Symbol:
Mme
Name:
membrane metallo-endopeptidase
RGD ID:
3098
Description:
Enables oligopeptidase activity and peptide binding activity. Involved in several processes, including amyloid-beta clearance by cellular catabolic process; placenta development; and response to estrogen. Predicted to be located in several cellular components, including cytoplasmic vesicle; microtubule organizing center; and trans-Golgi network. Predicted to be active in extracellular region and plasma membrane. Used to study diarrhea and hypertension. Biomarker of Alzheimer's disease; congestive heart failure; and hepatocellular carcinoma. Human ortholog(s) of this gene implicated in Alzheimer's disease; Charcot-Marie-Tooth disease axonal type 2T; cerebellar ataxia type 43; cerebral amyloid angiopathy; and membranous glomerulonephritis. Orthologous to human MME (membrane metalloendopeptidase); PARTICIPATES IN angiotensin (1-7) signaling pathway; renin-angiotensin cascade pathway; kallikrein-kinin cascade pathway; INTERACTS WITH 1,2-dimethylhydrazine; 1-naphthyl isothiocyanate; 2,2,2-tetramine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
atriopeptidase; CD10; enkephalinase; membrane metallo endopeptidase; Membrane metallo-endopeptidase (neutral endopeptidase/enkephalinase); MGC93576; Nep; neprilysin; neutral endopeptidase 24.11; SFE; skin fibroblast elastase
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
MME (membrane metalloendopeptidase) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Mme (membrane metallo endopeptidase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Mme (membrane metalloendopeptidase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
MME (membrane metalloendopeptidase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
MME (membrane metalloendopeptidase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Mme (membrane metalloendopeptidase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
MME (membrane metalloendopeptidase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
MME (membrane metalloendopeptidase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Mme (membrane metalloendopeptidase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
LETM2 (leucine zipper and EF-hand containing transmembrane protein 2) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Mme (membrane metallo endopeptidase)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
MME (membrane metalloendopeptidase)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Nep4
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|OrthoFinder|PANTHER)
Caenorhabditis elegans (roundworm):
nep-2
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
Nep1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
mme
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Is Marker For:
Strains:
SS.MNS-(Mme-Gca )/Ayd
SS.MNS-(Mme-D2Mit14 )/Ayd
SS.MNS-(Mme-D2Rat131 )/Ayd
SS.WKY-(Mme-D2Wox18 )/Mco
SS.WKY-(D2N35-Mme )/Mco QTLs:
Bp90
Bp73
Bp368
Candidate Gene For:
Prcr1 Bp368
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 149,806,826 - 149,957,381 (+) NCBI GRCr8 mRatBN7.2 2 147,686,913 - 147,803,808 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 147,722,086 - 147,803,792 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 154,412,545 - 154,499,268 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 152,461,414 - 152,548,760 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 147,094,065 - 147,181,452 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 153,799,203 - 153,880,910 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 153,803,349 - 153,880,738 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 173,193,501 - 173,278,946 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 153,031,724 - 153,114,515 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 152,981,686 - 153,064,477 (+) NCBI Celera 2 142,009,686 - 142,090,693 (+) NCBI Celera RH 3.4 Map 2 955.0 RGD Cytogenetic Map 2 q31 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Mme Rat Alzheimer's disease ISO RGD:737353 13801021 DNA:SNPs, haplotypes:promoter, introns:-204G>C, IVS17-294C>T, IVS22+36C>A (human) RGD Mme Rat Alzheimer's disease ISO RGD:737353 13801034 RGD Mme Rat Alzheimer's disease no_association ISO RGD:737353 13801011 DNA:SNPs: :multiple RGD Mme Rat Alzheimer's disease no_association ISO RGD:737353 1600813 DNA:repeats RGD Mme Rat Alzheimer's disease ISO RGD:737353 13801023 DNA:SNPs:introns:rs1836915, rs6776185, rs6801319 (human) RGD Mme Rat Alzheimer's disease ISO RGD:734285 13801022 RGD Mme Rat Alzheimer's disease no_association ISO RGD:737353 13801020 DNA:SNPs, repeats, deletion:promoter:multiple RGD Mme Rat Alzheimer's disease severity ISO RGD:737353 13801019 RGD Mme Rat Alzheimer's disease no_association ISO RGD:737353 13801012 DNA:SNPs:5' utr, 3' utr:rs3736187, rs989692, rs701109 (human) RGD Mme Rat Alzheimer's disease onset ISO RGD:737353 13801009 DNA:SNP:3' utr:rs6665 (human) RGD Mme Rat Alzheimer's disease treatment ISO RGD:734285 13801033 associated with Endotoxemia RGD Mme Rat Alzheimer's disease ISO RGD:737353 13801011 DNA:SNP: :rs6797911 (human) RGD Mme Rat Alzheimer's disease ISO RGD:734285 13801010 RGD Mme Rat Alzheimer's disease treatment IEP 13801024 RGD Mme Rat Alzheimer's disease no_association ISO RGD:737353 13801023 DNA:SNPs, repeat:multiple:multiple RGD Mme Rat cerebral amyloid angiopathy ISO RGD:737353 1600811 associated with Alzheimer Disease;protein:decreased expression:frontal lobe cortex (human) RGD Mme Rat cerebral amyloid angiopathy severity ISO RGD:737353 13801026 RGD Mme Rat congestive heart failure IEP 13801043 RGD Mme Rat COVID-19 ISO RGD:737353 9068941 mRNA:decreased expression:peripheral blood mononuclear cell (human) RGD PMID:32228226|REF_RGD_ID:28912744 Mme Rat diarrhea treatment IMP 13801042 RGD Mme Rat Endotoxemia severity IMP 13801040 RGD Mme Rat hepatocellular carcinoma IEP 13801035 RGD Mme Rat hypertension treatment IMP 13801039 RGD Mme Rat Hypoglossal Nerve Injuries IEP 13801045 RGD Mme Rat Hypoxia treatment ISO RGD:737353 13801041 RGD Mme Rat Hypoxia IEP 13801041 RGD Mme Rat membranous glomerulonephritis ISO RGD:737353 1600817 antenatal membranous glomerulonephritis RGD Mme Rat periodontitis ISO RGD:737353 13801025 mRNA:increased expression:gingiva RGD
Mme Rat cerebellar ataxia type 43 ISO RGD:737353 8554872 ClinVar Annotator: match by term: Spinocerebellar ataxia 43 ClinVar PMID:15464186|PMID:24033266|PMID:25565308|PMID:25741868|PMID:26991897|PMID:27583304|PMID:27588448|PMID:28492532|PMID:30415211|PMID:31589614|PMID:33144514|PMID:33726816|PMID:34307994|PMID:34426522|PMID:35318247|PMID:36517691 Mme Rat Charcot-Marie-Tooth disease ISO RGD:737353 8554872 ClinVar Annotator: match by term: Charcot-Marie-Tooth disease ClinVar PMID:25741868|PMID:28492532 Mme Rat Charcot-Marie-Tooth disease axonal type 2T ISO RGD:737353 8554872 ClinVar Annotator: match by term: Charcot-Marie-Tooth disease axonal type 2T | ClinVar Annotator: match by more ... ClinVar PMID:15464186|PMID:16199547|PMID:24033266|PMID:25565308|PMID:25741868|PMID:26991897|PMID:27588448|PMID:28492532|PMID:30415211|PMID:31589614|PMID:31673878|PMID:33144514|PMID:33726816|PMID:34307994|PMID:34426522|PMID:34758253|PMID:35318247|PMID:36517691|PMID:38860315 Mme Rat Charcot-Marie-Tooth disease type 2 ISO RGD:737353 8554872 ClinVar Annotator: match by term: Charcot-Marie-Tooth disease type 2 ClinVar PMID:25741868|PMID:28492532|PMID:33144514 Mme Rat genetic disease ISO RGD:737353 8554872 ClinVar Annotator: match by term: Inborn genetic diseases ClinVar PMID:17576681|PMID:25741868|PMID:28492532|PMID:33144514|PMID:9536098 Mme Rat genetic disease ISO RGD:737353 8554872 ClinVar Annotator: match by term: Hereditary disease | ClinVar Annotator: match by term: Inborn genetic more ... ClinVar PMID:25741868|PMID:28492532|PMID:33144514 Mme Rat hereditary breast ovarian cancer syndrome ISO RGD:737353 8554872 ClinVar Annotator: match by term: Breast and/or ovarian cancer ClinVar PMID:25741868|PMID:27588448|PMID:28492532|PMID:33144514|PMID:34426522|PMID:36517691 Mme Rat membranous glomerulonephritis ISO RGD:737353 8554872 ClinVar Annotator: match by term: Congenital membranous nephropathy due to fetomaternal anti-neutral endopeptidase alloimmunization ClinVar PMID:15464186|PMID:24033266|PMID:25565308|PMID:25741868|PMID:26991897|PMID:27588448|PMID:28492532|PMID:30415211 Mme Rat neuropathy ISO RGD:737353 8554872 ClinVar Annotator: match by term: Autosomal recessive axonal hereditary motor and sensory neuropathy | ClinVar more ... ClinVar PMID:25741868|PMID:26991897|PMID:28492532 Mme Rat peripheral nervous system disease ISO RGD:737353 8554872 ClinVar Annotator: match by term: Peripheral neuropathy ClinVar PMID:25741868|PMID:26991897|PMID:28492532
Only show annotations with direct experimental evidence (0 objects hidden)
Mme Rat (S)-nicotine increases expression ISO RGD:737353 6480464 Nicotine results in increased expression of MME mRNA CTD PMID:23825647 Mme Rat 1,2-dichloroethane decreases expression ISO RGD:734285 6480464 ethylene dichloride results in decreased expression of MME mRNA CTD PMID:28189721|PMID:28960355 Mme Rat 1,2-dimethylhydrazine multiple interactions EXP 6480464 [APC protein affects the susceptibility to 1,2-Dimethylhydrazine] which results in increased expression of MME mRNA CTD PMID:27840820 Mme Rat 1,2-dimethylhydrazine decreases expression ISO RGD:734285 6480464 1,2-Dimethylhydrazine results in decreased expression of MME mRNA CTD PMID:22206623 Mme Rat 1-naphthyl isothiocyanate decreases expression EXP 6480464 1-Naphthylisothiocyanate results in decreased expression of MME mRNA CTD PMID:30723492 Mme Rat 17beta-estradiol multiple interactions ISO RGD:737353 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in increased expression of MME mRNA CTD PMID:19619570 Mme Rat 17beta-estradiol decreases expression ISO RGD:734285 6480464 Estradiol results in decreased expression of MME mRNA CTD PMID:39298647 Mme Rat 17beta-estradiol decreases expression ISO RGD:737353 6480464 Estradiol results in decreased expression of MME mRNA CTD PMID:16202921|PMID:19619570|PMID:21185374|PMID:25878060 Mme Rat 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one multiple interactions ISO RGD:737353 6480464 Metribolone promotes the reaction [NDRG1 protein binds to MME protein] CTD PMID:17220478 Mme Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO RGD:734285 6480464 2,2',4,4'-tetrabromodiphenyl ether affects the expression of MME mRNA CTD PMID:30294300 Mme Rat 2,2',5,5'-tetrachlorobiphenyl increases expression ISO RGD:737353 6480464 2,5,2',5'-tetrachlorobiphenyl results in increased expression of MME mRNA CTD PMID:36804509 Mme Rat 2,2,2-tetramine multiple interactions EXP 6480464 Trientine inhibits the reaction [Streptozocin results in decreased expression of MME protein] CTD PMID:19634143 Mme Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:737353 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in increased expression of MME mRNA CTD PMID:19619570 Mme Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of MME mRNA CTD PMID:33387578|PMID:34747641 Mme Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:734285 6480464 Tetrachlorodibenzodioxin affects the expression of MME mRNA CTD PMID:26377647 Mme Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:737353 6480464 Tetrachlorodibenzodioxin affects the expression of MME mRNA CTD PMID:22298810 Mme Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of MME mRNA CTD PMID:21215274|PMID:32109520 Mme Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of MME mRNA CTD PMID:22298810 Mme Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 AHR protein alternative form affects the reaction [Tetrachlorodibenzodioxin results in decreased expression of MME mRNA] CTD PMID:21215274 Mme Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:734285 6480464 Tetrachlorodibenzodioxin results in decreased expression of MME mRNA CTD PMID:17586704 Mme Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:737353 6480464 Tetrachlorodibenzodioxin results in increased expression of MME mRNA CTD PMID:16704738 Mme Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:737353 6480464 Tetrachlorodibenzodioxin results in decreased expression of MME mRNA CTD PMID:19619570 Mme Rat 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine decreases expression EXP 6480464 Puromycin Aminonucleoside results in decreased expression of MME protein CTD PMID:19885019 Mme Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3,4,5,3',4'-pentachlorobiphenyl results in decreased expression of MME mRNA CTD PMID:23196670 Mme Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO RGD:734285 6480464 tetrabromobisphenol A results in decreased expression of MME mRNA CTD PMID:25172293 Mme Rat 3,4-methylenedioxymethamphetamine decreases expression ISO RGD:734285 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in decreased expression of MME mRNA CTD PMID:26251327 Mme Rat 3-chloropropane-1,2-diol affects expression EXP 6480464 alpha-Chlorohydrin affects the expression of MME mRNA CTD PMID:28522335 Mme Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:734285 6480464 bisphenol S results in increased expression of MME mRNA CTD PMID:30951980 Mme Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:737353 6480464 bisphenol S results in increased expression of MME protein CTD PMID:34186270 Mme Rat 4,4'-sulfonyldiphenol affects methylation ISO RGD:737353 6480464 bisphenol S affects the methylation of MME gene CTD PMID:31601247 Mme Rat 4,4'-sulfonyldiphenol decreases expression ISO RGD:734285 6480464 bisphenol S results in decreased expression of MME mRNA CTD PMID:39298647 Mme Rat 4-hydroxyphenyl retinamide decreases expression ISO RGD:734285 6480464 Fenretinide results in decreased expression of MME mRNA CTD PMID:28973697 Mme Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of MME mRNA CTD PMID:24780913|PMID:30047161 Mme Rat 7,12-dimethyltetraphene decreases expression EXP 6480464 9,10-Dimethyl-1,2-benzanthracene results in decreased expression of MME mRNA CTD PMID:19480007 Mme Rat 8-Br-cAMP decreases expression ISO RGD:737353 6480464 8-Bromo Cyclic Adenosine Monophosphate results in decreased expression of MME mRNA CTD PMID:22079614 Mme Rat acrolein multiple interactions ISO RGD:737353 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of more ... CTD PMID:32699268|PMID:32845096 Mme Rat aflatoxin B1 decreases expression ISO RGD:737353 6480464 Aflatoxin B1 results in decreased expression of MME mRNA CTD PMID:27153756 Mme Rat aflatoxin B1 increases methylation ISO RGD:737353 6480464 Aflatoxin B1 results in increased methylation of MME intron CTD PMID:30157460 Mme Rat Aflatoxin B2 alpha increases methylation ISO RGD:737353 6480464 aflatoxin B2 results in increased methylation of MME intron CTD PMID:30157460 Mme Rat agmatine multiple interactions ISO RGD:734285 6480464 Agmatine inhibits the reaction [APP protein results in decreased expression of MME protein] CTD PMID:32522471 Mme Rat aldehydo-D-glucose decreases expression ISO RGD:734285 6480464 Glucose results in decreased expression of MME mRNA CTD PMID:17178593 Mme Rat aldehydo-D-glucose multiple interactions ISO RGD:734285 6480464 [MME protein results in increased cleavage of angiotensin I (1-7)] affects the reaction [Glucose results more ... CTD PMID:28559246 Mme Rat all-trans-retinoic acid multiple interactions ISO RGD:737353 6480464 CSF3 protein promotes the reaction [Tretinoin results in increased expression of MME protein] CTD PMID:12627849 Mme Rat all-trans-retinoic acid increases expression ISO RGD:737353 6480464 Tretinoin results in increased expression of MME mRNA; Tretinoin results in increased expression of MME more ... CTD PMID:12627849|PMID:21934132 Mme Rat alpha-pinene multiple interactions ISO RGD:737353 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of more ... CTD PMID:32699268 Mme Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of MME mRNA CTD PMID:30047161 Mme Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of MME mRNA CTD PMID:16483693 Mme Rat aristolochic acid A decreases expression ISO RGD:737353 6480464 aristolochic acid I results in decreased expression of MME mRNA CTD PMID:33212167 Mme Rat arsane affects expression ISO RGD:737353 6480464 Arsenic affects the expression of MME mRNA CTD PMID:28793237 Mme Rat arsane multiple interactions ISO RGD:737353 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of MME more ... CTD PMID:32525701 Mme Rat arsenic atom affects expression ISO RGD:737353 6480464 Arsenic affects the expression of MME mRNA CTD PMID:28793237 Mme Rat arsenic atom multiple interactions ISO RGD:737353 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of MME more ... CTD PMID:32525701 Mme Rat arsenite(3-) increases expression ISO RGD:734285 6480464 arsenite results in increased expression of MME mRNA CTD PMID:33053406 Mme Rat Azoxymethane multiple interactions ISO RGD:734285 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of MME more ... CTD PMID:29950665 Mme Rat Benoxacor increases expression ISO RGD:734285 6480464 benoxacor results in increased expression of MME mRNA CTD PMID:34850242 Mme Rat benzo[a]pyrene decreases expression ISO RGD:737353 6480464 Benzo(a)pyrene results in decreased expression of MME mRNA CTD PMID:20064835 Mme Rat benzo[a]pyrene increases methylation ISO RGD:737353 6480464 Benzo(a)pyrene results in increased methylation of MME 3' UTR; Benzo(a)pyrene results in increased methylation of more ... CTD PMID:27901495 Mme Rat benzo[a]pyrene increases expression ISO RGD:734285 6480464 Benzo(a)pyrene results in increased expression of MME mRNA CTD PMID:22228805 Mme Rat benzo[a]pyrene multiple interactions ISO RGD:734285 6480464 AHR protein affects the reaction [Benzo(a)pyrene affects the expression of MME mRNA] CTD PMID:22228805 Mme Rat benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of MME mRNA CTD PMID:21839799 Mme Rat benzo[e]pyrene increases methylation ISO RGD:737353 6480464 benzo(e)pyrene results in increased methylation of MME intron CTD PMID:30157460 Mme Rat beta-lapachone decreases expression ISO RGD:737353 6480464 beta-lapachone results in decreased expression of MME mRNA CTD PMID:38218311 Mme Rat beta-naphthoflavone multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in decreased expression of MME mRNA CTD PMID:18164116 Mme Rat bicalutamide increases expression ISO RGD:737353 6480464 bicalutamide results in increased expression of MME mRNA CTD PMID:15790403 Mme Rat bis(2-ethylhexyl) phthalate decreases expression ISO RGD:737353 6480464 Diethylhexyl Phthalate results in decreased expression of MME protein CTD PMID:31163220 Mme Rat bis(2-ethylhexyl) phthalate multiple interactions ISO RGD:734285 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated more ... CTD PMID:39150890 Mme Rat bisphenol A decreases expression ISO RGD:737353 6480464 bisphenol A results in decreased expression of MME mRNA CTD PMID:20678512 Mme Rat bisphenol A increases expression ISO RGD:737353 6480464 bisphenol A results in increased expression of MME protein CTD PMID:34186270 Mme Rat bisphenol A decreases methylation ISO RGD:737353 6480464 bisphenol A results in decreased methylation of MME gene CTD PMID:31601247 Mme Rat bisphenol A increases expression ISO RGD:734285 6480464 bisphenol A results in increased expression of MME mRNA CTD PMID:30951980 Mme Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of MME mRNA CTD PMID:30816183|PMID:32528016 Mme Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of MME mRNA CTD PMID:25181051|PMID:33296240 Mme Rat bisphenol AF increases expression ISO RGD:737353 6480464 bisphenol AF results in increased expression of MME protein CTD PMID:34186270 Mme Rat Bisphenol B increases expression ISO RGD:737353 6480464 bisphenol B results in increased expression of MME protein CTD PMID:34186270 Mme Rat bisphenol F increases expression ISO RGD:734285 6480464 bisphenol F results in increased expression of MME mRNA CTD PMID:30951980|PMID:38685157 Mme Rat bisphenol F increases expression ISO RGD:737353 6480464 bisphenol F results in increased expression of MME protein CTD PMID:34186270 Mme Rat Butylbenzyl phthalate multiple interactions ISO RGD:734285 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated more ... CTD PMID:39150890 Mme Rat cadmium atom multiple interactions EXP 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of MME more ... CTD PMID:34558789 Mme Rat cadmium dichloride multiple interactions EXP 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of MME more ... CTD PMID:34558789 Mme Rat candoxatrilat decreases activity ISO RGD:737353 6480464 candoxatrilat results in decreased activity of MME protein CTD PMID:18084312 Mme Rat carbon nanotube affects expression ISO RGD:734285 6480464 Nanotubes, Carbon affects the expression of MME protein CTD PMID:21135415 Mme Rat carbon nanotube decreases expression ISO RGD:734285 6480464 Nanotubes, Carbon analog results in decreased expression of MME mRNA; Nanotubes, Carbon results in decreased more ... CTD PMID:25620056 Mme Rat ceftriaxone increases expression EXP 6480464 Ceftriaxone results in increased expression of MME mRNA CTD PMID:29745864 Mme Rat CGP 52608 multiple interactions ISO RGD:737353 6480464 CGP 52608 promotes the reaction [RORA protein binds to MME gene] CTD PMID:28238834 Mme Rat chlordecone affects expression ISO RGD:734285 6480464 Chlordecone affects the expression of MME mRNA CTD PMID:33711761 Mme Rat chlorpyrifos increases expression ISO RGD:734285 6480464 Chlorpyrifos results in increased expression of MME mRNA CTD PMID:37019170 Mme Rat cisplatin decreases expression EXP 6480464 Cisplatin results in decreased expression of MME mRNA CTD PMID:22023808 Mme Rat cisplatin multiple interactions ISO RGD:734285 6480464 [Cisplatin co-treated with RELB mutant form co-treated with TNF protein] results in decreased expression of more ... CTD PMID:23625948 Mme Rat clothianidin multiple interactions EXP 6480464 [enilconazole co-treated with clothianidin] results in increased expression of MME mRNA; [thiacloprid co-treated with clothianidin] more ... CTD PMID:33426623 Mme Rat clothianidin increases expression EXP 6480464 clothianidin results in increased expression of MME mRNA CTD PMID:33426623 Mme Rat cobalt dichloride multiple interactions ISO RGD:737353 6480464 cobaltous chloride promotes the reaction [HIF1A protein binds to MME gene]; HIF1A protein promotes the more ... CTD PMID:23138928 Mme Rat cobalt dichloride decreases expression ISO RGD:737353 6480464 cobaltous chloride results in decreased expression of MME mRNA; cobaltous chloride results in decreased expression more ... CTD PMID:19320972|PMID:23138928 Mme Rat cocaine multiple interactions EXP 6480464 [Thiorphan binds to and results in decreased activity of MME protein] which results in increased more ... CTD PMID:19279569 Mme Rat copper atom decreases expression EXP 6480464 Copper results in decreased expression of MME mRNA CTD PMID:22465980 Mme Rat copper(0) decreases expression EXP 6480464 Copper results in decreased expression of MME mRNA CTD PMID:22465980 Mme Rat copper(II) chloride decreases expression ISO RGD:737353 6480464 cupric chloride results in decreased expression of MME mRNA CTD PMID:38568856 Mme Rat crocidolite asbestos decreases expression ISO RGD:734285 6480464 Asbestos, Crocidolite results in decreased expression of MME mRNA CTD PMID:29279043 Mme Rat curcumin decreases expression ISO RGD:737353 6480464 Curcumin results in decreased expression of MME mRNA CTD PMID:17198877 Mme Rat cyclosporin A decreases expression ISO RGD:737353 6480464 Cyclosporine results in decreased expression of MME mRNA CTD PMID:20106945 Mme Rat D-glucose decreases expression ISO RGD:734285 6480464 Glucose results in decreased expression of MME mRNA CTD PMID:17178593 Mme Rat D-glucose multiple interactions ISO RGD:734285 6480464 [MME protein results in increased cleavage of angiotensin I (1-7)] affects the reaction [Glucose results more ... CTD PMID:28559246 Mme Rat DDT decreases expression EXP 6480464 DDT results in decreased expression of MME mRNA CTD PMID:30207508 Mme Rat DDT increases expression ISO RGD:734285 6480464 DDT results in increased expression of MME mRNA CTD PMID:35946953 Mme Rat DDT increases expression ISO RGD:737353 6480464 DDT results in increased expression of MME mRNA CTD PMID:35946953 Mme Rat dextran sulfate multiple interactions ISO RGD:734285 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of MME more ... CTD PMID:29950665 Mme Rat dextran sulfate decreases expression ISO RGD:734285 6480464 Dextran Sulfate results in decreased expression of MME mRNA CTD PMID:35093514 Mme Rat Dibutyl phosphate affects expression ISO RGD:737353 6480464 di-n-butylphosphoric acid affects the expression of MME mRNA CTD PMID:37042841 Mme Rat dibutyl phthalate multiple interactions ISO RGD:734285 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated more ... CTD PMID:39150890 Mme Rat diclofenac decreases expression ISO RGD:734285 6480464 Diclofenac results in decreased expression of MME mRNA CTD PMID:26934552 Mme Rat diethyl phthalate multiple interactions ISO RGD:734285 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated more ... CTD PMID:39150890 Mme Rat diisobutyl phthalate multiple interactions ISO RGD:734285 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated more ... CTD PMID:39150890 Mme Rat diisononyl phthalate multiple interactions ISO RGD:734285 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated more ... CTD PMID:39150890 Mme Rat dioxygen increases expression ISO RGD:737353 6480464 Oxygen deficiency results in increased expression of MME mRNA CTD PMID:24236059 Mme Rat dioxygen multiple interactions EXP 6480464 [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in increased expression more ... CTD PMID:33729688 Mme Rat dioxygen decreases expression ISO RGD:737353 6480464 Oxygen deficiency results in decreased expression of MME mRNA; Oxygen deficiency results in decreased expression more ... CTD PMID:23138928 Mme Rat dorsomorphin multiple interactions ISO RGD:737353 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Mme Rat doxorubicin decreases expression ISO RGD:737353 6480464 Doxorubicin results in decreased expression of MME mRNA; Doxorubicin results in decreased expression of MME more ... CTD PMID:16997790|PMID:29803840 Mme Rat doxorubicin affects response to substance ISO RGD:737353 6480464 MME protein affects the susceptibility to Doxorubicin CTD PMID:16217747 Mme Rat elemental selenium multiple interactions EXP 6480464 Selenium deficiency affects the expression of and affects the localization of MME protein CTD PMID:17109141 Mme Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of MME mRNA CTD PMID:29391264 Mme Rat enilconazole multiple interactions EXP 6480464 [enilconazole co-treated with clothianidin] results in increased expression of MME mRNA; [thiacloprid co-treated with enilconazole] more ... CTD PMID:33426623 Mme Rat enilconazole increases expression EXP 6480464 enilconazole results in increased expression of MME mRNA CTD PMID:33426623 Mme Rat entinostat increases expression ISO RGD:737353 6480464 entinostat results in increased expression of MME mRNA CTD PMID:26272509|PMID:27188386 Mme Rat entinostat multiple interactions ISO RGD:737353 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Mme Rat estrogen increases activity EXP 1600807 Estrogen increases activity of Mme protein in the brain RGD Mme Rat ethanol affects expression ISO RGD:734285 6480464 Ethanol affects the expression of MME mRNA CTD PMID:30319688 Mme Rat fipronil increases expression EXP 6480464 fipronil results in increased expression of MME mRNA CTD PMID:23962444 Mme Rat fisetin multiple interactions ISO RGD:734285 6480464 fisetin inhibits the reaction [Lead results in decreased expression of MME protein] CTD PMID:31539617 Mme Rat flavonoids increases expression EXP 6480464 Flavonoids results in increased expression of MME mRNA CTD PMID:18035473 Mme Rat folic acid affects expression ISO RGD:737353 6480464 Folic Acid affects the expression of MME mRNA CTD PMID:17320366 Mme Rat FR900359 increases phosphorylation ISO RGD:737353 6480464 FR900359 results in increased phosphorylation of MME protein CTD PMID:37730182 Mme Rat fulvestrant increases expression ISO RGD:737353 6480464 fulvestrant results in increased expression of MME mRNA CTD PMID:16202921 Mme Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of MME mRNA CTD PMID:33387578 Mme Rat glucose decreases expression ISO RGD:734285 6480464 Glucose results in decreased expression of MME mRNA CTD PMID:17178593 Mme Rat glucose multiple interactions ISO RGD:734285 6480464 [MME protein results in increased cleavage of angiotensin I (1-7)] affects the reaction [Glucose results more ... CTD PMID:28559246 Mme Rat hydralazine multiple interactions ISO RGD:737353 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of MME mRNA CTD PMID:17183730 Mme Rat L-ascorbic acid decreases activity EXP 1581744 Ascorbic acid decreases activity of Mme protein in osteoblasts RGD Mme Rat lead(0) multiple interactions ISO RGD:737353 6480464 Lead results in decreased expression of and results in decreased activity of MME protein CTD PMID:21315759 Mme Rat lead(0) decreases expression ISO RGD:734285 6480464 Lead results in decreased expression of MME protein CTD PMID:31539617 Mme Rat lead(0) multiple interactions ISO RGD:734285 6480464 fisetin inhibits the reaction [Lead results in decreased expression of MME protein] CTD PMID:31539617 Mme Rat lead(0) affects folding ISO RGD:737353 6480464 Lead affects the folding of MME protein CTD PMID:25673500 Mme Rat lead(0) decreases expression ISO RGD:737353 6480464 Lead results in decreased expression of MME mRNA CTD PMID:21315759 Mme Rat lipopolysaccharide affects activity ISO RGD:734285 6480464 Lipopolysaccharides affects the activity of MME protein CTD PMID:21114838 Mme Rat lipopolysaccharide multiple interactions ISO RGD:737353 6480464 [S-(1,2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of MME mRNA CTD PMID:35811015 Mme Rat lipopolysaccharide increases expression EXP 6480464 Lipopolysaccharides results in increased expression of MME mRNA CTD PMID:12738685 Mme Rat lipopolysaccharide decreases expression ISO RGD:734285 6480464 Lipopolysaccharides results in decreased expression of MME mRNA; Lipopolysaccharides results in decreased expression of MME more ... CTD PMID:12057914|PMID:21114838 Mme Rat melatonin multiple interactions EXP 6480464 Melatonin inhibits the reaction [Aluminum Chloride results in decreased expression of MME protein] CTD PMID:33130240 Mme Rat mercury atom multiple interactions ISO RGD:737353 6480464 Mercury affects the folding of and results in decreased activity of MME protein CTD PMID:25673500 Mme Rat mercury atom increases expression ISO RGD:737353 6480464 Mercury results in increased expression of MME protein CTD PMID:25673500 Mme Rat mercury(0) multiple interactions ISO RGD:737353 6480464 Mercury affects the folding of and results in decreased activity of MME protein CTD PMID:25673500 Mme Rat mercury(0) increases expression ISO RGD:737353 6480464 Mercury results in increased expression of MME protein CTD PMID:25673500 Mme Rat metformin decreases expression EXP 6480464 Metformin results in decreased expression of MME mRNA CTD PMID:31324951 Mme Rat methapyrilene increases methylation ISO RGD:737353 6480464 Methapyrilene results in increased methylation of MME intron CTD PMID:30157460 Mme Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of MME mRNA CTD PMID:30047161 Mme Rat mitomycin C affects response to substance ISO RGD:737353 6480464 MME protein affects the susceptibility to Mitomycin CTD PMID:16217747 Mme Rat morphine multiple interactions EXP 6480464 Naloxone inhibits the reaction [Morphine results in increased activity of MME protein]; phosphoramidon inhibits the more ... CTD PMID:10070497 Mme Rat morphine increases activity EXP 6480464 Morphine results in increased activity of MME protein CTD PMID:10070497 Mme Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in decreased expression of MME mRNA CTD PMID:18164116 Mme Rat naloxone multiple interactions EXP 6480464 Naloxone inhibits the reaction [Morphine results in increased activity of MME protein] CTD PMID:10070497 Mme Rat Naltrindole multiple interactions EXP 6480464 naltrindole inhibits the reaction [[Thiorphan binds to and results in decreased activity of MME protein] more ... CTD PMID:19279569 Mme Rat niclosamide decreases expression ISO RGD:737353 6480464 Niclosamide results in decreased expression of MME mRNA; Niclosamide results in decreased expression of MME more ... CTD PMID:29480568 Mme Rat nicotine increases expression ISO RGD:737353 6480464 Nicotine results in increased expression of MME mRNA CTD PMID:23825647 Mme Rat ochratoxin A decreases expression EXP 6480464 ochratoxin A results in decreased expression of MME mRNA CTD PMID:12700408 Mme Rat okadaic acid decreases expression ISO RGD:737353 6480464 Okadaic Acid results in decreased expression of MME mRNA CTD PMID:38832940 Mme Rat omapatrilat decreases activity ISO RGD:737353 6480464 omapatrilat results in decreased activity of MME protein CTD PMID:18084312 Mme Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of MME mRNA CTD PMID:25729387 Mme Rat oxaliplatin increases expression EXP 6480464 oxaliplatin results in increased expression of MME mRNA CTD PMID:25729387 Mme Rat ozone multiple interactions ISO RGD:737353 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of more ... CTD PMID:32699268|PMID:32845096|PMID:35430440 Mme Rat paracetamol decreases expression ISO RGD:737353 6480464 Acetaminophen results in decreased expression of MME mRNA CTD PMID:29067470 Mme Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of MME mRNA CTD PMID:33387578 Mme Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of MME mRNA CTD PMID:32680482 Mme Rat perfluorohexanesulfonic acid decreases expression ISO RGD:734285 6480464 perfluorohexanesulfonic acid results in decreased expression of MME mRNA CTD PMID:37995155 Mme Rat perfluorooctane-1-sulfonic acid decreases expression ISO RGD:737353 6480464 perfluorooctane sulfonic acid results in decreased expression of MME mRNA CTD PMID:27153767 Mme Rat phenobarbital multiple interactions ISO RGD:734285 6480464 NR1I3 protein affects the reaction [Phenobarbital results in increased expression of MME mRNA] CTD PMID:19482888 Mme Rat phenobarbital affects expression ISO RGD:734285 6480464 Phenobarbital affects the expression of MME mRNA CTD PMID:23091169 Mme Rat phenobarbital increases expression ISO RGD:734285 6480464 Phenobarbital results in increased expression of MME mRNA CTD PMID:19270015|PMID:19482888 Mme Rat phenylmercury acetate multiple interactions ISO RGD:737353 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Mme Rat phorbol 13-acetate 12-myristate decreases expression ISO RGD:737353 6480464 Tetradecanoylphorbol Acetate results in decreased expression of MME protein CTD PMID:16997790 Mme Rat phosphoramidon multiple interactions EXP 6480464 phosphoramidon inhibits the reaction [Morphine results in increased activity of MME protein] CTD PMID:10070497 Mme Rat pioglitazone multiple interactions ISO RGD:734285 6480464 [N-nitroso-tris-chloroethylurea co-treated with pioglitazone] results in decreased expression of MME mRNA CTD PMID:27935865 Mme Rat pirinixic acid decreases expression ISO RGD:734285 6480464 pirinixic acid results in decreased expression of MME mRNA CTD PMID:23811191 Mme Rat potassium chromate increases expression ISO RGD:737353 6480464 potassium chromate(VI) results in increased expression of MME mRNA CTD PMID:22714537 Mme Rat potassium dichromate increases expression ISO RGD:737353 6480464 Potassium Dichromate results in increased expression of MME protein CTD PMID:23718831 Mme Rat pravastatin affects expression EXP 6480464 Pravastatin affects the expression of MME mRNA CTD PMID:27225895 Mme Rat pravastatin decreases expression ISO RGD:734285 6480464 Pravastatin results in decreased expression of MME mRNA CTD PMID:27225895 Mme Rat pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of MME mRNA CTD PMID:19162173 Mme Rat pregnenolone 16alpha-carbonitrile decreases expression ISO RGD:734285 6480464 Pregnenolone Carbonitrile results in decreased expression of MME mRNA CTD PMID:22698814 Mme Rat pregnenolone 16alpha-carbonitrile multiple interactions ISO RGD:734285 6480464 NR1I2 protein promotes the reaction [Pregnenolone Carbonitrile results in decreased expression of MME mRNA] CTD PMID:22698814 Mme Rat progesterone decreases expression ISO RGD:737353 6480464 Progesterone results in decreased expression of MME mRNA CTD PMID:18070364 Mme Rat progesterone increases expression ISO RGD:737353 6480464 Progesterone results in increased expression of MME mRNA CTD PMID:21795739 Mme Rat progesterone affects expression ISO RGD:734285 6480464 Progesterone affects the expression of MME mRNA CTD PMID:17251523 Mme Rat propiconazole decreases expression ISO RGD:734285 6480464 propiconazole results in decreased expression of MME mRNA CTD PMID:21278054 Mme Rat resveratrol increases activity ISO RGD:737353 6480464 resveratrol results in increased activity of MME protein CTD PMID:16162502 Mme Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO RGD:737353 6480464 [S-(1,2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of MME mRNA CTD PMID:35811015 Mme Rat S-(1,2-dichlorovinyl)-L-cysteine decreases expression ISO RGD:737353 6480464 S-(1,2-dichlorovinyl)cysteine results in decreased expression of MME mRNA CTD PMID:35811015 Mme Rat S-nitroso-N-acetyl-D-penicillamine decreases expression EXP 6480464 S-Nitroso-N-Acetylpenicillamine results in decreased expression of MME mRNA CTD PMID:12102619 Mme Rat SB 431542 multiple interactions ISO RGD:737353 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Mme Rat selenium atom multiple interactions EXP 6480464 Selenium deficiency affects the expression of and affects the localization of MME protein CTD PMID:17109141 Mme Rat silicon dioxide decreases expression ISO RGD:737353 6480464 Silicon Dioxide analog results in decreased expression of MME protein CTD PMID:24831964 Mme Rat silicon dioxide decreases expression ISO RGD:734285 6480464 Silicon Dioxide analog results in decreased expression of MME protein CTD PMID:24831964 Mme Rat sodium arsenate multiple interactions ISO RGD:737353 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of MME more ... CTD PMID:32525701 Mme Rat sodium arsenite increases expression ISO RGD:737353 6480464 sodium arsenite results in increased expression of MME mRNA CTD PMID:22714537|PMID:34032870 Mme Rat sodium arsenite decreases expression ISO RGD:737353 6480464 sodium arsenite results in decreased expression of MME mRNA CTD PMID:35954277 Mme Rat sodium fluoride increases expression ISO RGD:734285 6480464 Sodium Fluoride results in increased expression of MME protein CTD PMID:28918527 Mme Rat streptozocin multiple interactions EXP 6480464 Trientine inhibits the reaction [Streptozocin results in decreased expression of MME protein] CTD PMID:19634143 Mme Rat streptozocin decreases expression EXP 6480464 Streptozocin results in decreased expression of MME protein CTD PMID:19634143 Mme Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of MME mRNA CTD PMID:30047161 Mme Rat sulforaphane decreases expression ISO RGD:734285 6480464 sulforaphane results in decreased expression of MME mRNA CTD PMID:30529165 Mme Rat tamoxifen affects expression ISO RGD:734285 6480464 Tamoxifen affects the expression of MME mRNA CTD PMID:20937368 Mme Rat temozolomide decreases expression ISO RGD:737353 6480464 Temozolomide results in decreased expression of MME mRNA CTD PMID:31758290 Mme Rat tert-butyl hydroperoxide increases expression ISO RGD:737353 6480464 tert-Butylhydroperoxide results in increased expression of MME mRNA CTD PMID:15336504 Mme Rat testosterone decreases expression ISO RGD:734285 6480464 Testosterone results in decreased expression of MME mRNA CTD PMID:21669218 Mme Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of MME protein CTD PMID:16449355 Mme Rat tetrachloromethane decreases expression ISO RGD:734285 6480464 Carbon Tetrachloride results in decreased expression of MME mRNA CTD PMID:31919559 Mme Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of MME mRNA CTD PMID:30723492 Mme Rat thalidomide decreases expression ISO RGD:734285 6480464 Thalidomide results in decreased expression of MME mRNA CTD PMID:26217789 Mme Rat thiacloprid increases expression EXP 6480464 thiacloprid results in increased expression of MME mRNA CTD PMID:33426623 Mme Rat thiacloprid multiple interactions EXP 6480464 [thiacloprid co-treated with clothianidin] results in increased expression of MME mRNA; [thiacloprid co-treated with enilconazole] more ... CTD PMID:33426623 Mme Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of MME mRNA CTD PMID:23411599 Mme Rat Thiorphan decreases activity EXP 1581744 Thiorphan decreases activity of Mme protein in osteoblasts RGD Mme Rat Thiorphan decreases activity EXP 6480464 Thiorphan results in decreased activity of MME protein CTD PMID:3481337|PMID:3519939 Mme Rat Thiorphan decreases activity ISO RGD:734285 6480464 Thiorphan results in decreased activity of MME protein CTD PMID:3519939 Mme Rat Thiorphan multiple interactions ISO RGD:737353 6480464 [Thiorphan results in decreased activity of MME protein] which affects the activity of AKT1 protein CTD PMID:16405511 Mme Rat Thiorphan multiple interactions EXP 6480464 [Thiorphan binds to and results in decreased activity of MME protein] which results in increased more ... CTD PMID:19279569 Mme Rat Thiorphan decreases activity ISO RGD:737353 6480464 Thiorphan results in decreased activity of MME protein CTD PMID:16405511 Mme Rat titanium dioxide multiple interactions ISO RGD:734285 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of MME more ... CTD PMID:29950665 Mme Rat titanium dioxide decreases expression ISO RGD:734285 6480464 titanium dioxide results in decreased expression of MME mRNA CTD PMID:35295148 Mme Rat titanium dioxide decreases methylation ISO RGD:734285 6480464 titanium dioxide results in decreased methylation of MME gene; titanium dioxide results in decreased methylation more ... CTD PMID:35295148 Mme Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of MME mRNA CTD PMID:25729387 Mme Rat topotecan increases expression EXP 6480464 Topotecan results in increased expression of MME mRNA CTD PMID:25729387 Mme Rat tributylstannane increases expression ISO RGD:734285 6480464 tributyltin results in increased expression of MME mRNA CTD PMID:31939706 Mme Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of MME mRNA CTD PMID:33387578 Mme Rat trichostatin A increases expression ISO RGD:737353 6480464 trichostatin A results in increased expression of MME mRNA CTD PMID:24935251 Mme Rat triclosan increases expression ISO RGD:737353 6480464 Triclosan results in increased expression of MME mRNA CTD PMID:30510588 Mme Rat trimellitic anhydride increases expression ISO RGD:734285 6480464 trimellitic anhydride results in increased expression of MME mRNA CTD PMID:19042947 Mme Rat triphenyl phosphate decreases expression EXP 6480464 triphenyl phosphate results in decreased expression of MME mRNA CTD PMID:30589522 Mme Rat triphenyl phosphate affects expression ISO RGD:737353 6480464 triphenyl phosphate affects the expression of MME mRNA CTD PMID:37042841 Mme Rat Triptolide decreases expression ISO RGD:734285 6480464 triptolide results in decreased expression of MME mRNA CTD PMID:32835833 Mme Rat Triptolide increases expression EXP 6480464 triptolide results in increased expression of MME protein CTD PMID:32519852 Mme Rat troglitazone increases expression ISO RGD:734285 6480464 troglitazone results in increased expression of MME mRNA CTD PMID:28973697 Mme Rat valproic acid multiple interactions ISO RGD:737353 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of MME mRNA; [NOG protein co-treated more ... CTD PMID:17183730|PMID:27188386 Mme Rat valproic acid increases expression ISO RGD:737353 6480464 Valproic Acid results in increased expression of MME mRNA CTD PMID:23179753|PMID:24383497|PMID:26272509|PMID:28001369 Mme Rat vincaleukoblastine affects response to substance ISO RGD:737353 6480464 MME protein affects the susceptibility to Vinblastine CTD PMID:16217747 Mme Rat XL147 multiple interactions ISO RGD:734285 6480464 [N-nitroso-tris-chloroethylurea co-treated with XL147] results in decreased expression of MME mRNA CTD PMID:27935865 Mme Rat zaragozic acid A increases expression EXP 6480464 squalestatin 1 results in increased expression of MME mRNA CTD PMID:27225895 Mme Rat zaragozic acid A decreases expression ISO RGD:734285 6480464 squalestatin 1 results in decreased expression of MME mRNA CTD PMID:27225895
Biological Process
Only show annotations with direct experimental evidence (0 objects hidden)
Mme Rat amygdala development acts_upstream_of_or_within ISO RGD:734285 1624291 MGI:102676 PMID:25991605 RGD PMID:25991605 Mme Rat amyloid-beta clearance involved_in IDA 13210538 PMID:19406747 ARUK-UCL Mme Rat amyloid-beta clearance involved_in IBA MGI:97004|PANTHER:PTN002620858|RGD:3098|UniProtKB:P08473 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Mme Rat amyloid-beta clearance involved_in ISO RGD:734285 1624291 UniProtKB:P05067 PMID:16636059 RGD PMID:16636059 Mme Rat amyloid-beta clearance involved_in IEA UniProtKB:Q61391|ensembl:ENSMUSP00000142205 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Mme Rat amyloid-beta clearance involved_in ISO RGD:737353 1624291 UniProtKB:Q61391 PMID:12657655, PMID:14749444, PMID:15100223, PMID:19057576 RGD PMID:12657655|PMID:14749444|PMID:15100223|PMID:19057576 Mme Rat amyloid-beta clearance involved_in IEA UniProtKB:P08473|ensembl:ENSP00000353679 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Mme Rat amyloid-beta clearance by cellular catabolic process involved_in ISO RGD:737353 1624291 UniProtKB:P05067 PMID:15100223, PMID:24825898 RGD PMID:15100223|PMID:24825898 Mme Rat amyloid-beta clearance by cellular catabolic process involved_in IEA UniProtKB:P08473|ensembl:ENSP00000353679 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Mme Rat amyloid-beta clearance by cellular catabolic process involved_in IMP 13825436 PMID:18941241 ARUK-UCL Mme Rat amyloid-beta metabolic process involved_in ISS UniProtKB:Q61391 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Mme Rat amyloid-beta metabolic process acts_upstream_of_or_within IEA UniProtKB:Q61391|ensembl:ENSMUSP00000142205 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Mme Rat amyloid-beta metabolic process acts_upstream_of_or_within ISO RGD:734285 1624291 MGI:102676 PMID:12074840, PMID:25991605 RGD PMID:12074840|PMID:25991605 Mme Rat angiotensin maturation involved_in ISO RGD:734285 1624291 MGI:1917258|MGI:2137696 PMID:27649628, PMID:28559246 RGD PMID:27649628|PMID:28559246 Mme Rat angiotensin maturation involved_in IEA UniProtKB:Q61391|ensembl:ENSMUSP00000142205 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Mme Rat bradykinin catabolic process involved_in IEA UniProtKB:P08473|ensembl:ENSP00000353679 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Mme Rat bradykinin catabolic process involved_in ISO RGD:737353 1624291 PMID:6349683 RGD PMID:6349683 Mme Rat bradykinin catabolic process involved_in ISS UniProtKB:P08473 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Mme Rat cellular response to cytokine stimulus involved_in ISS UniProtKB:P08473 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Mme Rat cellular response to cytokine stimulus involved_in IEA UniProtKB:P08473|ensembl:ENSP00000353679 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Mme Rat cellular response to cytokine stimulus involved_in ISO RGD:737353 1624291 PMID:20876573 RGD PMID:20876573 Mme Rat cellular response to UV-A involved_in ISS UniProtKB:P08473 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Mme Rat cellular response to UV-A involved_in IEA UniProtKB:P08473|ensembl:ENSP00000353679 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Mme Rat cellular response to UV-A involved_in ISO RGD:737353 1624291 PMID:20876573 RGD PMID:20876573 Mme Rat cellular response to UV-B involved_in ISS UniProtKB:P08473 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Mme Rat cellular response to UV-B involved_in IEA UniProtKB:P08473|ensembl:ENSP00000353679 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Mme Rat cellular response to UV-B involved_in ISO RGD:737353 1624291 PMID:20876573 RGD PMID:20876573 Mme Rat creatinine metabolic process involved_in ISS UniProtKB:P08473 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Mme Rat creatinine metabolic process involved_in IEA UniProtKB:P08473|ensembl:ENSP00000353679 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Mme Rat creatinine metabolic process involved_in ISO RGD:737353 1624291 PMID:22024547 RGD PMID:22024547 Mme Rat hippocampus development acts_upstream_of_or_within ISO RGD:734285 1624291 MGI:102676 PMID:25991605 RGD PMID:25991605 Mme Rat hormone catabolic process involved_in ISS UniProtKB:P08473 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Mme Rat hormone catabolic process involved_in ISO RGD:737353 1624291 PMID:6349683 RGD PMID:6349683 Mme Rat hormone catabolic process involved_in IEA UniProtKB:P08473|ensembl:ENSP00000353679 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Mme Rat kidney development IEP 13801036 RGD Mme Rat kidney development involved_in ISO RGD:737353 1624291 PMID:22272689 RGD PMID:22272689 Mme Rat kidney development involved_in IEA UniProtKB:P08473|ensembl:ENSP00000353679 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Mme Rat kidney development involved_in ISS UniProtKB:P08473 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Mme Rat learning or memory involved_in IEA UniProtKB:P08473|ensembl:ENSP00000353679 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Mme Rat learning or memory involved_in ISO RGD:737353 1624291 UniProtKB:P05067 PMID:24825898 RGD PMID:24825898 Mme Rat lung development IEP 13801036 RGD Mme Rat memory acts_upstream_of_or_within ISO RGD:734285 1624291 MGI:102676 PMID:25991605 RGD PMID:25991605 Mme Rat multicellular organism growth acts_upstream_of_or_within ISO RGD:734285 1624291 MGI:102676 PMID:25991605 RGD PMID:25991605 Mme Rat neuropeptide processing involved_in ISO RGD:737353 1624291 UniProtKB:P05067 PMID:24825898 RGD PMID:24825898 Mme Rat neuropeptide processing involved_in IEA UniProtKB:P08473|ensembl:ENSP00000353679 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Mme Rat peptide metabolic process IMP 1581953 RGD Mme Rat placenta development IEP 13801036 RGD Mme Rat positive regulation of long-term synaptic potentiation involved_in IEA UniProtKB:Q61391|ensembl:ENSMUSP00000142205 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Mme Rat positive regulation of long-term synaptic potentiation involved_in ISO RGD:734285 1624291 UniProtKB:P05067 PMID:16636059 RGD PMID:16636059 Mme Rat positive regulation of neurogenesis involved_in ISO RGD:737353 1624291 UniProtKB:P05067 PMID:24825898 RGD PMID:24825898 Mme Rat positive regulation of neurogenesis involved_in IEA UniProtKB:P08473|ensembl:ENSP00000353679 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Mme Rat protein catabolic process IDA 1600807 RGD Mme Rat protein catabolic process IDA 1581744 RGD Mme Rat protein processing involved_in IBA MGI:97004|PANTHER:PTN000199753|RGD:620293|UniProtKB:P08473|UniProtKB:P0DPD6|UniProtKB:P42891|UniProtKB:P42892 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Mme Rat proteolysis involved_in ISO RGD:737353 1624291 UniProtKB:Q61391 PMID:14749444, PMID:15100223, PMID:18539150, PMID:18602473, PMID:19057576, PMID:20876573, PMID:24825898, PMID:27588448, PMID:8168535 RGD PMID:14749444|PMID:15100223|PMID:18539150|PMID:18602473|PMID:19057576|PMID:20876573|PMID:24825898|PMID:27588448|PMID:8168535 Mme Rat proteolysis involved_in IEA InterPro:IPR000718|InterPro:IPR008753|InterPro:IPR018497 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Mme Rat proteolysis involved_in IEA UniProtKB:P08473|ensembl:ENSP00000353679 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Mme Rat proteolysis involved_in IEA UniProtKB-KW:KW-0645 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Mme Rat replicative senescence involved_in ISS UniProtKB:P08473 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Mme Rat replicative senescence involved_in IEA UniProtKB:P08473|ensembl:ENSP00000353679 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Mme Rat replicative senescence involved_in ISO RGD:737353 1624291 PMID:20876573 RGD PMID:20876573 Mme Rat response to estrogen IDA 1600807 RGD Mme Rat sensory perception of pain involved_in ISO RGD:734285 1624291 PMID:9751784 RGD PMID:9751784 Mme Rat sensory perception of pain involved_in IEA UniProtKB:Q61391|ensembl:ENSMUSP00000142205 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Mme Rat sensory perception of pain involved_in ISS UniProtKB:Q61391 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Mme Rat substance P catabolic process involved_in ISS UniProtKB:P08473 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Mme Rat substance P catabolic process involved_in ISO RGD:737353 1624291 PMID:6208535 RGD PMID:6208535 Mme Rat substance P catabolic process involved_in IEA UniProtKB:P08473|ensembl:ENSP00000353679 1600115 GO_REF:0000107 Ensembl GO_REF:0000107
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
Mme Rat cardiolipin binding enables ISO RGD:737353 1624291 PMID:22183801 RGD PMID:22183801 Mme Rat cardiolipin binding enables IEA UniProtKB:P08473|ensembl:ENSP00000353679 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Mme Rat endopeptidase activity enables ISO RGD:737353 1624291 UniProtKB:Q61391 PMID:14749444, PMID:15100223, PMID:15283675, PMID:18539150, PMID:19057576, PMID:20876573, PMID:24825898, PMID:2531377, PMID:8168535 RGD PMID:14749444|PMID:15100223|PMID:15283675|PMID:18539150|PMID:19057576|PMID:20876573|PMID:24825898|PMID:2531377|PMID:8168535 Mme Rat endopeptidase activity enables IEA UniProtKB:P08473|ensembl:ENSP00000353679 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Mme Rat exopeptidase activity enables ISO RGD:737353 1624291 PMID:6208535 RGD PMID:6208535 Mme Rat exopeptidase activity enables IEA UniProtKB:P08473|ensembl:ENSP00000353679 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Mme Rat hydrolase activity enables IEA UniProtKB-KW:KW-0378 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Mme Rat metal ion binding enables IEA UniProtKB-KW:KW-0479 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Mme Rat metallocarboxypeptidase activity enables ISO RGD:734285 1624291 MGI:2137696 PMID:28559246 RGD PMID:28559246 Mme Rat metallocarboxypeptidase activity enables IEA UniProtKB:Q61391|ensembl:ENSMUSP00000142205 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Mme Rat metalloendopeptidase activity enables ISS UniProtKB:P08473 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Mme Rat metalloendopeptidase activity enables IEA InterPro:IPR000718|InterPro:IPR018497 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Mme Rat metalloendopeptidase activity enables IBA FB:FBgn0027570|MGI:1343461|PANTHER:PTN000199753|RGD:1309299|UniProtKB:P08473|UniProtKB:P0DPD6|UniProtKB:P0DPE2|UniProtKB:P23276|UniProtKB:P42891 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Mme Rat metalloendopeptidase activity enables IEA UniProtKB:P08473|ensembl:ENSP00000353679 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Mme Rat metalloendopeptidase activity enables ISO RGD:737353 1624291 PMID:15283675, PMID:2521388, PMID:27588448, PMID:6208535, PMID:6349683 RGD PMID:15283675|PMID:2521388|PMID:27588448|PMID:6208535|PMID:6349683 Mme Rat metalloendopeptidase activity enables IEA EC:3.4.24.11 1600115 GO_REF:0000003 UniProt GO_REF:0000003 Mme Rat metallopeptidase activity enables ISO RGD:734285 1624291 MGI:1917258 PMID:27649628 RGD PMID:27649628 Mme Rat metallopeptidase activity enables IEA InterPro:IPR024079 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Mme Rat metallopeptidase activity enables IEA UniProtKB:Q61391|ensembl:ENSMUSP00000142205 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Mme Rat metallopeptidase activity enables IEA UniProtKB-KW:KW-0482 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Mme Rat oligopeptidase activity IDA 13801015 RGD Mme Rat peptidase activity enables IEA UniProtKB-KW:KW-0645 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Mme Rat peptidase activity enables IEA UniProtKB:Q61391|ensembl:ENSMUSP00000142205 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Mme Rat peptidase activity enables ISO RGD:734285 1624291 PMID:15944124 RGD PMID:15944124 Mme Rat peptide binding IDA 1600807 RGD Mme Rat phosphatidylserine binding enables ISO RGD:737353 1624291 PMID:22183801 RGD PMID:22183801 Mme Rat phosphatidylserine binding enables IEA UniProtKB:P08473|ensembl:ENSP00000353679 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Mme Rat protein binding enables ISO RGD:737353 1624291 UniProtKB:P04792|UniProtKB:P05067|UniProtKB:P21926|UniProtKB:Q06787-7 PMID:17342744, PMID:23289620, PMID:32814053 RGD PMID:17342744|PMID:23289620|PMID:32814053 Mme Rat protein homodimerization activity enables ISO RGD:737353 1624291 UniProtKB:P08473 PMID:22183801 RGD PMID:22183801 Mme Rat protein homodimerization activity enables IEA UniProtKB:P08473|ensembl:ENSP00000353679 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Mme Rat zinc ion binding enables ISS UniProtKB:P08473 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Mme Rat zinc ion binding enables ISO RGD:737353 1624291 PMID:8168535 RGD PMID:8168535 Mme Rat zinc ion binding enables IEA UniProtKB:P08473|ensembl:ENSP00000353679 1600115 GO_REF:0000107 Ensembl GO_REF:0000107
Imported Annotations - KEGG (archival)
(S)-nicotine (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (EXP,ISO) 1-naphthyl isothiocyanate (EXP) 17beta-estradiol (ISO) 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,2,2-tetramine (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine (EXP) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3,3',5,5'-tetrabromobisphenol A (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-chloropropane-1,2-diol (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) 7,12-dimethyltetraphene (EXP) 8-Br-cAMP (ISO) acrolein (ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) agmatine (ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) amitrole (EXP) ammonium chloride (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) Azoxymethane (ISO) Benoxacor (ISO) benzo[a]pyrene (EXP,ISO) benzo[e]pyrene (ISO) beta-lapachone (ISO) beta-naphthoflavone (EXP) bicalutamide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) Butylbenzyl phthalate (ISO) cadmium atom (EXP) cadmium dichloride (EXP) candoxatrilat (ISO) carbon nanotube (ISO) ceftriaxone (EXP) CGP 52608 (ISO) chlordecone (ISO) chlorpyrifos (ISO) cisplatin (EXP,ISO) clothianidin (EXP) cobalt dichloride (ISO) cocaine (EXP) copper atom (EXP) copper(0) (EXP) copper(II) chloride (ISO) crocidolite asbestos (ISO) curcumin (ISO) cyclosporin A (ISO) D-glucose (ISO) DDT (EXP,ISO) dextran sulfate (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) diclofenac (ISO) diethyl phthalate (ISO) diisobutyl phthalate (ISO) diisononyl phthalate (ISO) dioxygen (EXP,ISO) dorsomorphin (ISO) doxorubicin (ISO) elemental selenium (EXP) endosulfan (EXP) enilconazole (EXP) entinostat (ISO) estrogen (EXP) ethanol (ISO) fipronil (EXP) fisetin (ISO) flavonoids (EXP) folic acid (ISO) FR900359 (ISO) fulvestrant (ISO) gentamycin (EXP) glucose (ISO) hydralazine (ISO) L-ascorbic acid (EXP) lead(0) (ISO) lipopolysaccharide (EXP,ISO) melatonin (EXP) mercury atom (ISO) mercury(0) (ISO) metformin (EXP) methapyrilene (ISO) methimazole (EXP) mitomycin C (ISO) morphine (EXP) N-nitrosodiethylamine (EXP) naloxone (EXP) Naltrindole (EXP) niclosamide (ISO) nicotine (ISO) ochratoxin A (EXP) okadaic acid (ISO) omapatrilat (ISO) oxaliplatin (EXP) ozone (ISO) paracetamol (EXP,ISO) paraquat (EXP) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) phenylmercury acetate (ISO) phorbol 13-acetate 12-myristate (ISO) phosphoramidon (EXP) pioglitazone (ISO) pirinixic acid (ISO) potassium chromate (ISO) potassium dichromate (ISO) pravastatin (EXP,ISO) pregnenolone 16alpha-carbonitrile (EXP,ISO) progesterone (ISO) propiconazole (ISO) resveratrol (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) S-nitroso-N-acetyl-D-penicillamine (EXP) SB 431542 (ISO) selenium atom (EXP) silicon dioxide (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sodium fluoride (ISO) streptozocin (EXP) sulfadimethoxine (EXP) sulforaphane (ISO) tamoxifen (ISO) temozolomide (ISO) tert-butyl hydroperoxide (ISO) testosterone (ISO) tetrachloromethane (EXP,ISO) thalidomide (ISO) thiacloprid (EXP) thioacetamide (EXP) Thiorphan (EXP,ISO) titanium dioxide (ISO) topotecan (EXP) tributylstannane (ISO) trichloroethene (EXP) trichostatin A (ISO) triclosan (ISO) trimellitic anhydride (ISO) triphenyl phosphate (EXP,ISO) Triptolide (EXP,ISO) troglitazone (ISO) valproic acid (ISO) vincaleukoblastine (ISO) XL147 (ISO) zaragozic acid A (EXP,ISO)
Biological Process
amygdala development (ISO) amyloid-beta clearance (IBA,IDA,IEA,ISO) amyloid-beta clearance by cellular catabolic process (IEA,IMP,ISO) amyloid-beta metabolic process (IEA,ISO,ISS) angiotensin maturation (IEA,ISO) bradykinin catabolic process (IEA,ISO,ISS) cellular response to cytokine stimulus (IEA,ISO,ISS) cellular response to UV-A (IEA,ISO,ISS) cellular response to UV-B (IEA,ISO,ISS) creatinine metabolic process (IEA,ISO,ISS) hippocampus development (ISO) hormone catabolic process (IEA,ISO,ISS) kidney development (IEA,IEP,ISO,ISS) learning or memory (IEA,ISO) lung development (IEP) memory (ISO) multicellular organism growth (ISO) neuropeptide processing (IEA,ISO) peptide metabolic process (IMP) placenta development (IEP) positive regulation of long-term synaptic potentiation (IEA,ISO) positive regulation of neurogenesis (IEA,ISO) protein catabolic process (IDA) protein processing (IBA) proteolysis (IEA,ISO) replicative senescence (IEA,ISO,ISS) response to estrogen (IDA) sensory perception of pain (IEA,ISO,ISS) substance P catabolic process (IEA,ISO,ISS)
Cellular Component
axon (IEA,ISO,ISS) brush border (IEA,ISO,ISS) centrosome (IEA,ISO) ciliary basal body (IEA,ISO) cytoplasm (IEA,ISO,ISS) cytoplasmic vesicle (IEA,ISO) cytosol (IEA,ISO) dendrite (IEA,ISO,ISS) early endosome (IEA,ISO) extracellular region (IEA,ISO) membrane (IEA,ISO) membrane raft (IEA,ISO) neuron projection terminus (IEA,ISO,ISS) neuronal cell body (IEA,ISO) nucleoplasm (IEA,ISO) plasma membrane (IBA,IEA,ISO,ISS) presynapse (IEA,ISO) synapse (IEA,ISO,ISS) synaptic vesicle (IEA,ISO,ISS) trans-Golgi network (IEA,ISO)
Molecular Function
cardiolipin binding (IEA,ISO) endopeptidase activity (IEA,ISO) exopeptidase activity (IEA,ISO) hydrolase activity (IEA) metal ion binding (IEA) metallocarboxypeptidase activity (IEA,ISO) metalloendopeptidase activity (IBA,IEA,ISO,ISS) metallopeptidase activity (IEA,ISO) oligopeptidase activity (IDA) peptidase activity (IEA,ISO) peptide binding (IDA) phosphatidylserine binding (IEA,ISO) protein binding (ISO) protein homodimerization activity (IEA,ISO) zinc ion binding (IEA,ISO,ISS)
1.
Differential response of neutral endopeptidase 24.11 ("enkephalinase"), and cholinergic and opioidergic markers to hypoglossal axotomy.
Back SA and Gorenstein C, J Comp Neurol. 1994 Feb 8;340(2):149-60. doi: 10.1002/cne.903400202.
2.
Evaluation of neprilysin sequence variation in relation to CSF ß-Amyloid levels and Alzheimer disease risk.
Blomqvist ME, etal., Int J Mol Epidemiol Genet. 2010 Oct 15;1(1):47-52.
3.
Hypoxia decreases lung neprilysin expression and increases pulmonary vascular leak.
Carpenter TC and Stenmark KR, Am J Physiol Lung Cell Mol Physiol. 2001 Oct;281(4):L941-8. doi: 10.1152/ajplung.2001.281.4.L941.
4.
Release of angiotensin-(1-7) from the rat hindlimb: influence of angiotensin-converting enzyme inhibition.
Chappell MC, etal., Hypertension. 2000 Jan;35(1 Pt 2):348-52.
5.
Role of truncating mutations in MME gene in fetomaternal alloimmunisation and antenatal glomerulopathies.
Debiec H, etal., Lancet. 2004 Oct 2-8;364(9441):1252-9.
6.
Mapping of a quantitative trait locus for blood pressure on rat chromosome 2.
Deng AY, etal., J Clin Invest 1994 Jul;94(1):431-6
7.
A combination Alzheimer's therapy targeting BACE1 and neprilysin in 5XFAD transgenic mice.
Devi L and Ohno M, Mol Brain. 2015 Mar 25;8:19. doi: 10.1186/s13041-015-0110-5.
8.
Increased expression of neprilysin (neutral endopeptidase 24.11) in rat and human hepatocellular carcinomas.
Dragovic T, etal., Lab Invest. 1994 Jan;70(1):107-13.
9.
Pre- and post-natal ontogeny of neutral endopeptidase 24-11 ('enkephalinase') studied by in vitro autoradiography in the rat.
Dutriez I, etal., Experientia. 1992 Mar 15;48(3):290-300.
10.
Possible role of resveratrol targeting estradiol and neprilysin pathways in lipopolysaccharide model of Alzheimer disease.
El-Sayed NS and Bayan Y, Adv Exp Med Biol. 2015;822:107-18. doi: 10.1007/978-3-319-08927-0_12.
11.
Abeta-degrading endopeptidase, neprilysin, in mouse brain: synaptic and axonal localization inversely correlating with Abeta pathology.
Fukami S, etal., Neurosci Res. 2002 May;43(1):39-56.
12.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
13.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
14.
Estrogen regulates neprilysin activity in rat brain.
Huang J, etal., Neurosci Lett. 2004 Aug 26;367(1):85-7.
15.
Reaction of neutral endopeptidase 24.11 (enkephalinase) with arginine reagents.
Jackson DG and Hersh LB, J Biol Chem. 1986 Jul 5;261(19):8649-54.
16.
Increased expression of renal neutral endopeptidase in severe heart failure.
Knecht M, etal., Life Sci. 2002 Oct 25;71(23):2701-12.
17.
Accumulation of murine amyloid-ß mimics early Alzheimer's disease.
Krohn M, etal., Brain. 2015 Aug;138(Pt 8):2370-82. doi: 10.1093/brain/awv137. Epub 2015 May 18.
18.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
19.
Improved radiation hybrid map of rat chromosome 2: colocalization of the genes encoding corticotropin-releasing hormone and IL6-receptor with quantitative trait loci regulating the inflammatory response.
Laes JF, etal., Cytogenet Cell Genet 2001;92(1-2):130-3.
20.
Targeting the renin-angiotensin system: what's new?
Leckie BJ Curr Med Chem Cardiovasc Hematol Agents. 2005 Jan;3(1):23-32.
21.
No association between polymorphisms in the neprilysin promoter region and Swedish Alzheimer's disease patients.
Lilius L, etal., Neurosci Lett. 2003 Feb 6;337(2):111-3.
22.
The Association of MME microRNA Binding Site Polymorphism with the Risk of Late Onset Alzheimer's Disease in Northern Han Chinese.
Liu CX, etal., Curr Neurovasc Res. 2017;14(2):90-95. doi: 10.2174/1567202614666170313110301.
23.
Molecular cloning and amino acid sequence of rat enkephalinase.
Malfroy B, etal., Biochem Biophys Res Commun 1987 Apr 14;144(1):59-66.
24.
Naloxone-reversible antidiarrheal effects of enkephalinase inhibitors.
Marçais-Collado H, etal., Eur J Pharmacol. 1987 Dec 1;144(2):125-32.
25.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
26.
Neprilysin protects against cerebral amyloid angiopathy and Aß-induced degeneration of cerebrovascular smooth muscle cells.
Miners JS, etal., Brain Pathol. 2011 Sep;21(5):594-605. doi: 10.1111/j.1750-3639.2011.00486.x. Epub 2011 Apr 3.
27.
Decreased expression and activity of neprilysin in Alzheimer disease are associated with cerebral amyloid angiopathy.
Miners JS, etal., J Neuropathol Exp Neurol. 2006 Oct;65(10):1012-21.
28.
Neprilysin and insulin-degrading enzyme levels are increased in Alzheimer disease in relation to disease severity.
Miners JS, etal., J Neuropathol Exp Neurol. 2009 Aug;68(8):902-14. doi: 10.1097/NEN.0b013e3181afe475.
29.
Genetic variation in MME in relation to neprilysin protein and enzyme activity, Aß levels, and Alzheimer's disease risk.
Miners S, etal., Int J Mol Epidemiol Genet. 2012;3(1):30-8. Epub 2012 Feb 5.
30.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
31.
Expression of neprilysin in periodontitis-affected gingival tissues.
Nezu A, etal., Arch Oral Biol. 2017 Jul;79:35-41. doi: 10.1016/j.archoralbio.2017.03.003. Epub 2017 Mar 6.
32.
Dinucleotide repeat polymorphisms in the neprilysin gene are not associated with sporadic Alzheimer's disease.
Oda M, etal., Neurosci Lett. 2002 Mar 1;320(1-2):105-7.
33.
Effects of a selective neutral endopeptidase and a nonselective neutral endopeptidase/endothelin-converting enzyme inhibitor on lipopolysaccharide-induced endotoxaemia in anaesthetized Sprague-Dawley rats.
Pham D, etal., J Cardiovasc Pharmacol. 2000 Nov;36(5 Suppl 1):S362-6.
34.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
35.
Comparison of angiotensin-converting enzyme (ACE), neutral endopeptidase (NEP) and dual ACE/NEP inhibition on blood pressure and resistance arteries of deoxycorticosterone acetate-salt hypertensive rats.
Pu Q, etal., J Hypertens. 2002 May;20(5):899-907.
36.
Intracardiac expression of neutral endopeptidase.
Raizada V, etal., Mol Cell Biochem 2002 Mar;232(1-2):129-31.
37.
A place in our hearts for the lowly angiotensin 1-7 peptide?
Reudelhuber TL Hypertension. 2006 May;47(5):811-5. Epub 2006 Mar 6.
38.
GOA pipeline
RGD automated data pipeline
39.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
40.
Ascorbic acid decreases neutral endopeptidase activity in cultured osteoblastic cells.
Schmid C, etal., Regul Pept. 2005 Aug 15;130(1-2):57-66.
41.
Mutation screening and association study of the neprilysin gene in sporadic Alzheimer's disease in Chinese persons.
Shi J, etal., J Gerontol A Biol Sci Med Sci. 2005 Mar;60(3):301-6.
42.
IL-4-induced selective clearance of oligomeric beta-amyloid peptide(1-42) by rat primary type 2 microglia.
Shimizu E, etal., J Immunol. 2008 Nov 1;181(9):6503-13.
43.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
44.
Association between neprilysin polymorphisms and sporadic Alzheimer's disease.
Wood LS, etal., Neurosci Lett. 2007 Nov 5;427(2):103-6. doi: 10.1016/j.neulet.2007.09.019. Epub 2007 Sep 20.
45.
[Effects of Naoerkang on expressions of beta-amyloid peptide 1-42 and neprilysin in hippocampus in a rat model of Alzheimer's disease].
Yuan HF, etal., Zhong Xi Yi Jie He Xue Bao. 2010 Feb;8(2):152-7.
46.
Insulin receptor dysfunction impairs cellular clearance of neurotoxic oligomeric a{beta}.
Zhao WQ, etal., J Biol Chem. 2009 Jul 10;284(28):18742-53. doi: 10.1074/jbc.M109.011015. Epub 2009 Apr 30.
Mme Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 149,806,826 - 149,957,381 (+) NCBI GRCr8 mRatBN7.2 2 147,686,913 - 147,803,808 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 147,722,086 - 147,803,792 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 154,412,545 - 154,499,268 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 152,461,414 - 152,548,760 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 147,094,065 - 147,181,452 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 153,799,203 - 153,880,910 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 153,803,349 - 153,880,738 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 173,193,501 - 173,278,946 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 153,031,724 - 153,114,515 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 152,981,686 - 153,064,477 (+) NCBI Celera 2 142,009,686 - 142,090,693 (+) NCBI Celera RH 3.4 Map 2 955.0 RGD Cytogenetic Map 2 q31 NCBI
MME Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 155,024,202 - 155,183,729 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 155,024,124 - 155,183,704 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 154,741,991 - 154,901,518 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 156,280,130 - 156,384,212 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 156,280,756 - 156,384,194 NCBI Celera 3 153,217,556 - 153,321,523 (+) NCBI Celera Cytogenetic Map 3 q25.2 NCBI HuRef 3 152,191,860 - 152,295,862 (+) NCBI HuRef CHM1_1 3 154,760,481 - 154,864,540 (+) NCBI CHM1_1 T2T-CHM13v2.0 3 157,798,155 - 157,957,709 (+) NCBI T2T-CHM13v2.0
Mme Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 63,202,632 - 63,291,134 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 63,148,958 - 63,293,451 (+) Ensembl GRCm39 Ensembl GRCm38 3 63,295,211 - 63,383,713 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 63,241,537 - 63,386,030 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 63,099,794 - 63,186,153 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 63,383,801 - 63,470,160 (+) NCBI MGSCv36 mm8 Celera 3 62,969,256 - 63,055,608 (+) NCBI Celera Cytogenetic Map 3 E1 NCBI cM Map 3 29.97 NCBI
Mme Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955448 6,226,059 - 6,314,949 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955448 6,193,113 - 6,311,666 (+) NCBI ChiLan1.0 ChiLan1.0
MME Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 152,997,962 - 153,099,218 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 152,949,064 - 153,103,948 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 152,085,694 - 152,240,148 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 159,637,965 - 160,292,119 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 160,197,566 - 160,292,119 (+) Ensembl panpan1.1 panPan2
MME Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 23 48,966,222 - 49,059,919 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 23 48,971,066 - 49,059,919 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 23 48,843,474 - 48,934,858 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 23 49,596,559 - 49,692,908 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 23 49,593,076 - 49,694,136 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 23 49,187,708 - 49,279,020 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 23 49,238,095 - 49,328,993 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 23 49,521,230 - 49,612,145 (+) NCBI UU_Cfam_GSD_1.0
Mme Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 87,138,054 - 87,220,087 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936519 2,513,704 - 2,595,971 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936519 2,513,896 - 2,595,896 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
MME Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 95,019,081 - 95,126,045 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 95,018,395 - 95,122,977 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 103,025,551 - 103,128,284 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MME Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 15 35,577,460 - 35,681,730 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 15 35,580,714 - 35,633,914 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 8,227,922 - 8,338,216 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Mme
.
Predicted Target Of
Count of predictions: 131 Count of miRNA genes: 97 Interacting mature miRNAs: 125 Transcripts: ENSRNOT00000042576 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1578648 Bss11 Bone structure and strength QTL 11 4.7 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 2 114837527 211674221 Rat 2293671 Bss44 Bone structure and strength QTL 44 10.97 0.0001 lumbar vertebra morphology trait (VT:0010494) lumbar vertebra cortical cross-sectional area (CMO:0001690) 2 43162366 148478373 Rat 631566 Bp90 Blood pressure QTL 90 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 102803808 147803808 Rat 1298074 Bp164 Blood pressure QTL 164 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 6907363 Bp357 Blood pressure QTL 357 4.1 0.002 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 129540907 174540907 Rat 1354648 Bp239 Blood pressure QTL 239 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118463 226797303 Rat 1358360 Sradr2 Stress Responsive Adrenal Weight QTL 2 10.24 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 2 129164097 152195315 Rat 1354649 Kidm17 Kidney mass QTL 17 2.9 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 2 81754530 227146641 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 1298076 Bp166 Blood pressure QTL 166 0.0009 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 136445150 202447032 Rat 152025245 Scl81 Serum cholesterol level QTL 81 3.49 blood cholesterol amount (VT:0000180) 2 122609194 206936711 Rat 1549828 Bp258 Blood pressure QTL 258 0.03 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 142323368 150650069 Rat 631198 Cm22 Cardiac mass QTL 22 4.3 0.0008 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 2 76539322 150540526 Rat 1554319 Bmd2 Bone mineral density QTL 2 13.4 0.0001 lumbar vertebra area (VT:0010570) lumbar vertebra cross-sectional area (CMO:0001689) 2 114837675 212549332 Rat 1581569 Uae32 Urinary albumin excretion QTL 32 0.0001 urine protein amount (VT:0005160) urine albumin excretion rate (CMO:0000757) 2 78665619 219826953 Rat 10043136 Iddm54 Insulin dependent diabetes mellitus QTL 54 3.4 0.0001 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 2 143657411 190602963 Rat 61467 Bp14 Blood pressure QTL 14 2.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 43154682 202446871 Rat 70175 BpQTLCluster3 Blood pressure QTL cluster 3 4.128 arterial blood pressure trait (VT:2000000) absolute change in systolic blood pressure (CMO:0000607) 2 135552573 202446871 Rat 1358901 Cm38 Cardiac mass QTL 38 2 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 1359030 Bp277 Blood pressure QTL 277 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 114837527 185876470 Rat 1331760 Bp206 Blood pressure QTL 206 3.62454 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 56043031 202447032 Rat 1581502 Esta3 Estrogen-induced thymic atrophy QTL 3 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 2 136916935 189599348 Rat 1358899 Kidm23 Kidney mass QTL 23 3.88 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358908 Bw49 Body weight QTL 49 3.36 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 1582257 Gluco21 Glucose level QTL 21 3.1 0.0035 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 118111229 157142209 Rat 1358910 Kidm27 Kidney mass QTL 27 5.77 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358911 Kidm28 Kidney mass QTL 28 5.42 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358904 Cm39 Cardiac mass QTL 39 2.26 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 8662836 Vetf8 Vascular elastic tissue fragility QTL 8 0.66 thoracic aorta molecular composition trait (VT:0010568) aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003) 2 104559726 149559726 Rat 1358887 Bw50 Body weight QTL 50 2.39 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 1298080 Bp163 Blood pressure QTL 163 0.02 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118275 202447032 Rat 8662832 Vetf7 Vascular elastic tissue fragility QTL 7 3.5 aorta elastin amount (VT:0003905) aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002) 2 81689826 221035911 Rat 5135226 Leukc2 Leukocyte quantity QTL 2 eosinophil quantity (VT:0002602) blood eosinophil count (CMO:0000033) 2 118111229 149559726 Rat 1298085 Bp165 Blood pressure QTL 165 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 1358894 Kidm24 Kidney mass QTL 24 4.03 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1359022 Ppulsi1 Prepulse inhibition QTL 1 3.63 prepulse inhibition trait (VT:0003088) acoustic startle response measurement (CMO:0001519) 2 136916935 213594495 Rat 724534 Uae6 Urinary albumin excretion QTL 6 10 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 2 78665619 249053267 Rat 61374 Edpm2 Estrogen-dependent pituitary mass QTL 2 4.42 0.86 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 2 76539322 202447032 Rat 1331794 Bp202 Blood pressure QTL 202 3.66819 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 141194931 223265385 Rat 71113 Cari2 Carrageenan-induced inflammation QTL 2 2.7 0.009 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 2 141596551 202447032 Rat 1331805 Cm29 Cardiac mass QTL 29 3.50746 heart mass (VT:0007028) heart wet weight (CMO:0000069) 2 141194931 223265385 Rat 634308 Sach6 Saccharin preference QTL 6 4.9 taste sensitivity trait (VT:0001986) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 2 112456140 212696837 Rat 1358917 Cm42 Cardiac mass QTL 42 2.82 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 724568 Uae13 Urinary albumin excretion QTL 13 4.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 2 143157029 210020885 Rat 1358913 Cm41 Cardiac mass QTL 41 2.73 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 1300165 Rf9 Renal function QTL 9 3.28 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 2 133914684 202447032 Rat 7488933 Bp368 Blood pressure QTL 368 0.004 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 142323368 147803808 Rat 61401 Niddm2 Non-insulin dependent diabetes mellitus QTL 2 4.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 144599348 189599348 Rat 631507 Bp105 Blood pressure QTL 105 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 112456140 212696837 Rat 738007 Anxrr7 Anxiety related response QTL 7 4.4 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 2 118189491 163189491 Rat 2293835 Kiddil5 Kidney dilation QTL 5 3.8 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 42804607 157142209 Rat 1581552 Pur12 Proteinuria QTL 12 5.19 0.0009 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 2 112103657 148076632 Rat 631520 Bp73 Blood pressure QTL 73 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 147686913 168355276 Rat 1598833 Bp295 Blood pressure QTL 295 3.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 147798556 192798556 Rat 1558653 Prcr1 Prostate cancer resistance QTL 1 5 prostate integrity trait (VT:0010571) area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899) 2 72532993 157142209 Rat 1354622 Kidm16 Kidney mass QTL 16 3 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 2 81754530 222436696 Rat 631266 Bp132 Blood pressure QTL 132 0.0005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 46123260 202447032 Rat 2293843 Kiddil6 Kidney dilation QTL 6 3.1 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 42804607 182042367 Rat 1354594 Despr10 Despair related QTL 10 2e-06 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 2 114654253 159654253 Rat 152025206 Hrtrt23 Heart rate QTL 23 5.98 heart pumping trait (VT:2000009) 2 28484589 169504100 Rat 1354605 Rf48 Renal function QTL 48 2.9 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 2 74786664 206665859 Rat 6903312 Bw112 Body weight QTL 112 3.2 0.0013 body mass (VT:0001259) body weight (CMO:0000012) 2 143657569 184114274 Rat 152025204 Hrtrt22 Heart rate QTL 22 5.6 heart pumping trait (VT:2000009) 2 28484589 169504100 Rat 1354601 Slep1 Serum leptin concentration QTL 1 5.39 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 2 43171017 184114403 Rat
D2Mco32
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 2 149,905,089 - 149,905,413 (+) Marker Load Pipeline Rnor_6.0 2 153,832,556 - 153,832,878 NCBI Rnor6.0 Rnor_5.0 2 173,226,472 - 173,226,794 UniSTS Rnor5.0 RGSC_v3.4 2 153,065,090 - 153,065,413 UniSTS RGSC3.4 RGSC_v3.4 2 153,065,089 - 153,065,413 RGD RGSC3.4 RGSC_v3.1 2 153,015,052 - 153,015,376 RGD Celera 2 142,042,277 - 142,042,642 UniSTS Cytogenetic Map 2 q31 UniSTS
D2Mco33
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 2 149,902,428 - 149,902,672 (+) Marker Load Pipeline mRatBN7.2 2 147,752,777 - 147,753,017 (+) MAPPER mRatBN7.2 Rnor_6.0 2 153,829,897 - 153,830,138 NCBI Rnor6.0 Rnor_5.0 2 173,223,813 - 173,224,054 UniSTS Rnor5.0 RGSC_v3.4 2 153,062,431 - 153,062,672 UniSTS RGSC3.4 RGSC_v3.4 2 153,062,292 - 153,062,721 RGD RGSC3.4 RGSC_v3.1 2 153,012,394 - 153,012,635 RGD Celera 2 142,039,618 - 142,039,859 UniSTS RH 3.4 Map 2 953.8 UniSTS RH 3.4 Map 2 953.8 RGD Cytogenetic Map 2 q31 UniSTS
D2Wox43
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 2 149,905,086 - 149,905,422 (+) Marker Load Pipeline Rnor_6.0 2 153,832,553 - 153,832,887 NCBI Rnor6.0 Rnor_5.0 2 173,226,469 - 173,226,803 UniSTS Rnor5.0 RGSC_v3.4 2 153,065,087 - 153,065,422 UniSTS RGSC3.4 Celera 2 142,042,274 - 142,042,651 UniSTS Cytogenetic Map 2 q31 UniSTS
RH132069
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 147,803,084 - 147,803,304 (+) MAPPER mRatBN7.2 Rnor_6.0 2 153,880,187 - 153,880,406 NCBI Rnor6.0 Rnor_5.0 2 173,274,304 - 173,274,523 UniSTS Rnor5.0 RGSC_v3.4 2 153,113,792 - 153,114,011 UniSTS RGSC3.4 Celera 2 142,089,970 - 142,090,189 UniSTS RH 3.4 Map 2 954.1 UniSTS Cytogenetic Map 2 q31 UniSTS
39.MHAa90d3.seq
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 147,741,027 - 147,741,208 (+) MAPPER mRatBN7.2 Rnor_6.0 2 153,817,767 - 153,817,947 NCBI Rnor6.0 Rnor_5.0 2 173,211,683 - 173,211,863 UniSTS Rnor5.0 RGSC_v3.4 2 153,050,377 - 153,050,557 UniSTS RGSC3.4 Celera 2 142,027,874 - 142,028,054 UniSTS Cytogenetic Map 2 q31 UniSTS
RH94409
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 147,803,242 - 147,803,394 (+) MAPPER mRatBN7.2 Rnor_6.0 2 153,880,345 - 153,880,496 NCBI Rnor6.0 Rnor_5.0 2 173,274,462 - 173,274,613 UniSTS Rnor5.0 RGSC_v3.4 2 153,113,950 - 153,114,101 UniSTS RGSC3.4 Celera 2 142,090,128 - 142,090,279 UniSTS RH 3.4 Map 2 955.0 UniSTS Cytogenetic Map 2 q31 UniSTS
RH140580
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 147,801,884 - 147,802,041 (+) MAPPER mRatBN7.2 Rnor_6.0 2 153,878,987 - 153,879,143 NCBI Rnor6.0 Rnor_5.0 2 173,273,104 - 173,273,260 UniSTS Rnor5.0 RGSC_v3.4 2 153,112,592 - 153,112,748 UniSTS RGSC3.4 Celera 2 142,088,770 - 142,088,926 UniSTS RH 3.4 Map 2 956.1 UniSTS Cytogenetic Map 2 q31 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000042576 ⟹ ENSRNOP00000044578
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 147,722,086 - 147,803,792 (+) Ensembl Rnor_6.0 Ensembl 2 153,830,586 - 153,880,738 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000088565 ⟹ ENSRNOP00000074307
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 2 153,803,349 - 153,879,826 (+) Ensembl
RefSeq Acc Id:
NM_012608 ⟹ NP_036740
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 149,872,497 - 149,953,462 (+) NCBI mRatBN7.2 2 147,722,844 - 147,803,808 (+) NCBI Rnor_6.0 2 153,799,585 - 153,880,910 (+) NCBI Rnor_5.0 2 173,193,501 - 173,278,946 (+) NCBI RGSC_v3.4 2 153,031,724 - 153,114,515 (+) RGD Celera 2 142,009,686 - 142,090,693 (+) RGD
Sequence:
GCCCAGGAGTTCTGTTTGGTGACCGAGAGCAGCGCTGCCAAATTGCACCGGGGTTCATTTGGGGGCTGGGAATTGGCCATTCCGCTGTACAGACACTGTTTTTATTTTAAAAAGCAAGATTTTAGGTG
hide sequence
RefSeq Acc Id:
XM_039101718 ⟹ XP_038957646
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 149,871,446 - 149,957,381 (+) NCBI mRatBN7.2 2 147,721,839 - 147,803,480 (+) NCBI
RefSeq Acc Id:
XM_039101719 ⟹ XP_038957647
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 149,806,826 - 149,957,381 (+) NCBI mRatBN7.2 2 147,686,913 - 147,803,480 (+) NCBI
RefSeq Acc Id:
XM_039101720 ⟹ XP_038957648
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 149,872,249 - 149,953,462 (+) NCBI mRatBN7.2 2 147,722,660 - 147,802,794 (+) NCBI
RefSeq Acc Id:
XM_063281293 ⟹ XP_063137363
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 149,872,011 - 149,957,381 (+) NCBI
RefSeq Acc Id:
NP_036740 ⟸ NM_012608
- UniProtKB:
P07861 (UniProtKB/Swiss-Prot), A6JVN6 (UniProtKB/TrEMBL), A0A0H2UHX5 (UniProtKB/TrEMBL)
- Sequence:
MGRSESQMDITDINAPKPKKKQRWTPLEISLSVLVLLLTIIAVTMIALYATYDDGICKSSDCIKSAARLIQNMDASAEPCTDFFKYACGGWLKRNVIPETSSRYSNFDILRDELEVILKDVLQEPKTE
hide sequence
Ensembl Acc Id:
ENSRNOP00000044578 ⟸ ENSRNOT00000042576
Ensembl Acc Id:
ENSRNOP00000074307 ⟸ ENSRNOT00000088565
RefSeq Acc Id:
XP_038957647 ⟸ XM_039101719
- Peptide Label:
isoform X1
- UniProtKB:
P07861 (UniProtKB/Swiss-Prot), A6JVN6 (UniProtKB/TrEMBL), A0A0H2UHX5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038957646 ⟸ XM_039101718
- Peptide Label:
isoform X1
- UniProtKB:
P07861 (UniProtKB/Swiss-Prot), A6JVN6 (UniProtKB/TrEMBL), A0A0H2UHX5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038957648 ⟸ XM_039101720
- Peptide Label:
isoform X2
- UniProtKB:
A0A0H2UHX5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063137363 ⟸ XM_063281293
- Peptide Label:
isoform X1
- UniProtKB:
P07861 (UniProtKB/Swiss-Prot), A6JVN6 (UniProtKB/TrEMBL), A0A0H2UHX5 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2011-04-11
Mme
membrane metallo-endopeptidase
Mme
membrane metallo endopeptidase
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-02-26
Mme
membrane metallo endopeptidase
Symbol and Name status set to approved
625702 APPROVED
2002-06-10
Mme
membrane metallo endopeptidase
Name updated
70585 PROVISIONAL
Note Type
Note
Reference
gene_domains
contains a single transmembrane spanning domain
729272
gene_process
involved in control of cardiovascular homeostasis
727377
gene_protein
742 amino acids
729272
