN7.2 1 152,143,335 - 152,226,390 (+) NCBI Rnor_6.0 1 162,800,097 - 162,883,356 (+) NCBI Rnor_5.0 1 168,974,734 - 169,090,326 (+) NCBI
Sequence:
AAATACTTGATAAATATCCGTATGTGTTGGTTGGTCACTCTCTAAAGCCCATTCTCCATGTTTTCTCTCACTAAGATACCCACAGTCATTCTTTCTCTTCAAAGCTACTTCCTGGGGAGAAAGTCCAA
hide sequence
RefSeq Acc Id:
XM_039109396 ⟹ XP_038965324
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 161,522,412 - 161,637,623 (+) NCBI mRatBN7.2 1 152,111,172 - 152,226,390 (+) NCBI
RefSeq Acc Id:
XM_063287516 ⟹ XP_063143586
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 161,522,399 - 161,637,623 (+) NCBI
RefSeq Acc Id:
XM_063287517 ⟹ XP_063143587
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 161,522,412 - 161,637,623 (+) NCBI
RefSeq Acc Id:
XM_063287520 ⟹ XP_063143590
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 161,554,565 - 161,637,623 (+) NCBI
RefSeq Acc Id:
XM_063287524 ⟹ XP_063143594
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 161,554,565 - 161,637,623 (+) NCBI
RefSeq Acc Id:
NP_058894 ⟸ NM_017198
- UniProtKB:
Q62934 (UniProtKB/Swiss-Prot), P35465 (UniProtKB/Swiss-Prot), A6I6C0 (UniProtKB/TrEMBL), A0A8L2QLX9 (UniProtKB/TrEMBL)
- Sequence:
MSNNGLDVQDKPPAPPMRNTSTMIGAGSKDPGTLNHGSKPLPPNPEEKKKKDRFYRSILAGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVL
hide sequence
RefSeq Acc Id:
XP_006229816 ⟸ XM_006229754
- Peptide Label:
isoform X1
- UniProtKB:
Q62934 (UniProtKB/Swiss-Prot), P35465 (UniProtKB/Swiss-Prot), A6I6C0 (UniProtKB/TrEMBL), A0A8L2QLX9 (UniProtKB/TrEMBL)
- Sequence:
MSNNGLDVQDKPPAPPMRNTSTMIGAGSKDPGTLNHGSKPLPPNPEEKKKKDRFYRSILAGDKT
hide sequence
RefSeq Acc Id:
XP_006229814 ⟸ XM_006229752
- Peptide Label:
isoform X1
- UniProtKB:
Q62934 (UniProtKB/Swiss-Prot), P35465 (UniProtKB/Swiss-Prot), A6I6C0 (UniProtKB/TrEMBL), A0A8L2QLX9 (UniProtKB/TrEMBL)
- Sequence:
MSNNGLDVQDKPPAPPMRNTSTMIGAGSKDPGTLNHGSKPLPPNPEEKKKKDRFYRSILAGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVL
hide sequence
RefSeq Acc Id:
XP_006229815 ⟸ XM_006229753
- Peptide Label:
isoform X1
- UniProtKB:
Q62934 (UniProtKB/Swiss-Prot), P35465 (UniProtKB/Swiss-Prot), A6I6C0 (UniProtKB/TrEMBL), A0A8L2QLX9 (UniProtKB/TrEMBL)
- Sequence:
MSNNGLDVQDKPPAPPMRNTSTMIGAGSKDPGTLNHGSKPLPPNPEEKKKKDRFYRSILAGDKT
hide sequence
Ensembl Acc Id:
ENSRNOP00000045832 ⟸ ENSRNOT00000049321
Ensembl Acc Id:
ENSRNOP00000073036 ⟸ ENSRNOT00000091952
RefSeq Acc Id:
XP_038965324 ⟸ XM_039109396
- Peptide Label:
isoform X1
- UniProtKB:
P35465 (UniProtKB/Swiss-Prot), Q62934 (UniProtKB/Swiss-Prot), A6I6C0 (UniProtKB/TrEMBL), A0A8L2QLX9 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000085225 ⟸ ENSRNOT00000104124
Ensembl Acc Id:
ENSRNOP00000095378 ⟸ ENSRNOT00000108538
RefSeq Acc Id:
XP_063143586 ⟸ XM_063287516
- Peptide Label:
isoform X1
- UniProtKB:
Q62934 (UniProtKB/Swiss-Prot), P35465 (UniProtKB/Swiss-Prot), A6I6C0 (UniProtKB/TrEMBL), A0A8L2QLX9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063143587 ⟸ XM_063287517
- Peptide Label:
isoform X1
- UniProtKB:
Q62934 (UniProtKB/Swiss-Prot), P35465 (UniProtKB/Swiss-Prot), A6I6C0 (UniProtKB/TrEMBL), A0A8L2QLX9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063143590 ⟸ XM_063287520
- Peptide Label:
isoform X1
- UniProtKB:
Q62934 (UniProtKB/Swiss-Prot), P35465 (UniProtKB/Swiss-Prot), A6I6C0 (UniProtKB/TrEMBL), A0A8L2QLX9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063143594 ⟸ XM_063287524
- Peptide Label:
isoform X1
- UniProtKB:
Q62934 (UniProtKB/Swiss-Prot), P35465 (UniProtKB/Swiss-Prot), A6I6C0 (UniProtKB/TrEMBL), A0A8L2QLX9 (UniProtKB/TrEMBL)
RGD ID: 13690212 Promoter ID: EPDNEW_R737 Type: initiation region Name: Pak1_1 Description: p21 activated kinase 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R738 EPDNEW_R739 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 162,768,136 - 162,768,196 EPDNEW
RGD ID: 13690213 Promoter ID: EPDNEW_R738 Type: initiation region Name: Pak1_3 Description: p21 activated kinase 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R737 EPDNEW_R739 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 162,768,405 - 162,768,465 EPDNEW
RGD ID: 13690219 Promoter ID: EPDNEW_R739 Type: initiation region Name: Pak1_2 Description: p21 activated kinase 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R737 EPDNEW_R738 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 162,817,625 - 162,817,685 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-05-12
Pak1
p21 (RAC1) activated kinase 1
Pak1
p21 protein (Cdc42/Rac)-activated kinase 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2009-05-27
Pak1
p21 protein (Cdc42/Rac)-activated kinase 1
Pak1
p21 (CDKN1A)-activated kinase 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Pak1
p21 (CDKN1A)-activated kinase 1
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_function
phosphorylates protein serine/threonine residues
61685
gene_function
phosphorylates protein serine/threonine residues
70317
gene_product
mitogen activated protein kinase kinase kinase family member
61685
gene_product
mitogen activated protein kinase kinase kinase family member
70317
gene_protein
67 kDa
61685
gene_protein
67 kDa
70317
gene_regulation
activated by receptor tyrosine kinases and trimeric G protein-linked receptors
70317
