Symbol:
Nras
Name:
NRAS proto-oncogene, GTPase
RGD ID:
3205
Description:
Predicted to enable GDP binding activity; GTP binding activity; and GTPase activity. Involved in myoblast differentiation. Predicted to be located in Golgi apparatus and membrane. Predicted to be active in plasma membrane. Human ortholog(s) of this gene implicated in several diseases, including Noonan syndrome 6; autoimmune lymphoproliferative syndrome type 4; endocrine gland cancer (multiple); hematologic cancer (multiple); and reproductive organ cancer (multiple). Orthologous to human NRAS (NRAS proto-oncogene, GTPase); PARTICIPATES IN ephrin - ephrin receptor bidirectional signaling axis; epidermal growth factor/neuregulin signaling pathway; Fc epsilon receptor mediated signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 2,6-di-tert-butyl-4-methylphenol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
GTPase NRas; neuroblastoma ras oncogene; neuroblastoma RAS viral (v-ras) oncogene homolog; neuroblastoma RAS viral oncogene homolog; transforming protein N-Ras
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
NRAS (NRAS proto-oncogene, GTPase) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Nras (neuroblastoma ras oncogene) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Nras (NRAS proto-oncogene, GTPase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
NRAS (NRAS proto-oncogene, GTPase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
NRAS (NRAS proto-oncogene, GTPase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Nras (NRAS proto-oncogene, GTPase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
NRAS (NRAS proto-oncogene, GTPase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
NRAS (NRAS proto-oncogene, GTPase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Nras (NRAS proto-oncogene, GTPase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
HRAS (HRas proto-oncogene, GTPase) HGNC
OrthoDB
Alliance orthologs 3
Mus musculus (house mouse):
Nras (neuroblastoma ras oncogene)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
NRAS (NRAS proto-oncogene, GTPase)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
nras (NRAS proto-oncogene, GTPase)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Ras85D
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
let-60
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
nras
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Related Pseudogenes:
Nras-ps1
Allele / Splice:
Nras-ps1
Candidate Gene For:
Cia10
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 193,271,399 - 193,282,023 (+) NCBI GRCr8 mRatBN7.2 2 190,582,885 - 190,593,509 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 190,582,918 - 190,591,626 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 198,180,438 - 198,188,074 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 196,052,865 - 196,060,501 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 190,870,131 - 190,877,767 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 205,553,119 - 205,563,716 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 205,553,163 - 205,560,791 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 224,983,707 - 224,994,303 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 198,292,650 - 198,300,286 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 198,255,369 - 198,265,062 (+) NCBI Celera 2 183,056,304 - 183,063,940 (+) NCBI Celera Cytogenetic Map 2 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Nras Rat 1,2-dichloroethane decreases expression ISO Nras (Mus musculus) 6480464 ethylene dichloride results in decreased expression of NRAS mRNA CTD PMID:28960355 Nras Rat 1,2-dimethylhydrazine multiple interactions ISO Nras (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of NRAS mRNA CTD PMID:22206623 Nras Rat 1,2-dimethylhydrazine decreases expression ISO Nras (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of NRAS mRNA CTD PMID:22206623 Nras Rat 17beta-estradiol multiple interactions ISO NRAS (Homo sapiens) 6480464 IGF1R mutant form inhibits the reaction [Estradiol results in increased expression of NRAS mRNA] CTD PMID:23094148 Nras Rat 17beta-estradiol increases expression ISO NRAS (Homo sapiens) 6480464 Estradiol results in increased expression of NRAS mRNA CTD PMID:23094148 Nras Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Nras (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of NRAS mRNA CTD PMID:21570461 Nras Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of NRAS mRNA CTD PMID:33387578 Nras Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Nras (Mus musculus) 6480464 [TIPARP gene mutant form results in increased susceptibility to Tetrachlorodibenzodioxin] which results in decreased expression of NRAS mRNA CTD PMID:25975270 Nras Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of NRAS mRNA CTD PMID:21346803 Nras Rat 2,6-di-tert-butyl-4-methylphenol increases activity EXP 6480464 Butylated Hydroxytoluene results in increased activity of NRAS CTD PMID:3040652 Nras Rat 2-nitrotoluene increases expression EXP 6480464 2-nitrotoluene results in increased expression of NRAS mRNA CTD PMID:16460773 Nras Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of NRAS mRNA CTD PMID:30047161 Nras Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of NRAS mRNA CTD PMID:30047161 Nras Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of NRAS mRNA CTD PMID:16483693 Nras Rat antimycin A decreases expression ISO NRAS (Homo sapiens) 6480464 Antimycin A results in decreased expression of NRAS mRNA CTD PMID:33512557 Nras Rat aristolochic acid A decreases expression ISO NRAS (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of NRAS mRNA CTD PMID:33212167 Nras Rat Aroclor 1254 decreases expression ISO Nras (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of NRAS mRNA CTD PMID:23650126 Nras Rat arsane increases expression ISO NRAS (Homo sapiens) 6480464 Arsenic results in increased expression of NRAS mRNA CTD PMID:19945496 Nras Rat arsenic atom increases expression ISO NRAS (Homo sapiens) 6480464 Arsenic results in increased expression of NRAS mRNA CTD PMID:19945496 Nras Rat benzo[a]pyrene diol epoxide I increases expression ISO NRAS (Homo sapiens) 6480464 7 more ... CTD PMID:18567617 Nras Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of NRAS mRNA CTD PMID:25181051 Nras Rat bromochloroacetic acid increases expression EXP 6480464 bromochloroacetic acid results in increased expression of NRAS mRNA CTD PMID:16460773 Nras Rat cadmium dichloride increases expression ISO NRAS (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of NRAS protein CTD PMID:23811327 Nras Rat cannabidiol multiple interactions ISO NRAS (Homo sapiens) 6480464 [Cannabidiol co-treated with moringin] results in decreased expression of NRAS mRNA CTD PMID:30096889 Nras Rat carbamazepine affects expression ISO NRAS (Homo sapiens) 6480464 Carbamazepine affects the expression of NRAS mRNA CTD PMID:24752500 Nras Rat carbon nanotube increases expression ISO NRAS (Homo sapiens) 6480464 Nanotubes and Carbon results in increased expression of NRAS mRNA CTD PMID:23634900 Nras Rat carbon nanotube increases expression ISO Nras (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Nras Rat carboplatin decreases expression EXP 6480464 Carboplatin results in decreased expression of NRAS mRNA CTD PMID:18172885 Nras Rat chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of NRAS mRNA CTD PMID:18668222 Nras Rat choline multiple interactions ISO Nras (Mus musculus) 6480464 Choline inhibits the reaction [Sodium Fluoride results in decreased expression of NRAS mRNA] CTD PMID:27664006 Nras Rat cobimetinib increases response to substance ISO NRAS (Homo sapiens) 6480464 NRAS protein mutant form results in increased susceptibility to cobimetinib CTD PMID:22084396 Nras Rat copper atom multiple interactions ISO NRAS (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of NRAS mRNA and [Disulfiram binds to Copper] which results in decreased expression of NRAS mRNA CTD PMID:24690739 and PMID:30911355 Nras Rat copper(0) multiple interactions ISO NRAS (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of NRAS mRNA and [Disulfiram binds to Copper] which results in decreased expression of NRAS mRNA CTD PMID:24690739 and PMID:30911355 Nras Rat copper(II) sulfate increases expression ISO NRAS (Homo sapiens) 6480464 Copper Sulfate results in increased expression of NRAS mRNA CTD PMID:19549813 Nras Rat crocidolite asbestos decreases expression ISO Nras (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of NRAS mRNA CTD PMID:29279043 Nras Rat cyclosporin A increases expression ISO NRAS (Homo sapiens) 6480464 Cyclosporine results in increased expression of NRAS mRNA CTD PMID:25562108 Nras Rat daunorubicin increases expression ISO NRAS (Homo sapiens) 6480464 Daunorubicin results in increased expression of NRAS mRNA CTD PMID:12656675 Nras Rat deguelin decreases expression ISO NRAS (Homo sapiens) 6480464 deguelin results in decreased expression of NRAS mRNA CTD PMID:33512557 Nras Rat deoxycholic acid multiple interactions ISO NRAS (Homo sapiens) 6480464 NRAS affects the reaction [Deoxycholic Acid results in increased expression of CEBPB] and NRAS affects the reaction [Deoxycholic Acid results in increased expression of PTGS2] CTD PMID:18444174 Nras Rat diclofenac affects expression ISO NRAS (Homo sapiens) 6480464 Diclofenac affects the expression of NRAS mRNA CTD PMID:24752500 Nras Rat dicrotophos decreases expression ISO NRAS (Homo sapiens) 6480464 dicrotophos results in decreased expression of NRAS mRNA CTD PMID:28302478 Nras Rat disulfiram multiple interactions ISO NRAS (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in decreased expression of NRAS mRNA CTD PMID:24690739 Nras Rat emamectin benzoate decreases expression ISO NRAS (Homo sapiens) 6480464 emamectin benzoate results in decreased expression of NRAS mRNA CTD PMID:38901726 Nras Rat ethanol affects splicing ISO Nras (Mus musculus) 6480464 Ethanol affects the splicing of NRAS mRNA CTD PMID:30319688 Nras Rat fenthion decreases expression ISO Nras (Mus musculus) 6480464 Fenthion results in decreased expression of NRAS mRNA CTD PMID:34813904 Nras Rat flavonoids increases expression EXP 6480464 Flavonoids results in increased expression of NRAS mRNA CTD PMID:18035473 Nras Rat folic acid multiple interactions ISO Nras (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of NRAS mRNA CTD PMID:22206623 Nras Rat folic acid decreases expression ISO Nras (Mus musculus) 6480464 Folic Acid results in decreased expression of NRAS mRNA CTD PMID:25629700 Nras Rat FR900359 increases phosphorylation ISO NRAS (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of NRAS protein CTD PMID:37730182 Nras Rat genistein increases expression ISO Nras (Mus musculus) 6480464 Genistein results in increased expression of NRAS mRNA CTD PMID:24967385 Nras Rat genistein increases expression EXP 6480464 Genistein results in increased expression of NRAS mRNA CTD PMID:21782745 Nras Rat genistein multiple interactions EXP 6480464 [Genistein co-treated with Methoxychlor] results in increased expression of NRAS mRNA CTD PMID:21782745 Nras Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of NRAS mRNA CTD PMID:33387578 Nras Rat glyphosate decreases expression ISO NRAS (Homo sapiens) 6480464 Glyphosate results in decreased expression of NRAS mRNA CTD PMID:31295307 Nras Rat hydrogen cyanide decreases expression ISO Nras (Mus musculus) 6480464 Hydrogen Cyanide results in decreased expression of NRAS mRNA CTD PMID:33914522 Nras Rat hydroquinone decreases expression ISO NRAS (Homo sapiens) 6480464 hydroquinone results in decreased expression of NRAS mRNA CTD PMID:26047893 Nras Rat ivermectin decreases expression ISO NRAS (Homo sapiens) 6480464 Ivermectin results in decreased expression of NRAS protein CTD PMID:32959892 Nras Rat L-744832 decreases prenylation ISO NRAS (Homo sapiens) 6480464 L 744832 results in decreased prenylation of NRAS protein CTD PMID:16156861 Nras Rat L-744832 multiple interactions ISO NRAS (Homo sapiens) 6480464 GGTI 2147 promotes the reaction [L 744832 results in decreased prenylation of NRAS protein] CTD PMID:16156861 Nras Rat lipopolysaccharide increases expression ISO Nras (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of NRAS mRNA CTD PMID:10975854 Nras Rat lovastatin decreases prenylation ISO NRAS (Homo sapiens) 6480464 Lovastatin results in decreased prenylation of NRAS protein CTD PMID:16156861 Nras Rat metformin multiple interactions ISO NRAS (Homo sapiens) 6480464 [Paclitaxel co-treated with Metformin] results in decreased expression of NRAS mRNA CTD PMID:29309887 Nras Rat methotrexate increases response to substance ISO NRAS (Homo sapiens) 6480464 NRAS gene mutant form results in increased susceptibility to Methotrexate CTD PMID:24688052 Nras Rat methoxychlor multiple interactions EXP 6480464 [Genistein co-treated with Methoxychlor] results in increased expression of NRAS mRNA CTD PMID:21782745 Nras Rat methoxychlor increases expression EXP 6480464 Methoxychlor results in increased expression of NRAS mRNA CTD PMID:21782745 Nras Rat methylparaben increases expression ISO NRAS (Homo sapiens) 6480464 methylparaben results in increased expression of NRAS mRNA CTD PMID:38568856 Nras Rat microcystin-LR increases expression ISO Nras (Mus musculus) 6480464 cyanoginosin LR results in increased expression of NRAS mRNA CTD PMID:17654400 Nras Rat microcystin-LR increases expression ISO NRAS (Homo sapiens) 6480464 cyanoginosin LR results in increased expression of NRAS mRNA and cyanoginosin LR results in increased expression of NRAS protein CTD PMID:28062358 Nras Rat mitomycin C decreases expression ISO NRAS (Homo sapiens) 6480464 Mitomycin results in decreased expression of NRAS protein CTD PMID:38642817 Nras Rat N-Nitrosodi-n-butylamine increases activity EXP 6480464 dibutylnitrosamine results in increased activity of NRAS CTD PMID:3040652 Nras Rat N-nitrosodiethylamine multiple interactions EXP 6480464 bicyclol inhibits the reaction [Diethylnitrosamine results in increased expression of NRAS mRNA] CTD PMID:17106253 Nras Rat N-nitrosodiethylamine increases expression ISO Nras (Mus musculus) 6480464 Diethylnitrosamine results in increased expression of NRAS mRNA CTD PMID:26464624 Nras Rat N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of NRAS mRNA CTD PMID:17106253 Nras Rat nickel atom increases expression ISO Nras (Mus musculus) 6480464 Nickel results in increased expression of NRAS mRNA CTD PMID:20053437 Nras Rat nickel atom increases expression ISO NRAS (Homo sapiens) 6480464 Nickel results in increased expression of NRAS mRNA CTD PMID:24768652 and PMID:25583101 Nras Rat nitrates multiple interactions ISO Nras (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of NRAS mRNA CTD PMID:35964746 Nras Rat ouabain decreases expression ISO NRAS (Homo sapiens) 6480464 Ouabain results in decreased expression of NRAS mRNA CTD PMID:28795476 Nras Rat ozone decreases expression ISO NRAS (Homo sapiens) 6480464 Ozone results in decreased expression of NRAS mRNA CTD PMID:23033980 Nras Rat paclitaxel multiple interactions ISO NRAS (Homo sapiens) 6480464 [Paclitaxel co-treated with Metformin] results in decreased expression of NRAS mRNA CTD PMID:29309887 Nras Rat paracetamol affects expression ISO Nras (Mus musculus) 6480464 Acetaminophen affects the expression of NRAS mRNA CTD PMID:17562736 Nras Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of NRAS mRNA CTD PMID:33387578 Nras Rat paracetamol decreases expression ISO NRAS (Homo sapiens) 6480464 Acetaminophen results in decreased expression of NRAS mRNA CTD PMID:21420995 Nras Rat pemetrexed increases response to substance ISO NRAS (Homo sapiens) 6480464 NRAS gene mutant form results in increased susceptibility to Pemetrexed CTD PMID:24688052 Nras Rat phenobarbital decreases expression EXP 6480464 Phenobarbital results in decreased expression of NRAS mRNA CTD PMID:19162173 Nras Rat phlorizin decreases expression ISO Nras (Mus musculus) 6480464 Phlorhizin results in decreased expression of NRAS mRNA CTD PMID:22538082 Nras Rat propiconazole decreases expression ISO Nras (Mus musculus) 6480464 propiconazole results in decreased expression of NRAS mRNA CTD PMID:21278054 Nras Rat quercetin decreases expression ISO NRAS (Homo sapiens) 6480464 Quercetin results in decreased expression of NRAS mRNA and Quercetin results in decreased expression of NRAS protein CTD PMID:10652438 and PMID:21308698 Nras Rat resveratrol increases expression ISO Nras (Mus musculus) 6480464 resveratrol results in increased expression of NRAS protein CTD PMID:25505154 Nras Rat resveratrol multiple interactions ISO NRAS (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of NRAS mRNA CTD PMID:23557933 Nras Rat SB 431542 multiple interactions ISO NRAS (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of NRAS protein CTD PMID:37664457 Nras Rat sodium arsenite decreases expression ISO NRAS (Homo sapiens) 6480464 sodium arsenite results in decreased expression of NRAS protein CTD PMID:24431212 Nras Rat sodium arsenite decreases expression ISO Nras (Mus musculus) 6480464 sodium arsenite results in decreased expression of NRAS mRNA CTD PMID:25270620 Nras Rat sodium arsenite increases expression ISO NRAS (Homo sapiens) 6480464 sodium arsenite results in increased expression of NRAS protein CTD PMID:24431212 Nras Rat sodium fluoride decreases expression ISO Nras (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of NRAS mRNA CTD PMID:27664006 Nras Rat sodium fluoride multiple interactions ISO Nras (Mus musculus) 6480464 Choline inhibits the reaction [Sodium Fluoride results in decreased expression of NRAS mRNA] CTD PMID:27664006 Nras Rat sorafenib decreases expression ISO NRAS (Homo sapiens) 6480464 sorafenib results in decreased expression of NRAS mRNA CTD PMID:26409325 Nras Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of NRAS mRNA CTD PMID:30047161 Nras Rat temozolomide decreases expression ISO NRAS (Homo sapiens) 6480464 Temozolomide results in decreased expression of NRAS mRNA CTD PMID:31758290 Nras Rat tetrachloromethane increases expression ISO Nras (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of NRAS mRNA CTD PMID:31919559 Nras Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of NRAS mRNA CTD PMID:34492290 Nras Rat trichloroethene increases expression ISO Nras (Mus musculus) 6480464 Trichloroethylene results in increased expression of NRAS mRNA CTD PMID:19448997 Nras Rat triphenyl phosphate affects expression ISO NRAS (Homo sapiens) 6480464 triphenyl phosphate affects the expression of NRAS mRNA CTD PMID:37042841 Nras Rat triptonide increases expression ISO Nras (Mus musculus) 6480464 triptonide results in increased expression of NRAS mRNA CTD PMID:33045310 Nras Rat valproic acid decreases methylation ISO NRAS (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of NRAS gene CTD PMID:29154799 Nras Rat valproic acid decreases expression ISO NRAS (Homo sapiens) 6480464 Valproic Acid results in decreased expression of NRAS mRNA CTD PMID:23179753 and PMID:27188386 Nras Rat valproic acid affects expression ISO NRAS (Homo sapiens) 6480464 Valproic Acid affects the expression of NRAS mRNA CTD PMID:25979313 Nras Rat vancomycin decreases expression ISO Nras (Mus musculus) 6480464 Vancomycin results in decreased expression of NRAS mRNA CTD PMID:18930951 Nras Rat vemurafenib affects response to substance ISO NRAS (Homo sapiens) 6480464 NRAS protein mutant form affects the susceptibility to vemurafenib CTD PMID:27222248 Nras Rat vemurafenib multiple interactions ISO NRAS (Homo sapiens) 6480464 [NRAS protein mutant form affects the susceptibility to vemurafenib] which results in increased expression of TNFRSF10B protein more ... CTD PMID:27222248 Nras Rat vitamin E decreases expression ISO NRAS (Homo sapiens) 6480464 Vitamin E results in decreased expression of NRAS mRNA CTD PMID:19244175
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2,6-di-tert-butyl-4-methylphenol (EXP) 2-nitrotoluene (EXP) 6-propyl-2-thiouracil (EXP) amitrole (EXP) ammonium chloride (EXP) antimycin A (ISO) aristolochic acid A (ISO) Aroclor 1254 (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene diol epoxide I (ISO) bisphenol A (EXP) bromochloroacetic acid (EXP) cadmium dichloride (ISO) cannabidiol (ISO) carbamazepine (ISO) carbon nanotube (ISO) carboplatin (EXP) chlorpyrifos (EXP) choline (ISO) cobimetinib (ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) crocidolite asbestos (ISO) cyclosporin A (ISO) daunorubicin (ISO) deguelin (ISO) deoxycholic acid (ISO) diclofenac (ISO) dicrotophos (ISO) disulfiram (ISO) emamectin benzoate (ISO) ethanol (ISO) fenthion (ISO) flavonoids (EXP) folic acid (ISO) FR900359 (ISO) genistein (EXP,ISO) gentamycin (EXP) glyphosate (ISO) hydrogen cyanide (ISO) hydroquinone (ISO) ivermectin (ISO) L-744832 (ISO) lipopolysaccharide (ISO) lovastatin (ISO) metformin (ISO) methotrexate (ISO) methoxychlor (EXP) methylparaben (ISO) microcystin-LR (ISO) mitomycin C (ISO) N-Nitrosodi-n-butylamine (EXP) N-nitrosodiethylamine (EXP,ISO) nickel atom (ISO) nitrates (ISO) ouabain (ISO) ozone (ISO) paclitaxel (ISO) paracetamol (EXP,ISO) pemetrexed (ISO) phenobarbital (EXP) phlorizin (ISO) propiconazole (ISO) quercetin (ISO) resveratrol (ISO) SB 431542 (ISO) sodium arsenite (ISO) sodium fluoride (ISO) sorafenib (ISO) sulfadimethoxine (EXP) temozolomide (ISO) tetrachloromethane (ISO) thioacetamide (EXP) trichloroethene (ISO) triphenyl phosphate (ISO) triptonide (ISO) valproic acid (ISO) vancomycin (ISO) vemurafenib (ISO) vitamin E (ISO)
1.
Tumour mutation status and sites of metastasis in patients with cutaneous melanoma.
Adler NR, etal., Br J Cancer. 2017 Sep 26;117(7):1026-1035. doi: 10.1038/bjc.2017.254. Epub 2017 Aug 8.
2.
Activation of RAS family genes in urothelial carcinoma.
Boulalas I, etal., J Urol. 2009 May;181(5):2312-9. Epub 2009 Mar 19.
3.
Somatic integration of an oncogene-harboring Sleeping Beauty transposon models liver tumor development in the mouse.
Carlson CM, etal., Proc Natl Acad Sci U S A. 2005 Nov 22;102(47):17059-64. doi: 10.1073/pnas.0502974102. Epub 2005 Nov 14.
4.
Comparison of liver oncogenic potential among human RAS isoforms.
Chung SI, etal., Oncotarget. 2016 Feb 9;7(6):7354-66. doi: 10.18632/oncotarget.6931.
5.
Neuroblastoma RAS Viral Oncogene Homolog (NRAS) Is a Novel Prognostic Marker and Contributes to Sorafenib Resistance in Hepatocellular Carcinoma.
Dietrich P, etal., Neoplasia. 2019 Mar;21(3):257-268. doi: 10.1016/j.neo.2018.11.011. Epub 2019 Jan 25.
6.
Clonal architectures and driver mutations in metastatic melanomas.
Ding L, etal., PLoS One. 2014 Nov 13;9(11):e111153. doi: 10.1371/journal.pone.0111153. eCollection 2014.
7.
NRAS mutations in de novo acute leukemia: prevalence and clinical significance.
Dunna NR, etal., Indian J Biochem Biophys. 2014 Jun;51(3):207-10.
8.
Metastatic Pattern of Stage IV Colorectal Cancer with High-Frequency Microsatellite Instability as a Prognostic Factor.
Fujiyoshi K, etal., Anticancer Res. 2017 Jan;37(1):239-247. doi: 10.21873/anticanres.11313.
9.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
10.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
11.
Mapping autoimmunity genes.
Griffiths MM, etal., Curr Opin Immunol. 1999 Dec;11(6):689-700.
12.
Identification of a new non-major histocompatibility complex genetic locus on chromosome 2 that controls disease severity in collagen-induced arthritis in rats.
Gulko PS, etal., Arthritis Rheum 1998 Dec;41(12):2122-31
13.
The inv(3)(q21q26)/t(3;3)(q21;q26) is frequently accompanied by alterations of the RUNX1, KRAS and NRAS and NF1 genes and mediates adverse prognosis both in MDS and in AML: a study in 39 cases of MDS or AML.
Haferlach C, etal., Leukemia. 2011 May;25(5):874-7. doi: 10.1038/leu.2011.5. Epub 2011 Feb 1.
14.
AKT (v-akt murine thymoma viral oncogene homolog 1) and N-Ras (neuroblastoma ras viral oncogene homolog) coactivation in the mouse liver promotes rapid carcinogenesis by way of mTOR (mammalian target of rapamycin complex 1), FOXM1 (forkhead box M1)/SKP2, and c-Myc pathways.
Ho C, etal., Hepatology. 2012 Mar;55(3):833-45. doi: 10.1002/hep.24736. Epub 2011 Dec 19.
15.
Expression of N-ras gene in human primary hepatocarcinoma.
Hu LF, etal., Sci Sin B. 1986 Feb;29(2):181-6.
16.
Detection of multiple gene amplifications in glioblastoma multiforme using array-based comparative genomic hybridization.
Hui AB, etal., Lab Invest. 2001 May;81(5):717-23.
17.
RAS oncogene suppression induces apoptosis followed by more differentiated and less myelosuppressive disease upon relapse of acute myeloid leukemia.
Kim WI, etal., Blood. 2009 Jan 29;113(5):1086-96. doi: 10.1182/blood-2008-01-132316. Epub 2008 Oct 24.
18.
Mutation analysis of the Ras pathway genes NRAS, HRAS, KRAS and BRAF in glioblastomas.
Knobbe CB, etal., Acta Neuropathol. 2004 Dec;108(6):467-70. doi: 10.1007/s00401-004-0929-9. Epub 2004 Oct 28.
19.
The ability of endogenous Nras oncogenes to initiate leukemia is codon-dependent.
Kong G, etal., Leukemia. 2016 Sep;30(9):1935-8. doi: 10.1038/leu.2016.89. Epub 2016 Apr 25.
20.
Cia5d regulates a new fibroblast-like synoviocyte invasion-associated gene expression signature.
Laragione T, etal., Arthritis Res Ther. 2008 Aug 15;10(4):R92.
21.
Differential expression of protooncogenes related to transformation and cancer progression in rat myoblasts.
Leibovitch SA, etal., Cancer Res. 1986 Aug;46(8):4097-103.
22.
Transcriptional activation of H- and N-ras oncogenes in human cervical cancer.
Mammas IN, etal., Gynecol Oncol. 2004 Mar;92(3):941-8.
23.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
24.
Mutation of NRAS but not KRAS significantly reduces myeloma sensitivity to single-agent bortezomib therapy.
Mulligan G, etal., Blood. 2014 Jan 30;123(5):632-9. doi: 10.1182/blood-2013-05-504340. Epub 2013 Dec 11.
25.
NRAS mutations with low allele burden have independent prognostic significance for patients with lower risk myelodysplastic syndromes.
Murphy DM, etal., Leukemia. 2013 Oct;27(10):2077-81. doi: 10.1038/leu.2013.160. Epub 2013 May 27.
26.
CD4+ T cells from patients with primary biliary cholangitis show T cell activation and differentially expressed T-cell receptor repertoires.
Nakagawa R, etal., Hepatol Res. 2019 Jun;49(6):653-662. doi: 10.1111/hepr.13318. Epub 2019 Feb 26.
27.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
28.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
29.
Loss of heterozygosity at the N-ras locus in 7,12-dimethylbenz anthracene-induced rat leukemia.
Osaka M, etal., Mol Carcinog. 1997 Apr;18(4):206-12.
30.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
31.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
32.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
33.
GOA pipeline
RGD automated data pipeline
34.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
35.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
36.
Comprehensive gene review and curation
RGD comprehensive gene curation
37.
MEK1/2 dual-specificity protein kinases: Structure and regulation.
Roskoski R Jr Biochem Biophys Res Commun. 2012 Jan 6;417(1):5-10. Epub 2011 Dec 8.
38.
An increase in N-Ras expression is associated with development of hormone refractory prostate cancer in a subset of patients.
Traynor P, etal., Dis Markers. 2008;24(3):157-65.
39.
Diabetes increases both N-ras and ets-1 expression during rat oral oncogenesis resulting in enhanced cell proliferation and metastatic potential.
Vairaktaris E, etal., In Vivo. 2007 Jul-Aug;21(4):615-21.
40.
The rat N-ras gene; interference of pseudogenes with the detection of activating point mutations.
van Kranen HJ, etal., Carcinogenesis 1994 Feb;15(2):307-11.
41.
Ras gene mutations in 7,12-dimethylbenzanthracene (DMBA)-induced rat sarcomas.
Walentinsson A and Levan G, Cancer Lett. 2001 May 10;166(1):47-53.
42.
Endogenous oncogenic Nras mutation initiates hematopoietic malignancies in a dose- and cell type-dependent manner.
Wang J, etal., Blood. 2011 Jul 14;118(2):368-79. doi: 10.1182/blood-2010-12-326058. Epub 2011 May 17.
43.
Localization in rats of genetic loci regulating susceptibility to experimental erosive arthritis and related autoimmune diseases.
Wilder RL, etal., Transplant Proc 1999 May;31(3):1585-8
44.
Regulator of G-protein signaling 14 (RGS14) is a selective H-Ras effector.
Willard FS, etal., PLoS One. 2009;4(3):e4884. doi: 10.1371/journal.pone.0004884. Epub 2009 Mar 25.
45.
Deficiency of beta Common Receptor Moderately Attenuates the Progression of Myeloproliferative Neoplasm in NrasG12D/+ Mice.
Zhang J, etal., J Biol Chem. 2015 Jul 31;290(31):19093-103. doi: 10.1074/jbc.M115.653154. Epub 2015 Jun 16.
Nras Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 193,271,399 - 193,282,023 (+) NCBI GRCr8 mRatBN7.2 2 190,582,885 - 190,593,509 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 190,582,918 - 190,591,626 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 198,180,438 - 198,188,074 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 196,052,865 - 196,060,501 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 190,870,131 - 190,877,767 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 205,553,119 - 205,563,716 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 205,553,163 - 205,560,791 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 224,983,707 - 224,994,303 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 198,292,650 - 198,300,286 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 198,255,369 - 198,265,062 (+) NCBI Celera 2 183,056,304 - 183,063,940 (+) NCBI Celera Cytogenetic Map 2 q34 NCBI
NRAS Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 114,704,469 - 114,716,771 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 114,704,469 - 114,716,771 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 115,247,090 - 115,259,392 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 115,051,108 - 115,061,038 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 114,961,626 - 114,971,557 NCBI Celera 1 113,476,335 - 113,488,757 (-) NCBI Celera Cytogenetic Map 1 p13.2 NCBI HuRef 1 113,105,559 - 113,117,974 (-) NCBI HuRef CHM1_1 1 115,361,892 - 115,374,317 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 114,715,929 - 114,728,216 (-) NCBI T2T-CHM13v2.0
Nras Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 102,965,643 - 102,975,230 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 102,965,601 - 102,975,230 (+) Ensembl GRCm39 Ensembl GRCm38 3 103,058,285 - 103,067,914 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 103,058,285 - 103,067,914 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 102,862,208 - 102,871,837 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 103,187,290 - 103,197,396 (+) NCBI MGSCv36 mm8 Celera 3 105,263,160 - 105,272,744 (+) NCBI Celera Cytogenetic Map 3 F2.2 NCBI cM Map 3 45.25 NCBI
Nras Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955435 18,001,517 - 18,009,103 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955435 18,001,517 - 18,009,105 (-) NCBI ChiLan1.0 ChiLan1.0
NRAS Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 107,366,720 - 107,378,995 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 106,960,899 - 106,973,178 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 87,837,146 - 87,850,013 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 122,890,505 - 122,903,585 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 122,890,505 - 122,903,585 (+) Ensembl panpan1.1 panPan2
NRAS Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 17 52,411,733 - 52,418,788 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 17 52,411,733 - 52,418,788 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 17 52,062,320 - 52,069,399 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 17 53,289,080 - 53,296,149 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 17 53,286,139 - 53,296,201 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 17 52,323,232 - 52,330,285 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 17 52,365,409 - 52,372,486 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 17 52,938,741 - 52,945,813 (-) NCBI UU_Cfam_GSD_1.0
Nras
NRAS Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 105,845,872 - 105,858,227 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 105,845,913 - 105,853,769 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 116,034,666 - 116,042,522 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
NRAS Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 18,953,273 - 18,966,002 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 18,953,883 - 18,961,931 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 21,707,389 - 21,720,123 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Nras
.
Assembly: RGSC_v3.4 Assembly: Rnor_5.0 Assembly: Rnor_6.0
Predicted Target Of
Count of predictions: 459 Count of miRNA genes: 217 Interacting mature miRNAs: 266 Transcripts: ENSRNOT00000039572 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1578648 Bss11 Bone structure and strength QTL 11 4.7 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 2 114837527 211674221 Rat 1358356 Srcrt1 Stress Responsive Cort QTL1 3.66 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 2 161699179 222436696 Rat 1331734 Bp204 Blood pressure QTL 204 3.61192 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 168358098 223265385 Rat 1298074 Bp164 Blood pressure QTL 164 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 1354648 Bp239 Blood pressure QTL 239 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118463 226797303 Rat 1354649 Kidm17 Kidney mass QTL 17 2.9 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 2 81754530 227146641 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 1298076 Bp166 Blood pressure QTL 166 0.0009 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 136445150 202447032 Rat 152025245 Scl81 Serum cholesterol level QTL 81 3.49 blood cholesterol amount (VT:0000180) 2 122609194 206936711 Rat 61458 Bp10 Blood pressure QTL 10 3.42 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 189020722 215287351 Rat 70162 Bp63 Blood pressure QTL 63 5.64 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 2 169745596 214745596 Rat 1554319 Bmd2 Bone mineral density QTL 2 13.4 0.0001 lumbar vertebra area (VT:0010570) lumbar vertebra cross-sectional area (CMO:0001689) 2 114837675 212549332 Rat 1581569 Uae32 Urinary albumin excretion QTL 32 0.0001 urine protein amount (VT:0005160) urine albumin excretion rate (CMO:0000757) 2 78665619 219826953 Rat 10043136 Iddm54 Insulin dependent diabetes mellitus QTL 54 3.4 0.0001 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 2 143657411 190602963 Rat 1302793 Bw16 Body weight QTL 16 5 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 2 157142209 202446871 Rat 61467 Bp14 Blood pressure QTL 14 2.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 43154682 202446871 Rat 61469 Bp16 Blood pressure QTL 16 5.64 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 2 169745596 214745596 Rat 70175 BpQTLCluster3 Blood pressure QTL cluster 3 4.128 arterial blood pressure trait (VT:2000000) absolute change in systolic blood pressure (CMO:0000607) 2 135552573 202446871 Rat 1358900 Bw48 Body weight QTL 48 4.88 body mass (VT:0001259) body weight (CMO:0000012) 2 157142078 211086598 Rat 4889834 Pur24 Proteinuria QTL 24 5.8 0.014 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 2 184114274 202447032 Rat 1359031 Bp275 Blood pressure QTL 275 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 185876309 219753474 Rat 1581499 Esta2 Estrogen-induced thymic atrophy QTL 2 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 2 189599258 226936289 Rat 1331760 Bp206 Blood pressure QTL 206 3.62454 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 56043031 202447032 Rat 9589044 Scfw1 Subcutaneous fat weight QTL 1 5.8 0.001 subcutaneous adipose mass (VT:1000472) abdominal subcutaneous fat pad weight (CMO:0002069) 2 182171407 227171407 Rat 8694435 Bw166 Body weight QTL 166 14.08 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 2 182171407 227171407 Rat 1359032 Hrtrt18 Heart rate QTL 18 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 2 157142078 192625452 Rat 2301966 Bp322 Blood pressure QTL 322 3.58 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 150540301 202447032 Rat 1298083 Bp158 Blood pressure QTL 158 2.62 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 189020722 215287351 Rat 1298080 Bp163 Blood pressure QTL 163 0.02 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118275 202447032 Rat 8662832 Vetf7 Vascular elastic tissue fragility QTL 7 3.5 aorta elastin amount (VT:0003905) aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002) 2 81689826 221035911 Rat 1331745 Bp203 Blood pressure QTL 203 4.377 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 189599258 218414891 Rat 1298085 Bp165 Blood pressure QTL 165 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 8694194 Abfw1 Abdominal fat weight QTL 1 11.7 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 2 182171407 227171407 Rat 61366 Iddm3 Insulin dependent diabetes mellitus QTL 3 4.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 189599258 234599258 Rat 1359022 Ppulsi1 Prepulse inhibition QTL 1 3.63 prepulse inhibition trait (VT:0003088) acoustic startle response measurement (CMO:0001519) 2 136916935 213594495 Rat 1641891 Alcrsp17 Alcohol response QTL 17 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 249053267 Rat 724534 Uae6 Urinary albumin excretion QTL 6 10 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 2 78665619 249053267 Rat 61374 Edpm2 Estrogen-dependent pituitary mass QTL 2 4.42 0.86 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 2 76539322 202447032 Rat 2300189 Bmd48 Bone mineral density QTL 48 5.8 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 2 179335906 224335906 Rat 8662843 Vetf9 Vascular elastic tissue fragility QTL 9 2.05 thoracic aorta molecular composition trait (VT:0010568) aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003) 2 157142078 226277316 Rat 631501 Bp101 Blood pressure QTL 101 2.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 150341684 202446871 Rat 2307174 Activ3 Activity QTL 3 4.83 0.000058 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 2 168594495 213594495 Rat 1331794 Bp202 Blood pressure QTL 202 3.66819 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 141194931 223265385 Rat 71113 Cari2 Carrageenan-induced inflammation QTL 2 2.7 0.009 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 2 141596551 202447032 Rat 1331805 Cm29 Cardiac mass QTL 29 3.50746 heart mass (VT:0007028) heart wet weight (CMO:0000069) 2 141194931 223265385 Rat 634308 Sach6 Saccharin preference QTL 6 4.9 taste sensitivity trait (VT:0001986) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 2 112456140 212696837 Rat 1358917 Cm42 Cardiac mass QTL 42 2.82 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 724568 Uae13 Urinary albumin excretion QTL 13 4.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 2 143157029 210020885 Rat 7488929 Bp366 Blood pressure QTL 366 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 184974550 193094998 Rat 1358913 Cm41 Cardiac mass QTL 41 2.73 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 1300165 Rf9 Renal function QTL 9 3.28 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 2 133914684 202447032 Rat 738013 Alc15 Alcohol consumption QTL 15 4.1 0.00022 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 2 184165752 229165752 Rat 61398 Bp50 Blood pressure QTL 50 4.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 189599258 234599258 Rat 631507 Bp105 Blood pressure QTL 105 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 112456140 212696837 Rat 1641925 Alcrsp2 Alcohol response QTL 2 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 221167075 Rat 1354609 Niddm62 Non-insulin dependent diabetes mellitus QTL 62 4.72 0.000006 insulin secretion trait (VT:0003564) plasma insulin level (CMO:0000342) 2 150540301 202447032 Rat 1598833 Bp295 Blood pressure QTL 295 3.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 147798556 192798556 Rat 61417 Cia10 Collagen induced arthritis QTL 10 3.4 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 2 179946951 224946951 Rat 1354622 Kidm16 Kidney mass QTL 16 3 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 2 81754530 222436696 Rat 631266 Bp132 Blood pressure QTL 132 0.0005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 46123260 202447032 Rat 8694383 Bw158 Body weight QTL 158 7.69 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 2 182171407 227171407 Rat 7488927 Bp365 Blood pressure QTL 365 0.008 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 162765032 207765032 Rat 1598838 Bp290 Blood pressure QTL 290 1.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 166539266 211539266 Rat 7488925 Bp364 Blood pressure QTL 364 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 160564068 205564068 Rat 2306901 Bp337 Blood pressure QTL 337 0.01 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 164073756 227146641 Rat 1354605 Rf48 Renal function QTL 48 2.9 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 2 74786664 206665859 Rat 2293084 Iddm26 Insulin dependent diabetes mellitus QTL 26 2.9 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 174930955 213594495 Rat
AA960392
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 190,582,442 - 190,582,731 (+) MAPPER mRatBN7.2 Rnor_6.0 2 205,552,650 - 205,552,938 NCBI Rnor6.0 Rnor_5.0 2 224,983,237 - 224,983,525 UniSTS Rnor5.0 RGSC_v3.4 2 198,292,137 - 198,292,425 UniSTS RGSC3.4 Celera 2 183,055,791 - 183,056,079 UniSTS Cytogenetic Map 2 q34 UniSTS
PMC316567P2
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 190,584,991 - 190,585,176 (+) MAPPER mRatBN7.2 Rnor_6.0 2 205,555,199 - 205,555,383 NCBI Rnor6.0 Rnor_5.0 2 224,985,786 - 224,985,970 UniSTS Rnor5.0 RGSC_v3.4 2 198,294,686 - 198,294,870 UniSTS RGSC3.4 Celera 2 183,058,340 - 183,058,524 UniSTS Cytogenetic Map 2 q34 UniSTS
PMC86690P2
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 190,584,992 - 190,585,137 (+) MAPPER mRatBN7.2 Rnor_6.0 2 205,555,200 - 205,555,344 NCBI Rnor6.0 Rnor_5.0 2 224,985,787 - 224,985,931 UniSTS Rnor5.0 RGSC_v3.4 2 198,294,687 - 198,294,831 UniSTS RGSC3.4 Celera 2 183,058,341 - 183,058,485 UniSTS Cytogenetic Map 2 q34 UniSTS
PMC86690P3
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 2 193,273,506 - 193,273,691 (+) Marker Load Pipeline mRatBN7.2 2 190,584,992 - 190,585,176 (+) MAPPER mRatBN7.2 Rnor_6.0 2 205,555,200 - 205,555,383 NCBI Rnor6.0 Rnor_5.0 2 224,985,787 - 224,985,970 UniSTS Rnor5.0 RGSC_v3.4 2 198,294,687 - 198,294,870 UniSTS RGSC3.4 Celera 2 183,058,341 - 183,058,524 UniSTS Cytogenetic Map 2 q34 UniSTS
PMC28413P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 190,583,526 - 190,583,641 (+) MAPPER mRatBN7.2 mRatBN7.2 X 116,761,789 - 116,761,904 (+) MAPPER mRatBN7.2 Rnor_6.0 2 205,553,734 - 205,553,848 NCBI Rnor6.0 Rnor_6.0 X 124,119,165 - 124,119,279 NCBI Rnor6.0 Rnor_5.0 2 224,984,321 - 224,984,435 UniSTS Rnor5.0 Rnor_5.0 X 124,205,407 - 124,205,521 UniSTS Rnor5.0 Cytogenetic Map 2 q34 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000039572 ⟹ ENSRNOP00000036381
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 190,583,518 - 190,591,112 (+) Ensembl Rnor_6.0 Ensembl 2 205,553,163 - 205,560,791 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000098182 ⟹ ENSRNOP00000078755
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 190,582,918 - 190,591,626 (+) Ensembl
RefSeq Acc Id:
NM_080766 ⟹ NP_542944
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 193,271,470 - 193,279,106 (+) NCBI mRatBN7.2 2 190,582,956 - 190,590,592 (+) NCBI Rnor_6.0 2 205,553,163 - 205,560,799 (+) NCBI Rnor_5.0 2 224,983,707 - 224,994,303 (+) NCBI RGSC_v3.4 2 198,292,650 - 198,300,286 (+) RGD Celera 2 183,056,304 - 183,063,940 (+) RGD
Sequence:
GCCGTTCATGGCGGTTTCGGGGTCTCCAACAGCTTCTCAGGTTGAAATCCAAAAGCCTCCCGAGGCGGGGTCTGCGGAGTTTGAGATTTTTGCAGGTGTGAAATGACTGAGTACAAACTGGTGGTGGT
hide sequence
RefSeq Acc Id:
XM_006233059 ⟹ XP_006233121
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 193,271,399 - 193,282,023 (+) NCBI mRatBN7.2 2 190,582,885 - 190,593,509 (+) NCBI Rnor_6.0 2 205,553,119 - 205,563,716 (+) NCBI Rnor_5.0 2 224,983,707 - 224,994,303 (+) NCBI
Sequence:
GATTACGTAGCGGGTGGGGCCGGAAGTGCCGCTCCCGGGTGGGGGCTGTTCATGGCGGTTTCGG
hide sequence
RefSeq Acc Id:
NP_542944 ⟸ NM_080766
- UniProtKB:
Q4KMB1 (UniProtKB/Swiss-Prot), Q04970 (UniProtKB/Swiss-Prot), A6K3K2 (UniProtKB/TrEMBL), A0A8L2QIP9 (UniProtKB/TrEMBL)
- Sequence:
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTK
hide sequence
RefSeq Acc Id:
XP_006233121 ⟸ XM_006233059
- Peptide Label:
isoform X1
- UniProtKB:
Q4KMB1 (UniProtKB/Swiss-Prot), Q04970 (UniProtKB/Swiss-Prot), A6K3K2 (UniProtKB/TrEMBL), A0A8L2QIP9 (UniProtKB/TrEMBL)
- Sequence:
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEY
hide sequence
Ensembl Acc Id:
ENSRNOP00000036381 ⟸ ENSRNOT00000039572
Ensembl Acc Id:
ENSRNOP00000078755 ⟸ ENSRNOT00000098182
RGD ID: 13691625 Promoter ID: EPDNEW_R2150 Type: multiple initiation site Name: Nras_1 Description: NRAS proto-oncogene, GTPase SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 2 205,553,146 - 205,553,206 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2017-03-29
Nras
NRAS proto-oncogene, GTPase
Nras
neuroblastoma RAS viral oncogene homolog
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2016-04-14
Nras
neuroblastoma RAS viral oncogene homolog
Nras
neuroblastoma RAS viral (v-ras) oncogene homolog
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2016-03-17
Nras
neuroblastoma RAS viral (v-ras) oncogene homolog
Nras
neuroblastoma ras oncogene
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-11-17
Nras
neuroblastoma ras oncogene
Name updated
1299863 APPROVED
2002-11-06
Nras
neuroblastoma RAS viral (v-ras) oncogene homolog
Neuroblastoma RAS viral (v-ras) oncogene homolog
Name updated
625702 APPROVED
2002-06-10
Nras
Neuroblastoma RAS viral (v-ras) oncogene homolog
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_disease
involved in the severity of collagen-induced arthritis
61063
