Symbol:
Mras
Name:
muscle RAS oncogene homolog
RGD ID:
3111
Description:
Predicted to enable GTP-dependent protein binding activity; GTPase activity; and guanyl ribonucleotide binding activity. Predicted to be involved in Ras protein signal transduction. Predicted to act upstream of or within cellular response to leukemia inhibitory factor. Predicted to be located in endomembrane system and membrane. Predicted to be part of protein phosphatase type 1 complex. Predicted to be active in plasma membrane. Human ortholog(s) of this gene implicated in Noonan syndrome 11. Orthologous to human MRAS (muscle RAS oncogene homolog); PARTICIPATES IN mitogen activated protein kinase signaling pathway; INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
muscle and microspikes RAS; ras-related protein M-Ras; ras-related protein R-Ras3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
MRAS (muscle RAS oncogene homolog) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Mras (muscle and microspikes RAS) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Mras (muscle RAS oncogene homolog) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
MRAS (muscle RAS oncogene homolog) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
MRAS (muscle RAS oncogene homolog) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Mras (muscle RAS oncogene homolog) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
MRAS (muscle RAS oncogene homolog) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
MRAS (muscle RAS oncogene homolog) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Mras (muscle RAS oncogene homolog) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Mras (muscle and microspikes RAS)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
MRAS (muscle RAS oncogene homolog)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
mras (muscle RAS oncogene homolog)
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
si:ch73-116o1.2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
ras-2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
mras
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 108,823,374 - 108,886,104 (-) NCBI GRCr8 mRatBN7.2 8 99,944,036 - 100,006,771 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 99,944,036 - 99,996,408 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 105,610,343 - 105,663,748 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 103,809,642 - 103,863,053 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 101,652,159 - 101,705,561 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 107,629,028 - 107,656,851 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 107,629,028 - 107,681,512 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 107,054,728 - 107,082,497 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 104,244,660 - 104,272,556 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 104,264,114 - 104,292,011 (-) NCBI Celera 8 99,345,811 - 99,373,539 (-) NCBI Celera Cytogenetic Map 8 q31 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Mras Rat 1,2-dimethylhydrazine affects expression ISO Mras (Mus musculus) 6480464 1 and 2-Dimethylhydrazine affects the expression of MRAS mRNA CTD PMID:22206623 Mras Rat 15-acetyldeoxynivalenol increases expression ISO MRAS (Homo sapiens) 6480464 15-acetyldeoxynivalenol results in increased expression of MRAS mRNA CTD PMID:23792671 Mras Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of MRAS mRNA CTD PMID:15212814 Mras Rat 17alpha-ethynylestradiol multiple interactions ISO Mras (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of MRAS mRNA CTD PMID:17942748 Mras Rat 17beta-estradiol multiple interactions ISO MRAS (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in increased expression of MRAS mRNA and [Estradiol co-treated with TGFB1 protein] results in increased expression of MRAS mRNA CTD PMID:20660070 and PMID:30165855 Mras Rat 2,2',5,5'-tetrachlorobiphenyl increases expression ISO MRAS (Homo sapiens) 6480464 2 more ... CTD PMID:21703328 Mras Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Mras (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of MRAS mRNA CTD PMID:19933214 Mras Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of MRAS mRNA CTD PMID:34747641 Mras Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of MRAS mRNA CTD PMID:27913140 Mras Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Mras (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of MRAS mRNA CTD PMID:21570461 Mras Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO MRAS (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of MRAS mRNA CTD PMID:20106945 and PMID:21632981 Mras Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Mras (Mus musculus) 6480464 [Tetrachlorodibenzodioxin affects the methylation of MRAS intron] which results in decreased expression of MRAS mRNA and [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of MRAS mRNA CTD PMID:17942748 and PMID:33017471 Mras Rat 2-hydroxypropanoic acid decreases expression ISO MRAS (Homo sapiens) 6480464 Lactic Acid results in decreased expression of MRAS mRNA CTD PMID:30851411 Mras Rat 4,4'-diaminodiphenylmethane decreases expression ISO Mras (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of MRAS mRNA CTD PMID:18648102 Mras Rat 4,4'-sulfonyldiphenol decreases expression ISO Mras (Mus musculus) 6480464 bisphenol S results in decreased expression of MRAS mRNA CTD PMID:39298647 Mras Rat 5-fluorouracil affects expression ISO MRAS (Homo sapiens) 6480464 Fluorouracil affects the expression of MRAS mRNA CTD PMID:16584549 Mras Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of MRAS mRNA CTD PMID:30047161 Mras Rat 8-Br-cAMP increases expression ISO MRAS (Homo sapiens) 6480464 8-Bromo Cyclic Adenosine Monophosphate results in increased expression of MRAS mRNA CTD PMID:22079614 Mras Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of MRAS mRNA CTD PMID:31881176 Mras Rat aflatoxin B1 increases methylation ISO MRAS (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of MRAS gene CTD PMID:27153756 Mras Rat aldehydo-D-glucose multiple interactions EXP 6480464 manumycin inhibits the reaction [Glucose results in increased activity of MRAS protein] and Simvastatin inhibits the reaction [Glucose results in increased activity of MRAS protein] CTD PMID:18569938 Mras Rat aldehydo-D-glucose increases activity EXP 6480464 Glucose results in increased activity of MRAS protein CTD PMID:18569938 Mras Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of MRAS mRNA CTD PMID:30047161 Mras Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of MRAS mRNA CTD PMID:16483693 Mras Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of MRAS mRNA CTD PMID:30779732 Mras Rat Aroclor 1254 increases expression ISO Mras (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in increased expression of MRAS mRNA CTD PMID:23650126 Mras Rat arsane affects expression ISO MRAS (Homo sapiens) 6480464 Arsenic affects the expression of MRAS mRNA CTD PMID:18414638 Mras Rat arsenic atom affects expression ISO MRAS (Homo sapiens) 6480464 Arsenic affects the expression of MRAS mRNA CTD PMID:18414638 Mras Rat benzo[a]pyrene decreases expression ISO MRAS (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of MRAS mRNA CTD PMID:20064835 Mras Rat benzo[a]pyrene decreases methylation ISO MRAS (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of MRAS 5' UTR CTD PMID:27901495 Mras Rat benzo[a]pyrene affects methylation ISO MRAS (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of MRAS promoter CTD PMID:27901495 Mras Rat benzo[a]pyrene increases expression ISO MRAS (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of MRAS mRNA CTD PMID:20106945 more ... Mras Rat benzo[a]pyrene decreases expression ISO Mras (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of MRAS mRNA CTD PMID:19770486 Mras Rat bis(2-chloroethyl) sulfide increases expression ISO Mras (Mus musculus) 6480464 Mustard Gas results in increased expression of MRAS mRNA CTD PMID:15674844 Mras Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of MRAS mRNA CTD PMID:25181051 and PMID:34947998 Mras Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of MRAS mRNA CTD PMID:19167457 Mras Rat cadmium dichloride decreases expression ISO MRAS (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of MRAS mRNA CTD PMID:38382870 Mras Rat cadmium dichloride increases expression ISO MRAS (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of MRAS mRNA CTD PMID:38568856 Mras Rat carbamazepine affects expression ISO MRAS (Homo sapiens) 6480464 Carbamazepine affects the expression of MRAS mRNA CTD PMID:24752500 Mras Rat carbonyl sulfide increases expression EXP 6480464 carbonyl sulfide results in increased expression of MRAS mRNA CTD PMID:19395590 Mras Rat chlorpyrifos increases expression ISO Mras (Mus musculus) 6480464 Chlorpyrifos results in increased expression of MRAS mRNA CTD PMID:37019170 Mras Rat cisplatin increases expression ISO MRAS (Homo sapiens) 6480464 Cisplatin results in increased expression of MRAS mRNA CTD PMID:27392435 Mras Rat cocaine affects expression EXP 6480464 Cocaine affects the expression of MRAS mRNA CTD PMID:20187946 Mras Rat copper atom multiple interactions ISO MRAS (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in decreased expression of MRAS mRNA CTD PMID:30911355 Mras Rat copper(0) multiple interactions ISO MRAS (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in decreased expression of MRAS mRNA CTD PMID:30911355 Mras Rat copper(II) sulfate increases expression ISO MRAS (Homo sapiens) 6480464 Copper Sulfate results in increased expression of MRAS mRNA CTD PMID:19549813 Mras Rat crocidolite asbestos affects expression ISO MRAS (Homo sapiens) 6480464 Asbestos and Crocidolite affects the expression of MRAS mRNA CTD PMID:17331233 Mras Rat crocidolite asbestos decreases expression ISO MRAS (Homo sapiens) 6480464 Asbestos and Crocidolite results in decreased expression of MRAS mRNA CTD PMID:29626692 Mras Rat D-glucose increases activity EXP 6480464 Glucose results in increased activity of MRAS protein CTD PMID:18569938 Mras Rat D-glucose multiple interactions EXP 6480464 manumycin inhibits the reaction [Glucose results in increased activity of MRAS protein] and Simvastatin inhibits the reaction [Glucose results in increased activity of MRAS protein] CTD PMID:18569938 Mras Rat dibutyl phthalate increases expression ISO Mras (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of MRAS mRNA CTD PMID:21266533 Mras Rat diclofenac affects expression ISO MRAS (Homo sapiens) 6480464 Diclofenac affects the expression of MRAS mRNA CTD PMID:24752500 Mras Rat diethylstilbestrol increases expression ISO MRAS (Homo sapiens) 6480464 Diethylstilbestrol results in increased expression of MRAS mRNA CTD PMID:36621641 Mras Rat diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of MRAS mRNA CTD PMID:36653537 Mras Rat Doramectin decreases expression EXP 6480464 doramectin results in decreased expression of MRAS mRNA CTD PMID:35137919 Mras Rat ethanol increases expression ISO Mras (Mus musculus) 6480464 Ethanol results in increased expression of MRAS mRNA CTD PMID:30319688 Mras Rat etoposide decreases expression ISO Mras (Mus musculus) 6480464 Etoposide results in decreased expression of MRAS mRNA CTD PMID:25270620 Mras Rat febuxostat increases expression ISO MRAS (Homo sapiens) 6480464 Febuxostat results in increased expression of MRAS mRNA CTD PMID:35866629 Mras Rat fipronil increases expression EXP 6480464 fipronil results in increased expression of MRAS mRNA CTD PMID:23962444 Mras Rat furan decreases expression EXP 6480464 furan results in decreased expression of MRAS mRNA CTD PMID:26194646 Mras Rat glucose increases activity EXP 6480464 Glucose results in increased activity of MRAS protein CTD PMID:18569938 Mras Rat glucose multiple interactions EXP 6480464 manumycin inhibits the reaction [Glucose results in increased activity of MRAS protein] and Simvastatin inhibits the reaction [Glucose results in increased activity of MRAS protein] CTD PMID:18569938 Mras Rat indole-3-methanol affects expression EXP 6480464 indole-3-carbinol affects the expression of MRAS mRNA CTD PMID:21396975 Mras Rat inulin multiple interactions ISO Mras (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of MRAS mRNA CTD PMID:36331819 Mras Rat ketamine increases expression EXP 6480464 Ketamine results in increased expression of MRAS mRNA CTD PMID:20080153 Mras Rat ketoconazole increases expression ISO MRAS (Homo sapiens) 6480464 Ketoconazole results in increased expression of MRAS mRNA CTD PMID:36621641 Mras Rat leflunomide increases expression ISO MRAS (Homo sapiens) 6480464 leflunomide results in increased expression of MRAS mRNA CTD PMID:28988120 Mras Rat lithocholic acid affects binding EXP 6480464 Lithocholic Acid binds to MRAS protein CTD PMID:18641422 Mras Rat manumycin A multiple interactions EXP 6480464 manumycin inhibits the reaction [Glucose results in increased activity of MRAS protein] CTD PMID:18569938 Mras Rat methoxychlor affects expression ISO Mras (Mus musculus) 6480464 Methoxychlor affects the expression of MRAS mRNA CTD PMID:20829426 Mras Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of MRAS gene CTD PMID:35440735 Mras Rat methoxychlor decreases expression EXP 6480464 Methoxychlor results in decreased expression of MRAS mRNA CTD PMID:21782745 Mras Rat N-nitrosodiethylamine increases expression ISO Mras (Mus musculus) 6480464 Diethylnitrosamine results in increased expression of MRAS mRNA CTD PMID:26464624 Mras Rat nickel atom decreases expression ISO MRAS (Homo sapiens) 6480464 Nickel results in decreased expression of MRAS mRNA CTD PMID:25583101 Mras Rat orphenadrine affects expression EXP 6480464 Orphenadrine affects the expression of MRAS mRNA CTD PMID:23665939 Mras Rat ouabain decreases expression ISO MRAS (Homo sapiens) 6480464 Ouabain results in decreased expression of MRAS mRNA CTD PMID:28795476 Mras Rat paracetamol affects expression ISO Mras (Mus musculus) 6480464 Acetaminophen affects the expression of MRAS mRNA CTD PMID:17562736 Mras Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of MRAS mRNA CTD PMID:33387578 Mras Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Mras (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of MRAS mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in increased expression of MRAS mRNA CTD PMID:36331819 Mras Rat phenobarbital multiple interactions ISO Mras (Mus musculus) 6480464 NR1I3 protein affects the reaction [Phenobarbital results in increased expression of MRAS mRNA] CTD PMID:19482888 Mras Rat phenobarbital increases expression ISO Mras (Mus musculus) 6480464 Phenobarbital results in increased expression of MRAS mRNA CTD PMID:19482888 Mras Rat progesterone multiple interactions ISO MRAS (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in increased expression of MRAS mRNA CTD PMID:20660070 Mras Rat propiconazole increases expression EXP 6480464 propiconazole results in increased expression of MRAS mRNA CTD PMID:30047161 Mras Rat rac-lactic acid decreases expression ISO MRAS (Homo sapiens) 6480464 Lactic Acid results in decreased expression of MRAS mRNA CTD PMID:30851411 Mras Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of MRAS mRNA CTD PMID:28374803 Mras Rat simvastatin multiple interactions EXP 6480464 Simvastatin inhibits the reaction [Glucose results in increased activity of MRAS protein] and Simvastatin inhibits the reaction [Smoke analog results in increased activity of MRAS protein] CTD PMID:18569938 and PMID:19299917 Mras Rat sodium arsenite multiple interactions ISO MRAS (Homo sapiens) 6480464 4-((3-bromophenyl)amino)-6 more ... CTD PMID:11943669 Mras Rat sodium arsenite decreases expression ISO MRAS (Homo sapiens) 6480464 sodium arsenite results in decreased expression of MRAS mRNA CTD PMID:34032870 Mras Rat sodium arsenite increases expression ISO MRAS (Homo sapiens) 6480464 sodium arsenite results in increased expression of MRAS mRNA CTD PMID:38568856 Mras Rat sodium arsenite increases activity ISO MRAS (Homo sapiens) 6480464 sodium arsenite results in increased activity of MRAS protein CTD PMID:11943669 Mras Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of MRAS mRNA CTD PMID:30047161 Mras Rat sulindac sulfide increases expression ISO MRAS (Homo sapiens) 6480464 sulindac sulfide results in increased expression of MRAS mRNA CTD PMID:16184548 Mras Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of MRAS mRNA CTD PMID:17805973 Mras Rat thiram increases expression ISO MRAS (Homo sapiens) 6480464 Thiram results in increased expression of MRAS mRNA CTD PMID:38568856 Mras Rat tipifarnib increases expression EXP 6480464 tipifarnib results in increased expression of MRAS mRNA CTD PMID:16403772 Mras Rat titanium dioxide increases methylation ISO Mras (Mus musculus) 6480464 titanium dioxide results in increased methylation of MRAS gene CTD PMID:35295148 Mras Rat torcetrapib increases expression ISO MRAS (Homo sapiens) 6480464 torcetrapib results in increased expression of MRAS mRNA CTD PMID:23228038 Mras Rat urethane decreases expression ISO MRAS (Homo sapiens) 6480464 Urethane results in decreased expression of MRAS mRNA CTD PMID:28818685 Mras Rat valproic acid increases methylation ISO MRAS (Homo sapiens) 6480464 Valproic Acid results in increased methylation of MRAS gene CTD PMID:29154799 Mras Rat vanadyl sulfate multiple interactions ISO MRAS (Homo sapiens) 6480464 4-((3-bromophenyl)amino)-6 more ... CTD PMID:11943669 Mras Rat vanadyl sulfate increases activity ISO MRAS (Homo sapiens) 6480464 vanadyl sulfate results in increased activity of MRAS protein CTD PMID:11943669 Mras Rat zinc atom increases expression ISO MRAS (Homo sapiens) 6480464 Zinc results in increased expression of MRAS mRNA CTD PMID:15984569 Mras Rat zinc sulfate multiple interactions ISO MRAS (Homo sapiens) 6480464 4-((3-bromophenyl)amino)-6 more ... CTD PMID:11943669 Mras Rat zinc sulfate increases activity ISO MRAS (Homo sapiens) 6480464 Zinc Sulfate results in increased activity of MRAS protein CTD PMID:11943669 Mras Rat zinc(0) increases expression ISO MRAS (Homo sapiens) 6480464 Zinc results in increased expression of MRAS mRNA CTD PMID:15984569
Imported Annotations - KEGG (archival)
1,2-dimethylhydrazine (ISO) 15-acetyldeoxynivalenol (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-hydroxypropanoic acid (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) 8-Br-cAMP (ISO) acetamide (EXP) aflatoxin B1 (ISO) aldehydo-D-glucose (EXP) amitrole (EXP) ammonium chloride (EXP) amphetamine (EXP) Aroclor 1254 (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) bis(2-chloroethyl) sulfide (ISO) bisphenol A (EXP) C60 fullerene (EXP) cadmium dichloride (ISO) carbamazepine (ISO) carbonyl sulfide (EXP) chlorpyrifos (ISO) cisplatin (ISO) cocaine (EXP) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) crocidolite asbestos (ISO) D-glucose (EXP) dibutyl phthalate (ISO) diclofenac (ISO) diethylstilbestrol (EXP,ISO) Doramectin (EXP) ethanol (ISO) etoposide (ISO) febuxostat (ISO) fipronil (EXP) furan (EXP) glucose (EXP) indole-3-methanol (EXP) inulin (ISO) ketamine (EXP) ketoconazole (ISO) leflunomide (ISO) lithocholic acid (EXP) manumycin A (EXP) methoxychlor (EXP,ISO) N-nitrosodiethylamine (ISO) nickel atom (ISO) orphenadrine (EXP) ouabain (ISO) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) progesterone (ISO) propiconazole (EXP) rac-lactic acid (ISO) rotenone (EXP) simvastatin (EXP) sodium arsenite (ISO) sulfadimethoxine (EXP) sulindac sulfide (ISO) tetrachloromethane (EXP) thiram (ISO) tipifarnib (EXP) titanium dioxide (ISO) torcetrapib (ISO) urethane (ISO) valproic acid (ISO) vanadyl sulfate (ISO) zinc atom (ISO) zinc sulfate (ISO) zinc(0) (ISO)
Mras Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 108,823,374 - 108,886,104 (-) NCBI GRCr8 mRatBN7.2 8 99,944,036 - 100,006,771 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 99,944,036 - 99,996,408 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 105,610,343 - 105,663,748 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 103,809,642 - 103,863,053 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 101,652,159 - 101,705,561 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 107,629,028 - 107,656,851 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 107,629,028 - 107,681,512 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 107,054,728 - 107,082,497 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 104,244,660 - 104,272,556 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 104,264,114 - 104,292,011 (-) NCBI Celera 8 99,345,811 - 99,373,539 (-) NCBI Celera Cytogenetic Map 8 q31 NCBI
MRAS Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 138,347,648 - 138,405,535 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 138,347,648 - 138,405,534 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 138,066,490 - 138,124,377 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 139,549,315 - 139,607,067 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 139,574,404 - 139,607,073 NCBI Celera 3 136,491,513 - 136,549,286 (+) NCBI Celera Cytogenetic Map 3 q22.3 NCBI HuRef 3 135,441,552 - 135,499,356 (+) NCBI HuRef CHM1_1 3 138,030,261 - 138,088,159 (+) NCBI CHM1_1 T2T-CHM13v2.0 3 141,088,198 - 141,146,101 (+) NCBI T2T-CHM13v2.0
Mras Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 99,267,473 - 99,319,505 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 99,267,473 - 99,319,434 (-) Ensembl GRCm39 Ensembl GRCm38 9 99,385,420 - 99,437,700 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 99,385,420 - 99,437,381 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 99,285,839 - 99,337,131 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 99,197,328 - 99,246,063 (-) NCBI MGSCv36 mm8 Celera 9 98,920,430 - 98,971,712 (-) NCBI Celera Cytogenetic Map 9 E3.3 NCBI cM Map 9 51.63 NCBI
Mras Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955501 615,303 - 670,782 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955501 615,303 - 670,404 (-) NCBI ChiLan1.0 ChiLan1.0
MRAS Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 136,253,974 - 136,311,964 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 136,258,713 - 136,316,693 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 135,377,488 - 135,435,338 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 142,827,020 - 142,884,582 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 142,827,020 - 142,884,582 (+) Ensembl panpan1.1 panPan2
MRAS Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 23 34,558,278 - 34,613,987 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 23 34,582,314 - 34,611,763 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 23 34,550,398 - 34,607,319 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 23 35,098,326 - 35,155,275 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 23 35,099,325 - 35,157,728 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 23 34,779,709 - 34,836,613 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 23 34,845,153 - 34,902,406 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 23 35,096,331 - 35,153,294 (+) NCBI UU_Cfam_GSD_1.0
Mras
MRAS Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 79,139,764 - 79,211,135 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 79,137,489 - 79,211,139 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 86,781,175 - 86,826,924 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MRAS Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 15 52,137,409 - 52,195,247 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 15 52,135,727 - 52,170,020 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 25,149,689 - 25,208,288 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Mras
.
Predicted Target Of
Count of predictions: 962 Count of miRNA genes: 331 Interacting mature miRNAs: 443 Transcripts: ENSRNOT00000050374 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
1300177 Cm2 Cardiac mass QTL 2 3.65 heart mass (VT:0007028) heart weight (CMO:0000017) 8 54259986 100382532 Rat 1549909 Stresp11 Stress response QTL 11 6.83 0.0019 stress-related behavior trait (VT:0010451) number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960) 8 73473045 118473045 Rat 1554321 Bmd3 Bone mineral density QTL 3 7.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 40952565 123900184 Rat 9590292 Uminl3 Urine mineral level QTL 3 3.62 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 8 71888757 116888757 Rat 1578769 Uae31 Urinary albumin excretion QTL 31 3.3 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 30848154 101699754 Rat 738011 Anxrr9 Anxiety related response QTL 9 6.1 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 8 93535351 123900184 Rat 8693654 Alc32 Alcohol consumption QTL 32 2 0.755 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 8 88612425 107550209 Rat 1358912 Bw51 Body weight QTL 51 2.95 body mass (VT:0001259) body weight (CMO:0000012) 8 51351728 107062046 Rat 1578765 Klgr1 Kidney lesion grade QTL 1 3.3 0.0001 kidney morphology trait (VT:0002135) organ lesion measurement (CMO:0000677) 8 30848154 101699754 Rat 738014 Anxrr15 Anxiety related response QTL 15 3.6 0.005 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 8 95718998 123900184 Rat 1300171 Bp184 Blood pressure QTL 184 3.66 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 8 70513503 118219066 Rat 1578755 Pur5 Proteinuria QTL 5 3.3 0.0001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 8 30848154 101699754 Rat 2313400 Anxrr25 Anxiety related response QTL 25 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 8 89265192 114019816 Rat 2303171 Bp331 Blood pressure QTL 331 5.57 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 61290298 119084929 Rat 631210 Bw3 Body weight QTL3 5.9 mesenteric fat pad mass (VT:0010427) mesenteric fat pad weight to body weight ratio (CMO:0000654) 8 69349194 112783834 Rat 1358903 Bp252 Blood pressure QTL 252 7 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 93965141 123900184 Rat 8694446 Bw170 Body weight QTL 170 12.07 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 8 71888757 116888757 Rat 631650 Stl6 Serum triglyceride level QTL 6 4 0.0019 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 10378157 112202585 Rat 631653 Bp125 Blood pressure QTL 125 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 66142385 111142385 Rat 1581557 Eae16 Experimental allergic encephalomyelitis QTL 16 3.8 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 8 8462195 110921472 Rat 70197 BpQTLcluster8 Blood pressure QTL cluster 8 3.482 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 46531639 119088626 Rat 2316950 Scl66 Serum cholesterol level QTL 66 4.1 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30848259 105647037 Rat 2300182 Bmd56 Bone mineral density QTL 56 5.4 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 95718998 123900184 Rat 2300181 Bmd55 Bone mineral density QTL 55 5.7 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 76468691 121468691 Rat 1358893 Bp263 Blood pressure QTL 263 5.01 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 93965141 123900184 Rat 8694200 Abfw4 Abdominal fat weight QTL 4 9.07 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 8 71888757 116888757 Rat 8694392 Bw161 Body weight QTL 161 8.06 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 8 71888757 116888757 Rat 61437 Cia6 Collagen induced arthritis QTL 6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 8 82460758 122812818 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000050374 ⟹ ENSRNOP00000045851
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 99,944,036 - 99,978,327 (-) Ensembl Rnor_6.0 Ensembl 8 107,629,028 - 107,656,861 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000077963 ⟹ ENSRNOP00000072543
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 99,946,502 - 99,996,408 (-) Ensembl Rnor_6.0 Ensembl 8 107,631,488 - 107,681,512 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000118697 ⟹ ENSRNOP00000085134
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 99,944,036 - 99,973,929 (-) Ensembl
RefSeq Acc Id:
NM_001388501 ⟹ NP_001375430
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 108,823,374 - 108,876,147 (-) NCBI mRatBN7.2 8 99,944,036 - 99,996,814 (-) NCBI
RefSeq Acc Id:
NM_012981 ⟹ NP_037113
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 108,823,374 - 108,875,911 (-) NCBI mRatBN7.2 8 99,944,036 - 99,996,578 (-) NCBI Rnor_6.0 8 107,629,028 - 107,656,851 (-) NCBI Rnor_5.0 8 107,054,728 - 107,082,497 (-) NCBI RGSC_v3.4 8 104,244,660 - 104,272,556 (-) RGD Celera 8 99,345,811 - 99,373,539 (-) RGD
Sequence:
GTCATCCTGGGGTCTGACTACCAGAAGCATGGCGACCAGCGCTGTTCCCAGTGACAACCTTCCCACATATAAACTGGTAGTGGTGGGAGATGGCGGTGTGGGCAAGAGTGCTCTCACTATTCAGTTTT
hide sequence
RefSeq Acc Id:
XM_039080883 ⟹ XP_038936811
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 108,823,377 - 108,857,628 (-) NCBI mRatBN7.2 8 99,944,039 - 99,978,326 (-) NCBI
RefSeq Acc Id:
XM_039080884 ⟹ XP_038936812
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 108,823,377 - 108,875,859 (-) NCBI mRatBN7.2 8 99,944,039 - 99,996,526 (-) NCBI
RefSeq Acc Id:
XM_039080887 ⟹ XP_038936815
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 108,823,377 - 108,886,104 (-) NCBI mRatBN7.2 8 99,944,039 - 100,006,771 (-) NCBI
RefSeq Acc Id:
XM_063264949 ⟹ XP_063121019
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 108,823,377 - 108,875,859 (-) NCBI
RefSeq Acc Id:
NP_037113 ⟸ NM_012981
- UniProtKB:
P97538 (UniProtKB/Swiss-Prot), O09021 (UniProtKB/Swiss-Prot), Q5RKJ7 (UniProtKB/TrEMBL), A6I2D6 (UniProtKB/TrEMBL), A0A0G2K389 (UniProtKB/TrEMBL)
- Sequence:
MATSAVPSDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDNQWAILDVLDTAGQEEFSAMREQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDRESFPMILVANKV
hide sequence
Ensembl Acc Id:
ENSRNOP00000072543 ⟸ ENSRNOT00000077963
Ensembl Acc Id:
ENSRNOP00000045851 ⟸ ENSRNOT00000050374
RefSeq Acc Id:
NP_001375430 ⟸ NM_001388501
- UniProtKB:
P97538 (UniProtKB/Swiss-Prot), O09021 (UniProtKB/Swiss-Prot), Q5RKJ7 (UniProtKB/TrEMBL), A6I2D6 (UniProtKB/TrEMBL), A0A0G2K389 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038936815 ⟸ XM_039080887
- Peptide Label:
isoform X2
- UniProtKB:
P97538 (UniProtKB/Swiss-Prot), O09021 (UniProtKB/Swiss-Prot), Q5RKJ7 (UniProtKB/TrEMBL), A6I2D6 (UniProtKB/TrEMBL), A0A0G2K389 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038936812 ⟸ XM_039080884
- Peptide Label:
isoform X2
- UniProtKB:
P97538 (UniProtKB/Swiss-Prot), O09021 (UniProtKB/Swiss-Prot), Q5RKJ7 (UniProtKB/TrEMBL), A6I2D6 (UniProtKB/TrEMBL), A0A0G2K389 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038936811 ⟸ XM_039080883
- Peptide Label:
isoform X1
- UniProtKB:
F7FMZ0 (UniProtKB/TrEMBL), A0A8I6A109 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000085134 ⟸ ENSRNOT00000118697
RefSeq Acc Id:
XP_063121019 ⟸ XM_063264949
- Peptide Label:
isoform X2
- UniProtKB:
P97538 (UniProtKB/Swiss-Prot), O09021 (UniProtKB/Swiss-Prot), A0A0G2K389 (UniProtKB/TrEMBL), A6I2D6 (UniProtKB/TrEMBL), Q5RKJ7 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-11-11
Mras
muscle RAS oncogene homolog
Mras
muscle and microspikes RAS
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Mras
Muscle and microspikes RAS
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_function
has GTP-binding and GTPase activities
729080
