Symbol:
Me1
Name:
malic enzyme 1
RGD ID:
3074
Description:
Enables NADP binding activity and malate dehydrogenase (decarboxylating) (NADP+) activity. Involved in response to hormone. Located in cytosol and mitochondrion. Orthologous to human ME1 (malic enzyme 1); PARTICIPATES IN Leigh disease pathway; primary hyperoxaluria type 2 pathway; pyruvate decarboxylase deficiency pathway; INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol; 2,2',4,4'-Tetrabromodiphenyl ether.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
cytosolic malic enzyme 1; malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+); Malic enzyme 1 soluble; malic enzyme 1, NADP(+)-dependent, cytosolic; Malic enzyme 1, soluble; MOD1; NADP-dependent malic enzyme; NADP-ME
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ME1 (malic enzyme 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Me1 (malic enzyme 1, NADP(+)-dependent, cytosolic) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Me1 (malic enzyme 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ME1 (malic enzyme 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ME1 (malic enzyme 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Me1 (malic enzyme 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ME1 (malic enzyme 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ME1 (malic enzyme 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Me1 (malic enzyme 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Me1 (malic enzyme 1, NADP(+)-dependent, cytosolic)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
ME1 (malic enzyme 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
me1 (malic enzyme 1, NADP(+)-dependent, cytosolic)
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):
MAE1
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|OrthoInspector|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG7848
Alliance
DIOPT (Ensembl Compara|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
Men
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Men-b
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
Menl-1
Alliance
DIOPT (Ensembl Compara|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
Menl-2
Alliance
DIOPT (Ensembl Compara|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
men-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
me1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 96,429,057 - 96,540,244 (-) NCBI GRCr8 mRatBN7.2 8 87,549,043 - 87,660,251 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 87,549,043 - 87,660,304 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 93,229,577 - 93,340,927 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 91,428,778 - 91,540,131 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 89,270,059 - 89,381,778 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 94,256,830 - 94,368,834 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 94,256,839 - 94,368,834 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 93,769,078 - 93,863,611 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 91,839,845 - 91,955,917 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 91,860,614 - 91,975,372 (-) NCBI Celera 8 87,151,761 - 87,246,579 (-) NCBI Celera RH 3.4 Map 8 999.69 RGD Cytogenetic Map 8 q31 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Me1 Rat (1->4)-beta-D-glucan multiple interactions ISO Me1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of ME1 mRNA CTD PMID:36331819 Me1 Rat (E)-cinnamyl alcohol increases expression ISO ME1 (Homo sapiens) 6480464 cinnamyl alcohol results in increased expression of ME1 mRNA CTD PMID:20566472 Me1 Rat (S)-nicotine multiple interactions ISO Me1 (Mus musculus) 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Me1 Rat 1,1-dichloroethene decreases expression ISO Me1 (Mus musculus) 6480464 vinylidene chloride results in decreased expression of ME1 mRNA CTD PMID:26682919 Me1 Rat 1,2-dichloroethane decreases expression ISO Me1 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of ME1 mRNA CTD PMID:28189721 and PMID:28960355 Me1 Rat 1,2-dimethylhydrazine multiple interactions ISO Me1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of ME1 mRNA CTD PMID:22206623 Me1 Rat 1,4-phenylenediamine increases expression ISO ME1 (Homo sapiens) 6480464 4-phenylenediamine results in increased expression of ME1 mRNA CTD PMID:16314067 Me1 Rat 1-chloro-2,4-dinitrobenzene increases expression ISO ME1 (Homo sapiens) 6480464 Dinitrochlorobenzene results in increased expression of ME1 mRNA CTD PMID:20566472 Me1 Rat 1-chloro-2,4-dinitrobenzene affects binding ISO ME1 (Homo sapiens) 6480464 Dinitrochlorobenzene binds to ME1 protein CTD PMID:32991956 Me1 Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine decreases expression ISO Me1 (Mus musculus) 6480464 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Me1 Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine multiple interactions ISO Me1 (Mus musculus) 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Me1 Rat 17alpha-ethynylestradiol affects expression ISO ME1 (Homo sapiens) 6480464 Ethinyl Estradiol affects the expression of ME1 mRNA CTD PMID:20170705 and PMID:26865667 Me1 Rat 17alpha-ethynylestradiol affects expression EXP 6480464 Ethinyl Estradiol affects the expression of ME1 mRNA CTD PMID:20170705 and PMID:26865667 Me1 Rat 17beta-estradiol multiple interactions ISO ME1 (Homo sapiens) 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in increased expression of ME1 mRNA CTD PMID:19619570 Me1 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of ME1 mRNA CTD PMID:32145629 Me1 Rat 17beta-estradiol decreases expression ISO Me1 (Mus musculus) 6480464 Estradiol results in decreased expression of ME1 mRNA CTD PMID:19484750 and PMID:39298647 Me1 Rat 17beta-estradiol increases expression ISO ME1 (Homo sapiens) 6480464 Estradiol results in increased expression of ME1 mRNA CTD PMID:19619570 Me1 Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO ME1 (Homo sapiens) 6480464 Dihydrotestosterone results in increased expression of ME1 mRNA CTD PMID:16631469 Me1 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression EXP 6480464 2 more ... CTD PMID:31826744 Me1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO ME1 (Homo sapiens) 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in increased expression of ME1 mRNA CTD PMID:19619570 Me1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Me1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ME1 mRNA CTD PMID:24680724 and PMID:26377647 Me1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of ME1 mRNA CTD PMID:16054898 more ... Me1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO ME1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of ME1 mRNA CTD PMID:17555868 more ... Me1 Rat 2,4,6-trinitrobenzenesulfonic acid increases expression ISO Me1 (Mus musculus) 6480464 Trinitrobenzenesulfonic Acid results in increased expression of ME1 mRNA CTD PMID:17982090 Me1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Me1 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Me1 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of ME1 mRNA CTD PMID:21346803 Me1 Rat 2,6-dimethoxyphenol multiple interactions ISO ME1 (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Me1 Rat 2-hydroxypropanoic acid increases expression ISO ME1 (Homo sapiens) 6480464 Lactic Acid results in increased expression of ME1 mRNA CTD PMID:20566472 Me1 Rat 2-hydroxypropanoic acid decreases expression ISO ME1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of ME1 mRNA CTD PMID:30851411 Me1 Rat 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3 more ... CTD PMID:20959002 Me1 Rat 3,3',5-triiodo-L-thyronine increases expression EXP 6480464 Triiodothyronine results in increased expression of ME1 mRNA CTD PMID:15953391 and PMID:29357290 Me1 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of ME1 protein CTD PMID:26597043 Me1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO ME1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of ME1 mRNA CTD PMID:28628672 Me1 Rat 3H-1,2-dithiole-3-thione increases expression EXP 6480464 1 and 2-dithiol-3-thione results in increased expression of ME1 mRNA CTD PMID:19162173 Me1 Rat 4,4'-diaminodiphenylmethane affects expression ISO Me1 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane affects the expression of ME1 mRNA CTD PMID:18648102 Me1 Rat 4,4'-sulfonyldiphenol increases expression ISO Me1 (Mus musculus) 6480464 bisphenol S results in increased expression of ME1 mRNA CTD PMID:30951980 and PMID:39298647 Me1 Rat 4,4'-sulfonyldiphenol decreases methylation ISO ME1 (Homo sapiens) 6480464 bisphenol S results in decreased methylation of ME1 gene CTD PMID:31601247 Me1 Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole affects expression EXP 6480464 Omeprazole affects the expression of ME1 mRNA CTD PMID:19483382 Me1 Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole multiple interactions EXP 6480464 [Omeprazole co-treated with Diethylnitrosamine] results in increased expression of ME1 mRNA CTD PMID:22687989 Me1 Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of ME1 mRNA CTD PMID:19483382 Me1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of ME1 mRNA CTD PMID:24780913 and PMID:25060363 Me1 Rat 9-cis,11-trans-octadecadienoic acid increases expression ISO Me1 (Mus musculus) 6480464 cis-9 and trans-11-conjugated linoleic acid results in increased expression of ME1 mRNA CTD PMID:17217560 Me1 Rat Actein decreases expression EXP 6480464 actein results in decreased expression of ME1 mRNA CTD PMID:19527300 Me1 Rat afimoxifene increases expression ISO ME1 (Homo sapiens) 6480464 afimoxifene results in increased expression of ME1 mRNA CTD PMID:19901195 Me1 Rat aflatoxin B1 increases methylation ISO ME1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of ME1 gene and Aflatoxin B1 results in increased methylation of ME1 intron CTD PMID:27153756 and PMID:30157460 Me1 Rat aldrin increases expression ISO Me1 (Mus musculus) 6480464 Aldrin results in increased expression of ME1 mRNA CTD PMID:18579281 Me1 Rat all-trans-retinoic acid increases expression ISO ME1 (Homo sapiens) 6480464 Tretinoin results in increased expression of ME1 mRNA CTD PMID:21934132 Me1 Rat all-trans-retinoic acid decreases expression ISO ME1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of ME1 mRNA CTD PMID:33167477 Me1 Rat alpha-hexachlorocyclohexane increases expression EXP 6480464 alpha-hexachlorocyclohexane results in increased expression of ME1 mRNA CTD PMID:17785943 Me1 Rat alpha-hexylcinnamaldehyde increases expression ISO ME1 (Homo sapiens) 6480464 hexyl cinnamic aldehyde results in increased expression of ME1 mRNA CTD PMID:20566472 Me1 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of ME1 mRNA CTD PMID:35163327 Me1 Rat amiodarone increases expression EXP 6480464 Amiodarone results in increased expression of ME1 protein CTD PMID:16538043 Me1 Rat amiodarone affects expression EXP 6480464 Amiodarone affects the expression of ME1 mRNA CTD PMID:19483382 Me1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of ME1 mRNA CTD PMID:16483693 Me1 Rat antimycin A increases expression ISO ME1 (Homo sapiens) 6480464 Antimycin A results in increased expression of ME1 mRNA CTD PMID:33512557 Me1 Rat aristolochic acid A increases expression ISO ME1 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of ME1 protein CTD PMID:33212167 Me1 Rat aristolochic acid A decreases expression ISO ME1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of ME1 mRNA CTD PMID:33212167 Me1 Rat Aroclor 1254 increases expression EXP 6480464 Chlorodiphenyl (54% Chlorine) results in increased expression of ME1 mRNA CTD PMID:22659317 Me1 Rat arsane multiple interactions ISO ME1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ME1 mRNA more ... CTD PMID:32525701 and PMID:39836092 Me1 Rat arsane multiple interactions ISO Me1 (Mus musculus) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ME1 mRNA CTD PMID:32045263 Me1 Rat arsenic atom multiple interactions ISO ME1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ME1 mRNA more ... CTD PMID:32525701 and PMID:39836092 Me1 Rat arsenic atom multiple interactions ISO Me1 (Mus musculus) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ME1 mRNA CTD PMID:32045263 Me1 Rat arsenous acid decreases response to substance ISO ME1 (Homo sapiens) 6480464 ME1 protein results in decreased susceptibility to Arsenic Trioxide CTD PMID:20707922 Me1 Rat arsenous acid increases expression ISO ME1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of ME1 mRNA CTD PMID:15725085 more ... Me1 Rat Augmentin increases expression ISO ME1 (Homo sapiens) 6480464 Amoxicillin-Potassium Clavulanate Combination results in increased expression of ME1 mRNA CTD PMID:34767876 Me1 Rat azoxystrobin increases expression ISO ME1 (Homo sapiens) 6480464 azoxystrobin results in increased expression of ME1 mRNA CTD PMID:33512557 Me1 Rat Bandrowski's base increases expression ISO ME1 (Homo sapiens) 6480464 Bandrowski's base results in increased expression of ME1 mRNA CTD PMID:20566472 Me1 Rat benazepril increases expression EXP 6480464 benazepril results in increased expression of ME1 mRNA CTD PMID:14871019 Me1 Rat benzbromarone affects expression EXP 6480464 Benzbromarone affects the expression of ME1 mRNA CTD PMID:19483382 Me1 Rat benzene affects expression EXP 6480464 Benzene affects the expression of ME1 mRNA CTD PMID:15878777 Me1 Rat benzo[a]pyrene increases expression ISO Me1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of ME1 mRNA CTD PMID:20127859 Me1 Rat benzo[a]pyrene affects methylation ISO ME1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of ME1 promoter CTD PMID:27901495 Me1 Rat benzo[a]pyrene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with 1 more ... CTD PMID:18711122 Me1 Rat benzo[a]pyrene multiple interactions ISO Me1 (Mus musculus) 6480464 AHR protein affects the reaction [Benzo(a)pyrene affects the expression of ME1 mRNA] CTD PMID:22228805 Me1 Rat benzo[a]pyrene increases expression ISO ME1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of ME1 mRNA CTD PMID:22316170 and PMID:31255691 Me1 Rat benzo[b]fluoranthene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with benzo(b)fluoranthene] affects the expression of ME1 mRNA CTD PMID:18711122 Me1 Rat benzoic acid increases expression ISO ME1 (Homo sapiens) 6480464 Benzoic Acid results in increased expression of ME1 mRNA CTD PMID:20566472 Me1 Rat beta-naphthoflavone increases expression ISO ME1 (Homo sapiens) 6480464 beta-Naphthoflavone results in increased expression of ME1 mRNA CTD PMID:32858204 Me1 Rat bexarotene increases expression EXP 6480464 bexarotene results in increased expression of ME1 mRNA CTD PMID:16648578 and PMID:23292798 Me1 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Me1 (Mus musculus) 6480464 PPARA protein promotes the reaction [Diethylhexyl Phthalate results in increased expression of ME1 mRNA] CTD PMID:19850644 Me1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Me1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of ME1 mRNA CTD PMID:33754040 Me1 Rat bis(2-ethylhexyl) phthalate increases expression ISO ME1 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of ME1 mRNA CTD PMID:31163220 Me1 Rat bis(2-ethylhexyl) phthalate increases expression ISO Me1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of ME1 mRNA CTD PMID:19850644 Me1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ME1 mRNA CTD PMID:27178563 Me1 Rat bisphenol A multiple interactions ISO Me1 (Mus musculus) 6480464 [Dextran Sulfate co-treated with bisphenol A] results in decreased expression of ME1 protein CTD PMID:35999755 Me1 Rat bisphenol A increases expression ISO ME1 (Homo sapiens) 6480464 bisphenol A results in increased expression of ME1 mRNA CTD PMID:29275510 Me1 Rat bisphenol A multiple interactions ISO ME1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of ME1 mRNA CTD PMID:28628672 Me1 Rat bisphenol A affects methylation ISO Me1 (Mus musculus) 6480464 bisphenol A affects the methylation of ME1 promoter CTD PMID:27334623 Me1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ME1 mRNA CTD PMID:30816183 more ... Me1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of ME1 mRNA CTD PMID:25181051 Me1 Rat bisphenol A affects expression ISO ME1 (Homo sapiens) 6480464 bisphenol A affects the expression of ME1 mRNA and bisphenol A affects the expression of ME1 protein CTD PMID:20170705 and PMID:34186270 Me1 Rat bisphenol AF increases expression ISO ME1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of ME1 protein CTD PMID:34186270 Me1 Rat Bisphenol B increases expression ISO ME1 (Homo sapiens) 6480464 bisphenol B results in increased expression of ME1 protein CTD PMID:34186270 Me1 Rat bisphenol F increases expression ISO Me1 (Mus musculus) 6480464 bisphenol F results in increased expression of ME1 mRNA CTD PMID:30951980 Me1 Rat bisphenol F increases expression ISO ME1 (Homo sapiens) 6480464 bisphenol F results in increased expression of ME1 protein CTD PMID:34186270 Me1 Rat bortezomib increases expression ISO ME1 (Homo sapiens) 6480464 Bortezomib results in increased expression of ME1 mRNA CTD PMID:20977926 Me1 Rat buspirone decreases expression EXP 6480464 Buspirone results in decreased expression of ME1 mRNA CTD PMID:24136188 Me1 Rat butanal decreases expression ISO ME1 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of ME1 mRNA CTD PMID:26079696 Me1 Rat cadmium dichloride increases expression ISO ME1 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of ME1 mRNA and Cadmium Chloride results in increased expression of ME1 protein CTD PMID:24527689 and PMID:25596134 Me1 Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of ME1 mRNA CTD PMID:25993096 Me1 Rat cadmium sulfate increases expression ISO ME1 (Homo sapiens) 6480464 cadmium sulfate results in increased expression of ME1 mRNA CTD PMID:12064557 Me1 Rat cannabidiol increases expression ISO ME1 (Homo sapiens) 6480464 Cannabidiol results in increased expression of ME1 mRNA CTD PMID:31518892 Me1 Rat captan increases expression ISO Me1 (Mus musculus) 6480464 Captan results in increased expression of ME1 mRNA CTD PMID:31558096 Me1 Rat carbamazepine affects expression ISO ME1 (Homo sapiens) 6480464 Carbamazepine affects the expression of ME1 mRNA CTD PMID:25979313 Me1 Rat carbamazepine increases expression EXP 6480464 Carbamazepine results in increased expression of ME1 mRNA CTD PMID:17381134 Me1 Rat carbon nanotube decreases expression ISO Me1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25620056 Me1 Rat carbon nanotube increases expression ISO Me1 (Mus musculus) 6480464 Nanotubes and Carbon analog results in increased expression of ME1 mRNA CTD PMID:25554681 Me1 Rat celastrol increases expression ISO ME1 (Homo sapiens) 6480464 celastrol results in increased expression of ME1 mRNA CTD PMID:17010675 Me1 Rat chloroacetaldehyde increases expression ISO ME1 (Homo sapiens) 6480464 chloroacetaldehyde results in increased expression of ME1 mRNA CTD PMID:25596134 Me1 Rat chloroethene increases expression ISO Me1 (Mus musculus) 6480464 Vinyl Chloride results in increased expression of ME1 mRNA CTD PMID:18579281 Me1 Rat chlorohydrocarbon multiple interactions EXP 6480464 [Hydrocarbons more ... CTD PMID:30744511 Me1 Rat cinnamyl alcohol increases expression ISO ME1 (Homo sapiens) 6480464 cinnamyl alcohol results in increased expression of ME1 mRNA CTD PMID:20566472 Me1 Rat cisplatin decreases expression ISO ME1 (Homo sapiens) 6480464 Cisplatin results in decreased expression of ME1 mRNA CTD PMID:25596134 Me1 Rat clavulanic acid increases expression ISO ME1 (Homo sapiens) 6480464 Clavulanic Acid results in increased expression of ME1 mRNA CTD PMID:34767876 Me1 Rat clodronic acid decreases expression ISO ME1 (Homo sapiens) 6480464 Clodronic Acid results in decreased expression of ME1 mRNA CTD PMID:25596134 Me1 Rat clofibrate affects expression EXP 6480464 Clofibrate affects the expression of ME1 mRNA CTD PMID:19483382 Me1 Rat clofibrate increases expression ISO Me1 (Mus musculus) 6480464 Clofibrate results in increased expression of ME1 mRNA CTD PMID:17585979 and PMID:30629241 Me1 Rat clofibrate increases expression EXP 6480464 Clofibrate results in increased expression of ME1 mRNA and Clofibrate results in increased expression of ME1 protein CTD PMID:12851107 and PMID:16470657 Me1 Rat clofibrate multiple interactions ISO Me1 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of ME1 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of ME1 mRNA] CTD PMID:17585979 Me1 Rat cobalt dichloride increases expression ISO ME1 (Homo sapiens) 6480464 cobaltous chloride results in increased expression of ME1 mRNA CTD PMID:19320972 and PMID:19376846 Me1 Rat cobalt dichloride increases expression EXP 6480464 cobaltous chloride results in increased expression of ME1 mRNA CTD PMID:24386269 Me1 Rat copper(II) sulfate increases expression ISO ME1 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of ME1 mRNA CTD PMID:19549813 Me1 Rat corticosterone decreases expression EXP 6480464 Corticosterone results in decreased expression of ME1 mRNA CTD PMID:15755911 Me1 Rat cyclosporin A increases expression EXP 6480464 Cyclosporine results in increased expression of ME1 mRNA CTD PMID:25596134 Me1 Rat cyclosporin A increases expression ISO ME1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of ME1 mRNA CTD PMID:25596134 and PMID:30008028 Me1 Rat daidzein increases expression ISO ME1 (Homo sapiens) 6480464 daidzein results in increased expression of ME1 mRNA CTD PMID:16865672 Me1 Rat DDE decreases expression ISO ME1 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of ME1 mRNA CTD PMID:38568856 Me1 Rat deguelin increases expression ISO ME1 (Homo sapiens) 6480464 deguelin results in increased expression of ME1 mRNA CTD PMID:33512557 Me1 Rat dexamethasone multiple interactions EXP 6480464 Testosterone inhibits the reaction [Dexamethasone results in decreased expression of ME1 mRNA] CTD PMID:20032058 Me1 Rat dexamethasone multiple interactions ISO ME1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of ME1 mRNA CTD PMID:28628672 Me1 Rat dexamethasone decreases expression EXP 6480464 Dexamethasone results in decreased expression of ME1 mRNA CTD PMID:20032058 Me1 Rat dextran sulfate multiple interactions ISO Me1 (Mus musculus) 6480464 [Dextran Sulfate co-treated with bisphenol A] results in decreased expression of ME1 protein CTD PMID:35999755 Me1 Rat diarsenic trioxide increases expression ISO ME1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of ME1 mRNA CTD PMID:15725085 more ... Me1 Rat diarsenic trioxide decreases response to substance ISO ME1 (Homo sapiens) 6480464 ME1 protein results in decreased susceptibility to Arsenic Trioxide CTD PMID:20707922 Me1 Rat dibenz[a,h]anthracene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with 1 more ... CTD PMID:18711122 Me1 Rat dibenzo[a,l]pyrene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with dibenzo(a and l)pyrene] affects the expression of ME1 mRNA CTD PMID:18711122 Me1 Rat dibenzo[a,l]pyrene decreases expression ISO ME1 (Homo sapiens) 6480464 dibenzo(a and l)pyrene results in decreased expression of ME1 mRNA CTD PMID:31255691 Me1 Rat Dibutyl phosphate affects expression ISO ME1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of ME1 mRNA CTD PMID:37042841 Me1 Rat dibutyl phthalate increases expression ISO Me1 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of ME1 mRNA CTD PMID:17361019 and PMID:21266533 Me1 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of ME1 mRNA CTD PMID:21266533 and PMID:21745491 Me1 Rat dichloroacetic acid increases expression ISO Me1 (Mus musculus) 6480464 Dichloroacetic Acid results in increased expression of ME1 mRNA CTD PMID:28962523 Me1 Rat diethyl maleate increases expression ISO Me1 (Mus musculus) 6480464 diethyl maleate results in increased expression of ME1 mRNA CTD PMID:25270620 Me1 Rat dioxygen affects expression ISO ME1 (Homo sapiens) 6480464 Oxygen deficiency affects the expression of ME1 mRNA CTD PMID:25596134 Me1 Rat dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate increases expression ISO ME1 (Homo sapiens) 6480464 Antimony Potassium Tartrate results in increased expression of ME1 mRNA CTD PMID:28713220 Me1 Rat diquat increases expression ISO Me1 (Mus musculus) 6480464 Diquat results in increased expression of ME1 mRNA CTD PMID:16962985 Me1 Rat disulfiram increases expression ISO ME1 (Homo sapiens) 6480464 Disulfiram results in increased expression of ME1 mRNA CTD PMID:20566472 Me1 Rat dorsomorphin multiple interactions ISO ME1 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Me1 Rat doxorubicin decreases expression ISO ME1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of ME1 mRNA CTD PMID:29803840 Me1 Rat elemental selenium decreases expression ISO ME1 (Homo sapiens) 6480464 Selenium results in decreased expression of ME1 mRNA CTD PMID:19244175 Me1 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of ME1 mRNA CTD PMID:29391264 Me1 Rat entinostat increases expression ISO ME1 (Homo sapiens) 6480464 entinostat results in increased expression of ME1 mRNA CTD PMID:27188386 Me1 Rat equol increases expression ISO ME1 (Homo sapiens) 6480464 Equol results in increased expression of ME1 mRNA CTD PMID:16865672 Me1 Rat ethanol multiple interactions EXP 6480464 [Fish Oils co-treated with Ethanol] results in increased expression of ME1 mRNA CTD PMID:17347304 Me1 Rat ethanol increases expression ISO Me1 (Mus musculus) 6480464 Ethanol results in increased expression of ME1 mRNA CTD PMID:19167417 Me1 Rat eugenol increases expression ISO ME1 (Homo sapiens) 6480464 Eugenol results in increased expression of ME1 mRNA CTD PMID:20566472 Me1 Rat felbamate increases expression EXP 6480464 felbamate results in increased expression of ME1 mRNA CTD PMID:17381134 Me1 Rat fenofibrate affects expression EXP 6480464 Fenofibrate affects the expression of ME1 mRNA CTD PMID:20801182 Me1 Rat fenofibrate increases expression EXP 6480464 Fenofibrate results in increased expression of ME1 mRNA CTD PMID:25596134 and PMID:27071702 Me1 Rat fenofibrate multiple interactions ISO Me1 (Mus musculus) 6480464 NR1H2 gene mutant form inhibits the reaction [Fenofibrate results in increased expression of ME1 mRNA] more ... CTD PMID:23063693 Me1 Rat fenofibrate increases expression ISO Me1 (Mus musculus) 6480464 Fenofibrate results in increased expression of ME1 mRNA CTD PMID:23063693 Me1 Rat fenpyroximate increases expression ISO ME1 (Homo sapiens) 6480464 fenpyroximate results in increased expression of ME1 mRNA CTD PMID:33512557 Me1 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of ME1 mRNA CTD PMID:24136188 Me1 Rat fipronil increases expression EXP 6480464 fipronil results in increased expression of ME1 mRNA CTD PMID:23962444 Me1 Rat fluoranthene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with fluoranthene] affects the expression of ME1 mRNA CTD PMID:18711122 Me1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of ME1 mRNA and Flutamide results in increased expression of ME1 protein CTD PMID:17311803 and PMID:24136188 Me1 Rat folic acid multiple interactions ISO Me1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of ME1 mRNA CTD PMID:22206623 Me1 Rat folpet increases expression ISO Me1 (Mus musculus) 6480464 folpet results in increased expression of ME1 mRNA CTD PMID:31558096 Me1 Rat formaldehyde decreases expression ISO ME1 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of ME1 mRNA CTD PMID:23649840 Me1 Rat furan increases expression EXP 6480464 furan results in increased expression of ME1 mRNA CTD PMID:25539665 Me1 Rat furan decreases expression EXP 6480464 furan results in decreased expression of ME1 mRNA CTD PMID:26194646 Me1 Rat furfural multiple interactions ISO ME1 (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Me1 Rat gedunin increases expression ISO ME1 (Homo sapiens) 6480464 gedunin results in increased expression of ME1 mRNA CTD PMID:17010675 Me1 Rat genistein increases expression ISO ME1 (Homo sapiens) 6480464 Genistein results in increased expression of ME1 mRNA CTD PMID:16865672 Me1 Rat genistein affects expression ISO ME1 (Homo sapiens) 6480464 Genistein affects the expression of ME1 mRNA CTD PMID:26865667 Me1 Rat glafenine decreases expression EXP 6480464 Glafenine results in decreased expression of ME1 mRNA CTD PMID:24136188 Me1 Rat glutathione increases expression EXP 6480464 Glutathione deficiency results in increased expression of ME1 mRNA CTD PMID:15345336 Me1 Rat hexadecanoic acid increases expression ISO Me1 (Mus musculus) 6480464 Palmitic Acid results in increased expression of ME1 mRNA CTD PMID:29414781 Me1 Rat hexane increases expression ISO ME1 (Homo sapiens) 6480464 n-hexane results in increased expression of ME1 mRNA CTD PMID:20566472 Me1 Rat hydrogen peroxide increases expression ISO ME1 (Homo sapiens) 6480464 Hydrogen Peroxide results in increased expression of ME1 mRNA CTD PMID:12414654 Me1 Rat hydrogen sulfide decreases expression ISO Me1 (Mus musculus) 6480464 Hydrogen Sulfide results in decreased expression of ME1 protein CTD PMID:29932956 Me1 Rat hypochlorous acid increases expression ISO Me1 (Mus musculus) 6480464 Hypochlorous Acid results in increased expression of ME1 mRNA CTD PMID:19376150 Me1 Rat ibuprofen increases expression EXP 6480464 Ibuprofen results in increased expression of ME1 mRNA CTD PMID:25596134 Me1 Rat ifosfamide decreases expression ISO ME1 (Homo sapiens) 6480464 Ifosfamide results in decreased expression of ME1 mRNA CTD PMID:25596134 Me1 Rat indinavir multiple interactions ISO Me1 (Mus musculus) 6480464 [Stavudine co-treated with Lamivudine co-treated with Indinavir] results in increased expression of ME1 mRNA and [Zidovudine co-treated with Lamivudine co-treated with Indinavir] results in increased expression of ME1 mRNA CTD PMID:11741158 Me1 Rat indole-3-methanol affects expression EXP 6480464 indole-3-carbinol affects the expression of ME1 mRNA CTD PMID:21396975 Me1 Rat indole-3-methanol multiple interactions EXP 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in decreased expression of ME1 mRNA more ... CTD PMID:22129741 Me1 Rat indometacin increases expression EXP 6480464 Indomethacin results in increased expression of ME1 mRNA CTD PMID:18299717 Me1 Rat indometacin decreases expression EXP 6480464 Indomethacin results in decreased expression of ME1 mRNA CTD PMID:36868495 Me1 Rat indometacin multiple interactions ISO ME1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of ME1 mRNA CTD PMID:28628672 Me1 Rat inulin multiple interactions ISO Me1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of ME1 mRNA CTD PMID:36331819 Me1 Rat iron atom increases expression ISO ME1 (Homo sapiens) 6480464 Iron deficiency results in increased expression of ME1 mRNA CTD PMID:20368581 Me1 Rat iron(0) increases expression ISO ME1 (Homo sapiens) 6480464 Iron deficiency results in increased expression of ME1 mRNA CTD PMID:20368581 Me1 Rat isoeugenol increases expression ISO ME1 (Homo sapiens) 6480464 isoeugenol results in increased expression of ME1 mRNA CTD PMID:20566472 Me1 Rat isoflavones increases expression ISO ME1 (Homo sapiens) 6480464 Isoflavones results in increased expression of ME1 mRNA CTD PMID:17374662 Me1 Rat isotretinoin decreases expression ISO ME1 (Homo sapiens) 6480464 Isotretinoin results in decreased expression of ME1 mRNA CTD PMID:20436886 Me1 Rat ivermectin decreases expression ISO ME1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of ME1 protein CTD PMID:32959892 Me1 Rat ketoconazole increases expression EXP 6480464 Ketoconazole results in increased expression of ME1 mRNA CTD PMID:37077353 Me1 Rat L-ethionine affects expression EXP 6480464 Ethionine affects the expression of ME1 mRNA CTD PMID:19483382 Me1 Rat lamivudine multiple interactions ISO Me1 (Mus musculus) 6480464 [Stavudine co-treated with Lamivudine co-treated with Indinavir] results in increased expression of ME1 mRNA more ... CTD PMID:11741158 Me1 Rat lamivudine increases expression ISO Me1 (Mus musculus) 6480464 Lamivudine results in increased expression of ME1 mRNA CTD PMID:11741158 Me1 Rat lead diacetate increases expression ISO ME1 (Homo sapiens) 6480464 lead acetate results in increased expression of ME1 mRNA CTD PMID:22839698 and PMID:38568856 Me1 Rat leflunomide increases expression EXP 6480464 leflunomide results in increased expression of ME1 mRNA CTD PMID:24136188 Me1 Rat lipopolysaccharide multiple interactions ISO ME1 (Homo sapiens) 6480464 [Lipopolysaccharides co-treated with resveratrol] results in decreased expression of ME1 mRNA CTD PMID:26667767 Me1 Rat lipopolysaccharide decreases expression ISO Me1 (Mus musculus) 6480464 Lipopolysaccharides results in decreased expression of ME1 mRNA CTD PMID:12388159 Me1 Rat manganese atom multiple interactions ISO ME1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ME1 mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of ME1 mRNA CTD PMID:39836092 Me1 Rat manganese(0) multiple interactions ISO ME1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ME1 mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of ME1 mRNA CTD PMID:39836092 Me1 Rat manganese(II) chloride multiple interactions ISO ME1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ME1 mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of ME1 mRNA CTD PMID:39836092 Me1 Rat melatonin multiple interactions EXP 6480464 Melatonin inhibits the reaction [[Diethylnitrosamine co-treated with oxfendazole] results in increased expression of ME1 mRNA] CTD PMID:20033131 Me1 Rat menadione increases expression ISO ME1 (Homo sapiens) 6480464 Vitamin K 3 results in increased expression of ME1 mRNA CTD PMID:12414654 Me1 Rat mercury dibromide increases expression ISO ME1 (Homo sapiens) 6480464 mercuric bromide results in increased expression of ME1 mRNA CTD PMID:26272509 Me1 Rat mercury dibromide multiple interactions ISO ME1 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ME1 mRNA CTD PMID:27188386 Me1 Rat mercury dichloride multiple interactions ISO ME1 (Homo sapiens) 6480464 [NOG protein co-treated with Mercuric Chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ME1 mRNA CTD PMID:27188386 Me1 Rat Mesaconitine increases expression EXP 6480464 mesaconitine results in increased expression of ME1 protein CTD PMID:37182599 Me1 Rat metformin increases expression EXP 6480464 Metformin results in increased expression of ME1 mRNA CTD PMID:25596134 and PMID:31324951 Me1 Rat metformin decreases expression ISO ME1 (Homo sapiens) 6480464 Metformin results in decreased expression of ME1 protein CTD PMID:28576465 Me1 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of ME1 gene CTD PMID:35440735 Me1 Rat methyl salicylate increases expression ISO ME1 (Homo sapiens) 6480464 methyl salicylate results in increased expression of ME1 mRNA CTD PMID:20566472 Me1 Rat methylmercury chloride increases expression ISO ME1 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of ME1 mRNA CTD PMID:23179753 more ... Me1 Rat methylmercury chloride multiple interactions EXP 6480464 [Hydrocarbons more ... CTD PMID:30744511 Me1 Rat methylmercury chloride multiple interactions ISO ME1 (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ME1 mRNA CTD PMID:27188386 Me1 Rat methylseleninic acid increases expression ISO ME1 (Homo sapiens) 6480464 methylselenic acid results in increased expression of ME1 mRNA CTD PMID:18548127 Me1 Rat N-acetyl-L-cysteine multiple interactions EXP 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in decreased expression of ME1 mRNA and Acetylcysteine inhibits the reaction [[indole-3-carbinol co-treated with Diethylnitrosamine] results in increased expression of ME1 mRNA] CTD PMID:22129741 Me1 Rat N-methyl-4-phenylpyridinium increases expression ISO ME1 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of ME1 mRNA CTD PMID:24810058 Me1 Rat N-methyl-N-nitrosourea increases expression EXP 6480464 Methylnitrosourea results in increased expression of ME1 mRNA CTD PMID:16525678 Me1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in decreased expression of ME1 mRNA more ... CTD PMID:18754104 more ... Me1 Rat N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of ME1 mRNA CTD PMID:19638242 Me1 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of ME1 mRNA CTD PMID:24136188 Me1 Rat nelfinavir decreases expression ISO Me1 (Mus musculus) 6480464 Nelfinavir results in decreased expression of ME1 mRNA CTD PMID:11741158 Me1 Rat nelfinavir multiple interactions ISO Me1 (Mus musculus) 6480464 [Stavudine co-treated with Lamivudine co-treated with Nelfinavir] results in decreased expression of ME1 mRNA CTD PMID:11741158 Me1 Rat nickel sulfate increases expression ISO ME1 (Homo sapiens) 6480464 nickel sulfate results in increased expression of ME1 mRNA CTD PMID:16314067 and PMID:20566472 Me1 Rat nicotine multiple interactions ISO Me1 (Mus musculus) 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Me1 Rat ochratoxin A decreases expression EXP 6480464 ochratoxin A results in decreased expression of ME1 mRNA CTD PMID:16251485 Me1 Rat ochratoxin A increases expression ISO ME1 (Homo sapiens) 6480464 ochratoxin A results in increased expression of ME1 mRNA CTD PMID:30008028 Me1 Rat omeprazole affects expression EXP 6480464 Omeprazole affects the expression of ME1 mRNA CTD PMID:19483382 Me1 Rat omeprazole multiple interactions EXP 6480464 [Omeprazole co-treated with Diethylnitrosamine] results in increased expression of ME1 mRNA CTD PMID:22687989 Me1 Rat oxfendazole multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with oxfendazole] results in increased expression of ME1 mRNA more ... CTD PMID:18754104 and PMID:20033131 Me1 Rat ozone decreases expression ISO Me1 (Mus musculus) 6480464 Ozone results in decreased expression of ME1 mRNA CTD PMID:16183385 Me1 Rat p-chloromercuribenzoic acid increases expression ISO ME1 (Homo sapiens) 6480464 p-Chloromercuribenzoic Acid results in increased expression of ME1 mRNA CTD PMID:26272509 Me1 Rat p-chloromercuribenzoic acid multiple interactions ISO ME1 (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ME1 mRNA CTD PMID:27188386 Me1 Rat paracetamol multiple interactions ISO Me1 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of ME1 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of ME1 mRNA] CTD PMID:17585979 Me1 Rat paracetamol increases expression ISO ME1 (Homo sapiens) 6480464 Acetaminophen results in increased expression of ME1 mRNA CTD PMID:30008028 Me1 Rat paracetamol affects expression ISO Me1 (Mus musculus) 6480464 Acetaminophen affects the expression of ME1 mRNA CTD PMID:15606129 and PMID:17562736 Me1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of ME1 mRNA and Acetaminophen results in increased expression of ME1 protein CTD PMID:16538043 more ... Me1 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of ME1 mRNA CTD PMID:32680482 Me1 Rat perfluorooctane-1-sulfonic acid increases expression ISO Me1 (Mus musculus) 6480464 perfluorooctane sulfonic acid results in increased expression of ME1 mRNA CTD PMID:19429403 Me1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Me1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of ME1 mRNA more ... CTD PMID:36331819 Me1 Rat perfluorooctane-1-sulfonic acid increases expression EXP 6480464 perfluorooctane sulfonic acid results in increased expression of ME1 mRNA CTD PMID:18063289 and PMID:19162173 Me1 Rat perfluorooctane-1-sulfonic acid increases activity EXP 6480464 perfluorooctane sulfonic acid results in increased activity of ME1 protein CTD PMID:18063289 Me1 Rat perfluorooctanoic acid affects expression ISO Me1 (Mus musculus) 6480464 perfluorooctanoic acid affects the expression of ME1 mRNA CTD PMID:18281256 Me1 Rat perfluorooctanoic acid multiple interactions ISO ME1 (Homo sapiens) 6480464 [Plasticizers co-treated with Cosmetics co-treated with Flame Retardants co-treated with perfluorooctanoic acid co-treated with Phytoestrogens] results in decreased expression of ME1 mRNA CTD PMID:33325755 Me1 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of ME1 mRNA CTD PMID:35163327 Me1 Rat perfluorooctanoic acid increases expression ISO Me1 (Mus musculus) 6480464 perfluorooctanoic acid results in increased expression of ME1 mRNA CTD PMID:17681415 and PMID:22154759 Me1 Rat perfluorooctanoic acid decreases expression ISO Me1 (Mus musculus) 6480464 perfluorooctanoic acid results in decreased expression of ME1 mRNA CTD PMID:22154759 Me1 Rat perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of ME1 mRNA CTD PMID:16221955 and PMID:19162173 Me1 Rat perfluorooctanoic acid affects expression EXP 6480464 perfluorooctanoic acid affects the expression of ME1 mRNA CTD PMID:17383973 Me1 Rat permethrin increases expression ISO Me1 (Mus musculus) 6480464 Permethrin results in increased expression of ME1 mRNA CTD PMID:30629241 Me1 Rat phenethyl caffeate multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in decreased expression of ME1 mRNA CTD PMID:20360939 Me1 Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of ME1 mRNA CTD PMID:17381134 more ... Me1 Rat phenobarbital increases expression ISO Me1 (Mus musculus) 6480464 Phenobarbital results in increased expression of ME1 mRNA CTD PMID:23091169 Me1 Rat phenylmercury acetate increases expression ISO ME1 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of ME1 mRNA CTD PMID:26272509 Me1 Rat phenylmercury acetate multiple interactions ISO ME1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ME1 mRNA CTD PMID:27188386 Me1 Rat phenytoin increases expression EXP 6480464 Phenytoin results in increased expression of ME1 mRNA CTD PMID:17381134 Me1 Rat phytoestrogen multiple interactions ISO ME1 (Homo sapiens) 6480464 [Plasticizers co-treated with Cosmetics co-treated with Flame Retardants co-treated with perfluorooctanoic acid co-treated with Phytoestrogens] results in decreased expression of ME1 mRNA CTD PMID:33325755 Me1 Rat picoxystrobin increases expression ISO ME1 (Homo sapiens) 6480464 picoxystrobin results in increased expression of ME1 mRNA CTD PMID:33512557 Me1 Rat piperonyl butoxide multiple interactions EXP 6480464 Triterpenes promotes the reaction [Piperonyl Butoxide results in increased expression of ME1 mRNA] CTD PMID:18544911 Me1 Rat piperonyl butoxide increases expression EXP 6480464 Piperonyl Butoxide results in increased expression of ME1 mRNA CTD PMID:18544911 and PMID:22484513 Me1 Rat pirinixic acid multiple interactions ISO Me1 (Mus musculus) 6480464 [pirinixic acid co-treated with PPARA] results in increased expression of ME1 mRNA more ... CTD PMID:15777286 more ... Me1 Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of ME1 mRNA CTD PMID:16489205 more ... Me1 Rat pirinixic acid affects expression EXP 6480464 pirinixic acid affects the expression of ME1 mRNA CTD PMID:19483382 Me1 Rat pirinixic acid multiple interactions ISO ME1 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of ME1 mRNA CTD PMID:19710929 Me1 Rat pirinixic acid increases expression ISO Me1 (Mus musculus) 6480464 pirinixic acid results in increased expression of ME1 mRNA and pirinixic acid results in increased expression of ME1 protein CTD PMID:15226431 more ... Me1 Rat potassium bromate increases expression ISO ME1 (Homo sapiens) 6480464 potassium bromate results in increased expression of ME1 mRNA CTD PMID:30008028 Me1 Rat pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of ME1 mRNA CTD PMID:19162173 and PMID:22659317 Me1 Rat procymidone decreases expression EXP 6480464 procymidone results in decreased expression of ME1 mRNA CTD PMID:15686871 Me1 Rat propan-2-ol increases expression ISO ME1 (Homo sapiens) 6480464 2-Propanol results in increased expression of ME1 mRNA CTD PMID:20566472 Me1 Rat pyrazinecarboxamide increases expression EXP 6480464 Pyrazinamide results in increased expression of ME1 mRNA CTD PMID:22431067 and PMID:27071702 Me1 Rat pyrimidifen increases expression ISO ME1 (Homo sapiens) 6480464 pyrimidifen results in increased expression of ME1 mRNA CTD PMID:33512557 Me1 Rat quercetin 3-O-beta-D-glucofuranoside multiple interactions EXP 6480464 isoquercitrin inhibits the reaction [[Diethylnitrosamine co-treated with oxfendazole] results in increased expression of ME1 mRNA] CTD PMID:20033131 Me1 Rat quercetin 3-O-beta-D-glucopyranoside multiple interactions EXP 6480464 isoquercitrin inhibits the reaction [[Diethylnitrosamine co-treated with oxfendazole] results in increased expression of ME1 mRNA] CTD PMID:20033131 Me1 Rat rac-lactic acid increases expression ISO ME1 (Homo sapiens) 6480464 Lactic Acid results in increased expression of ME1 mRNA CTD PMID:20566472 Me1 Rat rac-lactic acid decreases expression ISO ME1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of ME1 mRNA CTD PMID:30851411 Me1 Rat Rebamipide increases expression EXP 6480464 rebamipide results in increased expression of ME1 mRNA CTD PMID:18299717 Me1 Rat resveratrol multiple interactions ISO ME1 (Homo sapiens) 6480464 [Lipopolysaccharides co-treated with Resveratrol] results in decreased expression of ME1 mRNA and [Plant Extracts co-treated with Resveratrol] results in increased expression of ME1 mRNA CTD PMID:23557933 and PMID:26667767 Me1 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of ME1 mRNA CTD PMID:28374803 Me1 Rat rotenone increases expression ISO ME1 (Homo sapiens) 6480464 Rotenone results in increased expression of ME1 mRNA CTD PMID:33512557 Me1 Rat S-(1,2-dichlorovinyl)-L-cysteine increases expression ISO ME1 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in increased expression of ME1 mRNA CTD PMID:33725128 and PMID:36576512 Me1 Rat saquinavir decreases expression ISO Me1 (Mus musculus) 6480464 Saquinavir results in decreased expression of ME1 mRNA CTD PMID:11741158 Me1 Rat SB 431542 multiple interactions ISO ME1 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Me1 Rat selenium atom decreases expression ISO ME1 (Homo sapiens) 6480464 Selenium results in decreased expression of ME1 mRNA CTD PMID:19244175 Me1 Rat sodium arsenate multiple interactions ISO ME1 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of ME1 mRNA CTD PMID:32525701 Me1 Rat sodium arsenite increases expression ISO ME1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of ME1 mRNA CTD PMID:25493608 more ... Me1 Rat sodium arsenite multiple interactions ISO ME1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ME1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of ME1 mRNA CTD PMID:39836092 Me1 Rat sodium arsenite multiple interactions ISO Me1 (Mus musculus) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ME1 mRNA CTD PMID:32045263 Me1 Rat sodium arsenite increases expression ISO Me1 (Mus musculus) 6480464 sodium arsenite results in increased expression of ME1 mRNA CTD PMID:25270620 and PMID:31532247 Me1 Rat sodium chloride multiple interactions ISO ME1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of ME1 protein more ... CTD PMID:38598786 Me1 Rat sodium dichromate decreases expression EXP 6480464 sodium bichromate results in decreased expression of ME1 mRNA CTD PMID:25993096 Me1 Rat sodium dichromate increases expression ISO Me1 (Mus musculus) 6480464 sodium bichromate results in increased expression of ME1 mRNA CTD PMID:31558096 Me1 Rat sodium dodecyl sulfate increases expression ISO ME1 (Homo sapiens) 6480464 Sodium Dodecyl Sulfate results in increased expression of ME1 mRNA CTD PMID:20566472 Me1 Rat stavudine multiple interactions ISO Me1 (Mus musculus) 6480464 [Stavudine co-treated with Lamivudine co-treated with Indinavir] results in increased expression of ME1 mRNA more ... CTD PMID:11741158 Me1 Rat stavudine increases expression ISO Me1 (Mus musculus) 6480464 Stavudine results in increased expression of ME1 mRNA CTD PMID:11741158 Me1 Rat sulforaphane increases expression ISO ME1 (Homo sapiens) 6480464 sulforaphane results in increased expression of ME1 mRNA CTD PMID:26833863 and PMID:31838189 Me1 Rat sulindac multiple interactions EXP 6480464 [Sulindac co-treated with lipopolysaccharide and E coli O55-B5] affects the expression of ME1 mRNA CTD PMID:20371263 Me1 Rat sunitinib increases expression ISO ME1 (Homo sapiens) 6480464 Sunitinib results in increased expression of ME1 mRNA CTD PMID:31533062 Me1 Rat tebufenpyrad increases expression ISO ME1 (Homo sapiens) 6480464 4-chloro-N-((4-(1 and 1-dimethylethyl)phenyl)methyl)-3-ethyl-1-methyl-1H-pyrazole-5-carboxamide results in increased expression of ME1 mRNA CTD PMID:33512557 Me1 Rat tert-butyl hydroperoxide increases expression ISO ME1 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in increased expression of ME1 mRNA CTD PMID:12414654 and PMID:15336504 Me1 Rat testosterone multiple interactions EXP 6480464 Testosterone inhibits the reaction [Dexamethasone results in decreased expression of ME1 mRNA] CTD PMID:20032058 Me1 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of ME1 protein CTD PMID:16538043 Me1 Rat tetrachloromethane multiple interactions EXP 6480464 [Olive Oil analog co-treated with Carbon Tetrachloride] affects the expression of ME1 protein CTD PMID:25303780 Me1 Rat tetracycline increases expression EXP 6480464 Tetracycline results in increased expression of ME1 protein CTD PMID:16538043 Me1 Rat thapsigargin increases expression EXP 6480464 Thapsigargin results in increased expression of ME1 protein CTD PMID:35544339 Me1 Rat thifluzamide increases expression ISO ME1 (Homo sapiens) 6480464 thifluzamide results in increased expression of ME1 mRNA CTD PMID:33512557 Me1 Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of ME1 mRNA CTD PMID:19483382 Me1 Rat thiram increases expression ISO ME1 (Homo sapiens) 6480464 Thiram results in increased expression of ME1 mRNA CTD PMID:38568856 Me1 Rat titanium dioxide decreases expression ISO Me1 (Mus musculus) 6480464 titanium dioxide results in decreased expression of ME1 mRNA CTD PMID:23557971 Me1 Rat topiramate decreases expression EXP 6480464 topiramate results in decreased expression of ME1 mRNA CTD PMID:16979414 Me1 Rat trans-isoeugenol increases expression ISO ME1 (Homo sapiens) 6480464 isoeugenol results in increased expression of ME1 mRNA CTD PMID:20566472 Me1 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of ME1 mRNA CTD PMID:19448997 Me1 Rat trichloroethene multiple interactions ISO Me1 (Mus musculus) 6480464 Trichloroethylene inhibits the reaction [Dietary Fats affects the expression of ME1 mRNA] CTD PMID:29669109 Me1 Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of ME1 gene CTD PMID:27618143 Me1 Rat trichloroethene increases expression ISO Me1 (Mus musculus) 6480464 Trichloroethylene results in increased expression of ME1 mRNA CTD PMID:25549359 Me1 Rat trichostatin A increases expression ISO ME1 (Homo sapiens) 6480464 trichostatin A results in increased expression of ME1 mRNA CTD PMID:24935251 and PMID:26272509 Me1 Rat triphenyl phosphate increases expression EXP 6480464 triphenyl phosphate results in increased expression of ME1 mRNA CTD PMID:30589522 Me1 Rat Triptolide decreases expression ISO Me1 (Mus musculus) 6480464 triptolide results in decreased expression of ME1 mRNA CTD PMID:32835833 Me1 Rat troglitazone increases expression EXP 6480464 troglitazone results in increased expression of ME1 mRNA and troglitazone results in increased expression of ME1 protein CTD PMID:21315101 and PMID:25596134 Me1 Rat trovafloxacin decreases expression EXP 6480464 trovafloxacin results in decreased expression of ME1 mRNA CTD PMID:24136188 Me1 Rat valdecoxib increases expression EXP 6480464 valdecoxib results in increased expression of ME1 mRNA CTD PMID:24136188 Me1 Rat valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of ME1 mRNA CTD PMID:17381134 Me1 Rat valproic acid increases methylation ISO ME1 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of ME1 gene CTD PMID:29501571 Me1 Rat valproic acid decreases expression ISO ME1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of ME1 protein CTD PMID:29501571 Me1 Rat valproic acid increases expression ISO ME1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of ME1 mRNA CTD PMID:23179753 more ... Me1 Rat valproic acid multiple interactions ISO ME1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ME1 mRNA CTD PMID:27188386 Me1 Rat valproic acid affects expression ISO ME1 (Homo sapiens) 6480464 Valproic Acid affects the expression of ME1 mRNA CTD PMID:25979313 Me1 Rat valproic acid affects expression ISO Me1 (Mus musculus) 6480464 Valproic Acid affects the expression of ME1 mRNA CTD PMID:17292431 and PMID:17963808 Me1 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of ME1 mRNA CTD PMID:22570695 Me1 Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of ME1 gene CTD PMID:30207508 Me1 Rat vitamin D affects expression ISO ME1 (Homo sapiens) 6480464 Vitamin D affects the expression of ME1 mRNA CTD PMID:20368581 Me1 Rat zidovudine multiple interactions ISO Me1 (Mus musculus) 6480464 [Zidovudine co-treated with Lamivudine co-treated with Indinavir] results in increased expression of ME1 mRNA and [Zidovudine co-treated with Lamivudine] affects the expression of ME1 mRNA CTD PMID:11741158 Me1 Rat zidovudine decreases expression ISO Me1 (Mus musculus) 6480464 Zidovudine results in decreased expression of ME1 mRNA CTD PMID:11741158 Me1 Rat zoledronic acid increases expression ISO ME1 (Homo sapiens) 6480464 zoledronic acid results in increased expression of ME1 mRNA CTD PMID:24714768 and PMID:25596134
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(1->4)-beta-D-glucan (ISO) (E)-cinnamyl alcohol (ISO) (S)-nicotine (ISO) 1,1-dichloroethene (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 1,4-phenylenediamine (ISO) 1-chloro-2,4-dinitrobenzene (ISO) 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP,ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-trinitrobenzenesulfonic acid (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,4-dinitrotoluene (EXP) 2,6-dimethoxyphenol (ISO) 2-hydroxypropanoic acid (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3,3',5-triiodo-L-thyronine (EXP) 3-chloropropane-1,2-diol (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3H-1,2-dithiole-3-thione (EXP) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP) 6-propyl-2-thiouracil (EXP) 9-cis,11-trans-octadecadienoic acid (ISO) Actein (EXP) afimoxifene (ISO) aflatoxin B1 (ISO) aldrin (ISO) all-trans-retinoic acid (ISO) alpha-hexachlorocyclohexane (EXP) alpha-hexylcinnamaldehyde (ISO) alpha-Zearalanol (EXP) amiodarone (EXP) ammonium chloride (EXP) antimycin A (ISO) aristolochic acid A (ISO) Aroclor 1254 (EXP) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) Augmentin (ISO) azoxystrobin (ISO) Bandrowski's base (ISO) benazepril (EXP) benzbromarone (EXP) benzene (EXP) benzo[a]pyrene (EXP,ISO) benzo[b]fluoranthene (EXP) benzoic acid (ISO) beta-naphthoflavone (ISO) bexarotene (EXP) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) bortezomib (ISO) buspirone (EXP) butanal (ISO) cadmium dichloride (EXP,ISO) cadmium sulfate (ISO) cannabidiol (ISO) captan (ISO) carbamazepine (EXP,ISO) carbon nanotube (ISO) celastrol (ISO) chloroacetaldehyde (ISO) chloroethene (ISO) chlorohydrocarbon (EXP) cinnamyl alcohol (ISO) cisplatin (ISO) clavulanic acid (ISO) clodronic acid (ISO) clofibrate (EXP,ISO) cobalt dichloride (EXP,ISO) copper(II) sulfate (ISO) corticosterone (EXP) cyclosporin A (EXP,ISO) daidzein (ISO) DDE (ISO) deguelin (ISO) dexamethasone (EXP,ISO) dextran sulfate (ISO) diarsenic trioxide (ISO) dibenz[a,h]anthracene (EXP) dibenzo[a,l]pyrene (EXP,ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) dichloroacetic acid (ISO) diethyl maleate (ISO) dioxygen (ISO) dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate (ISO) diquat (ISO) disulfiram (ISO) dorsomorphin (ISO) doxorubicin (ISO) elemental selenium (ISO) endosulfan (EXP) entinostat (ISO) equol (ISO) ethanol (EXP,ISO) eugenol (ISO) felbamate (EXP) fenofibrate (EXP,ISO) fenpyroximate (ISO) finasteride (EXP) fipronil (EXP) fluoranthene (EXP) flutamide (EXP) folic acid (ISO) folpet (ISO) formaldehyde (ISO) furan (EXP) furfural (ISO) gedunin (ISO) genistein (ISO) glafenine (EXP) glutathione (EXP) hexadecanoic acid (ISO) hexane (ISO) hydrogen peroxide (ISO) hydrogen sulfide (ISO) hypochlorous acid (ISO) ibuprofen (EXP) ifosfamide (ISO) indinavir (ISO) indole-3-methanol (EXP) indometacin (EXP,ISO) inulin (ISO) iron atom (ISO) iron(0) (ISO) isoeugenol (ISO) isoflavones (ISO) isotretinoin (ISO) ivermectin (ISO) ketoconazole (EXP) L-ethionine (EXP) lamivudine (ISO) lead diacetate (ISO) leflunomide (EXP) lipopolysaccharide (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) melatonin (EXP) menadione (ISO) mercury dibromide (ISO) mercury dichloride (ISO) Mesaconitine (EXP) metformin (EXP,ISO) methoxychlor (EXP) methyl salicylate (ISO) methylmercury chloride (EXP,ISO) methylseleninic acid (ISO) N-acetyl-L-cysteine (EXP) N-methyl-4-phenylpyridinium (ISO) N-methyl-N-nitrosourea (EXP) N-nitrosodiethylamine (EXP) nefazodone (EXP) nelfinavir (ISO) nickel sulfate (ISO) nicotine (ISO) ochratoxin A (EXP,ISO) omeprazole (EXP) oxfendazole (EXP) ozone (ISO) p-chloromercuribenzoic acid (ISO) paracetamol (EXP,ISO) paraquat (EXP) perfluorooctane-1-sulfonic acid (EXP,ISO) perfluorooctanoic acid (EXP,ISO) permethrin (ISO) phenethyl caffeate (EXP) phenobarbital (EXP,ISO) phenylmercury acetate (ISO) phenytoin (EXP) phytoestrogen (ISO) picoxystrobin (ISO) piperonyl butoxide (EXP) pirinixic acid (EXP,ISO) potassium bromate (ISO) pregnenolone 16alpha-carbonitrile (EXP) procymidone (EXP) propan-2-ol (ISO) pyrazinecarboxamide (EXP) pyrimidifen (ISO) quercetin 3-O-beta-D-glucofuranoside (EXP) quercetin 3-O-beta-D-glucopyranoside (EXP) rac-lactic acid (ISO) Rebamipide (EXP) resveratrol (ISO) rotenone (EXP,ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) saquinavir (ISO) SB 431542 (ISO) selenium atom (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sodium chloride (ISO) sodium dichromate (EXP,ISO) sodium dodecyl sulfate (ISO) stavudine (ISO) sulforaphane (ISO) sulindac (EXP) sunitinib (ISO) tebufenpyrad (ISO) tert-butyl hydroperoxide (ISO) testosterone (EXP) tetrachloromethane (EXP) tetracycline (EXP) thapsigargin (EXP) thifluzamide (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) topiramate (EXP) trans-isoeugenol (ISO) trichloroethene (EXP,ISO) trichostatin A (ISO) triphenyl phosphate (EXP) Triptolide (ISO) troglitazone (EXP) trovafloxacin (EXP) valdecoxib (EXP) valproic acid (EXP,ISO) vinclozolin (EXP) vitamin D (ISO) zidovudine (ISO) zoledronic acid (ISO)
Molecular Function
identical protein binding (IEA,ISO) magnesium ion binding (IEA,ISO,ISS) malate dehydrogenase (decarboxylating) (NADP+) activity (IBA,IDA,IEA,ISO,ISS) malic enzyme activity (IDA,IEA,ISO,ISS) manganese ion binding (IEA,ISO,ISS) metal ion binding (IEA) NAD binding (IEA) NADP binding (IDA) oxaloacetate decarboxylase activity (IEA,ISO,ISS) oxidoreductase activity (IEA) oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor (IEA) protein binding (ISO)
1.
Tissue-specific regulation of two functional malic enzyme mRNAs by triiodothyronine.
Dozin B, etal., Biochemistry. 1985 Sep 24;24(20):5581-6.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
4.
Cloning, sequencing and functional expression of a cDNA encoding a NADP-dependent malic enzyme from human liver.
Gonzalez-Manchon C, etal., Gene. 1995 Jul 4;159(2):255-60.
5.
Dietary lipoic acid-dependent changes in the activity and mRNA levels of hepatic lipogenic enzymes in rats.
Huong DT and Ide T, Br J Nutr. 2008 Jul;100(1):79-87. Epub 2007 Dec 7.
6.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
7.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
8.
Characterization of cytosolic malic enzyme in human tumor cells.
Loeber G, etal., FEBS Lett. 1994 May 16;344(2-3):181-6.
9.
Coding nucleotide sequence of rat liver malic enzyme mRNA.
Magnuson MA, etal., J Biol Chem 1986 Jan 25;261(3):1183-6.
10.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
11.
Structural characterization of the rat malic enzyme gene.
Morioka H, etal., Proc Natl Acad Sci U S A 1989 Jul;86(13):4912-6.
12.
Effect of cold acclimation on brown adipose tissue fatty acid synthesis in rats adapted to a high-protein, carbohydrate-free diet.
Moura MA, etal., Metabolism. 2001 Dec;50(12):1493-8.
13.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
14.
Cardiac glutaminolysis: a maladaptive cancer metabolism pathway in the right ventricle in pulmonary hypertension.
Piao L, etal., J Mol Med (Berl). 2013 Oct;91(10):1185-97. doi: 10.1007/s00109-013-1064-7. Epub 2013 Jun 21.
15.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
16.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
17.
GOA pipeline
RGD automated data pipeline
18.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
19.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
20.
Kinetics of induction by thyroid hormone of the two hepatic mRNAs coding for cytosolic malic enzyme in the hypothyroid and euthyroid states. Evidence against an obligatory role of S14 protein in malic enzyme gene expression.
Strait KA, etal., J Biol Chem 1989 Nov 25;264(33):19784-9.
21.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
22.
Effect of Anabolic Steroid Nandrolone Decanoate on the Properties of Certain Enzymes in the Heart, Liver, and Muscle of Rats, and their Effect on Rats' Cardiac Electrophysiology.
Tylicki A, etal., Horm Metab Res. 2007 Apr;39(4):268-72.
23.
Mitochondrial malic enzyme: purification from bovine brain, generation of an antiserum, and immunocytochemical localization in neurons of rat brain.
Vogel R, etal., J Neurochem. 1998 Aug;71(2):844-52.
Me1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 96,429,057 - 96,540,244 (-) NCBI GRCr8 mRatBN7.2 8 87,549,043 - 87,660,251 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 87,549,043 - 87,660,304 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 93,229,577 - 93,340,927 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 91,428,778 - 91,540,131 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 89,270,059 - 89,381,778 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 94,256,830 - 94,368,834 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 94,256,839 - 94,368,834 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 93,769,078 - 93,863,611 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 91,839,845 - 91,955,917 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 91,860,614 - 91,975,372 (-) NCBI Celera 8 87,151,761 - 87,246,579 (-) NCBI Celera RH 3.4 Map 8 999.69 RGD Cytogenetic Map 8 q31 NCBI
ME1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 83,210,402 - 83,431,051 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 83,210,402 - 83,431,051 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 83,920,121 - 84,140,770 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 83,976,827 - 84,197,498 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 83,977,975 - 84,197,499 NCBI Celera 6 84,353,414 - 84,574,177 (-) NCBI Celera Cytogenetic Map 6 q14.2 NCBI HuRef 6 81,148,328 - 81,370,879 (-) NCBI HuRef CHM1_1 6 84,017,801 - 84,238,482 (-) NCBI CHM1_1 T2T-CHM13v2.0 6 84,433,644 - 84,654,257 (-) NCBI T2T-CHM13v2.0
Me1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 86,463,416 - 86,577,967 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 86,463,424 - 86,578,006 (-) Ensembl GRCm39 Ensembl GRCm38 9 86,581,363 - 86,695,914 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 86,581,371 - 86,695,953 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 86,474,970 - 86,589,947 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 87,524,432 - 87,639,643 (-) NCBI MGSCv36 mm8 MGSCv36 9 86,378,094 - 86,492,941 (-) NCBI MGSCv36 mm8 Celera 9 83,658,088 - 83,772,920 (-) NCBI Celera Cytogenetic Map 9 E3.1 NCBI cM Map 9 46.58 NCBI
Me1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955411 10,938,944 - 11,065,085 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955411 10,938,580 - 11,084,171 (-) NCBI ChiLan1.0 ChiLan1.0
ME1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 103,312,102 - 103,524,703 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 101,204,935 - 101,421,593 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 81,107,569 - 81,320,050 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 84,382,732 - 84,595,701 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 84,382,732 - 84,595,701 (-) Ensembl panpan1.1 panPan2
ME1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 12 43,623,413 - 43,793,590 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 12 43,624,945 - 43,828,775 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 12 43,436,816 - 43,632,406 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 12 44,390,732 - 44,586,598 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 12 44,390,736 - 44,586,656 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 12 43,730,159 - 43,925,658 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 12 43,679,098 - 43,858,889 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 12 43,840,059 - 44,036,221 (-) NCBI UU_Cfam_GSD_1.0
Me1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404946 78,899,805 - 79,044,563 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936510 7,426,347 - 7,571,553 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936510 7,425,983 - 7,571,090 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ME1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 82,799,684 - 82,991,085 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 82,799,878 - 82,989,895 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 93,051,393 - 93,241,425 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3 Pig Cytomap 1 p12 NCBI
ME1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 13 7,889,211 - 8,112,793 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 13 7,887,984 - 8,112,533 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666040 184,102,580 - 184,333,948 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Me1
.
Predicted Target Of
Count of predictions: 174 Count of miRNA genes: 127 Interacting mature miRNAs: 150 Transcripts: ENSRNOT00000013244 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
12879878 Bw183 Body weight QTL 183 0.001 body mass (VT:0001259) body weight (CMO:0000012) 8 43296169 98968765 Rat 1300177 Cm2 Cardiac mass QTL 2 3.65 heart mass (VT:0007028) heart weight (CMO:0000017) 8 54259986 100382532 Rat 1549909 Stresp11 Stress response QTL 11 6.83 0.0019 stress-related behavior trait (VT:0010451) number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960) 8 73473045 118473045 Rat 1549908 Neudeg1 Neurodegradation QTL 1 5.5 0 nervous system integrity trait (VT:0010566) logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986) 8 30188867 94457446 Rat 12879879 Cm99 Cardiac mass QTL 99 0.001 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 43296169 98968765 Rat 1554321 Bmd3 Bone mineral density QTL 3 7.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 40952565 123900184 Rat 9590292 Uminl3 Urine mineral level QTL 3 3.62 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 8 71888757 116888757 Rat 1578769 Uae31 Urinary albumin excretion QTL 31 3.3 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 30848154 101699754 Rat 12879880 Cm100 Cardiac mass QTL 100 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 8 43296169 98968765 Rat 12879881 Cm101 Cardiac mass QTL 101 0.001 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 8 43296169 98968765 Rat 12879882 Am8 Aortic mass QTL 8 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 8 43296169 98968765 Rat 12879883 Kidm65 Kidney mass QTL 65 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 43296169 98968765 Rat 70161 Bp62 Blood pressure QTL 62 2.9 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 42692684 90165460 Rat 1358912 Bw51 Body weight QTL 51 2.95 body mass (VT:0001259) body weight (CMO:0000012) 8 51351728 107062046 Rat 1578765 Klgr1 Kidney lesion grade QTL 1 3.3 0.0001 kidney morphology trait (VT:0002135) organ lesion measurement (CMO:0000677) 8 30848154 101699754 Rat 1300171 Bp184 Blood pressure QTL 184 3.66 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 8 70513503 118219066 Rat 1578755 Pur5 Proteinuria QTL 5 3.3 0.0001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 8 30848154 101699754 Rat 2303171 Bp331 Blood pressure QTL 331 5.57 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 61290298 119084929 Rat 8662823 Vetf5 Vascular elastic tissue fragility QTL 5 1.9 artery integrity trait (VT:0010639) patent ductus arteriosus score (CMO:0002566) 8 28242912 99525068 Rat 2293697 Bmd39 Bone mineral density QTL 39 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 8 54043744 98968765 Rat 631210 Bw3 Body weight QTL3 5.9 mesenteric fat pad mass (VT:0010427) mesenteric fat pad weight to body weight ratio (CMO:0000654) 8 69349194 112783834 Rat 1358896 Bp262 Blood pressure QTL 262 2.89 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 27205715 99103503 Rat 731182 Uae24 Urinary albumin excretion QTL 24 6.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 19331152 93965294 Rat 1331837 Bw23 Body weight QTL 23 4.19 0.00007 body mass (VT:0001259) body weight (CMO:0000012) 8 46531722 99083736 Rat 1331838 Niddm61 Non-insulin dependent diabetes mellitus QTL 61 3.53 0.0004 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 36469535 99083736 Rat 8694446 Bw170 Body weight QTL 170 12.07 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 8 71888757 116888757 Rat 631650 Stl6 Serum triglyceride level QTL 6 4 0.0019 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 10378157 112202585 Rat 631653 Bp125 Blood pressure QTL 125 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 66142385 111142385 Rat 1581557 Eae16 Experimental allergic encephalomyelitis QTL 16 3.8 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 8 8462195 110921472 Rat 1358906 Bp253 Blood pressure QTL 253 4 0.0004 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 40713066 93965294 Rat 1358907 Cm40 Cardiac mass QTL 40 1.89 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 27205715 99103503 Rat 2303570 Gluco48 Glucose level QTL 48 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 49805831 94805831 Rat 70197 BpQTLcluster8 Blood pressure QTL cluster 8 3.482 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 46531639 119088626 Rat 2316950 Scl66 Serum cholesterol level QTL 66 4.1 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30848259 105647037 Rat 2300181 Bmd55 Bone mineral density QTL 55 5.7 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 76468691 121468691 Rat 10402857 Bp380 Blood pressure QTL 380 0.95 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 53968765 98968765 Rat 1358892 Kidm26 Kidney mass QTL 26 3.69 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 27205715 99103503 Rat 2301402 Bp316 Blood pressure QTL 316 0.005 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 53968765 98968765 Rat 631664 Hcar3 Hepatocarcinoma resistance QTL 3 2.9 0.0005 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 8 54237644 99103503 Rat 8694200 Abfw4 Abdominal fat weight QTL 4 9.07 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 8 71888757 116888757 Rat 8694392 Bw161 Body weight QTL 161 8.06 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 8 71888757 116888757 Rat 61437 Cia6 Collagen induced arthritis QTL 6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 8 82460758 122812818 Rat
RH129138
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 87,549,163 - 87,549,352 (+) MAPPER mRatBN7.2 Rnor_6.0 8 94,256,960 - 94,257,148 NCBI Rnor6.0 Rnor_5.0 8 93,769,199 - 93,769,387 UniSTS Rnor5.0 RGSC_v3.4 8 91,839,966 - 91,840,154 UniSTS RGSC3.4 Celera 8 87,151,882 - 87,152,070 UniSTS Cytogenetic Map 8 q31 UniSTS
AU048158
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 87,639,285 - 87,639,421 (+) MAPPER mRatBN7.2 Rnor_6.0 8 94,347,354 - 94,347,489 NCBI Rnor6.0 Rnor_5.0 8 93,858,715 - 93,858,850 UniSTS Rnor5.0 Celera 8 87,241,607 - 87,241,743 UniSTS Cytogenetic Map 8 q31 UniSTS
ME1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 87,614,953 - 87,615,108 (+) MAPPER mRatBN7.2 Rnor_6.0 8 94,322,488 - 94,322,642 NCBI Rnor6.0 Rnor_5.0 8 93,834,727 - 93,834,881 UniSTS Rnor5.0 RGSC_v3.4 8 91,905,747 - 91,905,901 UniSTS RGSC3.4 Celera 8 87,217,631 - 87,217,785 UniSTS Cytogenetic Map 8 q31 UniSTS
RH130391
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 87,550,091 - 87,550,287 (+) MAPPER mRatBN7.2 Rnor_6.0 8 94,257,888 - 94,258,083 NCBI Rnor6.0 Rnor_5.0 8 93,770,127 - 93,770,322 UniSTS Rnor5.0 RGSC_v3.4 8 91,840,894 - 91,841,089 UniSTS RGSC3.4 Celera 8 87,152,810 - 87,153,005 UniSTS RH 3.4 Map 8 998.59 UniSTS Cytogenetic Map 8 q31 UniSTS
RH94870
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 8 96,430,278 - 96,430,541 (+) Marker Load Pipeline mRatBN7.2 8 87,550,264 - 87,550,527 (+) MAPPER mRatBN7.2 Rnor_6.0 8 94,258,061 - 94,258,323 NCBI Rnor6.0 Rnor_5.0 8 93,770,300 - 93,770,562 UniSTS Rnor5.0 RGSC_v3.4 8 91,841,067 - 91,841,329 UniSTS RGSC3.4 Celera 8 87,152,983 - 87,153,245 UniSTS RH 3.4 Map 8 999.69 UniSTS Cytogenetic Map 8 q31 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000013244 ⟹ ENSRNOP00000013244
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 87,549,048 - 87,660,304 (-) Ensembl Rnor_6.0 Ensembl 8 94,256,839 - 94,352,246 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000078977 ⟹ ENSRNOP00000071968
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 87,549,043 - 87,659,923 (-) Ensembl Rnor_6.0 Ensembl 8 94,258,198 - 94,368,834 (-) Ensembl
RefSeq Acc Id:
NM_012600 ⟹ NP_036732
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 96,429,057 - 96,540,244 (-) NCBI mRatBN7.2 8 87,549,043 - 87,660,251 (-) NCBI Rnor_6.0 8 94,256,839 - 94,368,834 (-) NCBI Rnor_5.0 8 93,769,078 - 93,863,611 (-) NCBI RGSC_v3.4 8 91,839,845 - 91,955,917 (-) RGD Celera 8 87,151,761 - 87,246,579 (-) RGD
Sequence:
ATGGATCCCCGAGCCCCCCGACGCCGACACGCCCACCAGCGCGGCTACCTGCTGACGCGGGACCCGCATCTCAACAAGGACTTGGCTTTTACTCTGGAAGAGAGGCAACAGCTGAACATTCATGGCTT
hide sequence
RefSeq Acc Id:
NP_036732 ⟸ NM_012600
- UniProtKB:
P13697 (UniProtKB/Swiss-Prot)
- Sequence:
MDPRAPRRRHAHQRGYLLTRDPHLNKDLAFTLEERQQLNIHGLLPPCIVNQEIQVLRVIKNFERLNSDFDRYLLLMDLQDRNEKLFYSVLMSNVEKFMPIVYTPTVGLACQQYSLAFRKPRGLFISIH
hide sequence
Ensembl Acc Id:
ENSRNOP00000013244 ⟸ ENSRNOT00000013244
Ensembl Acc Id:
ENSRNOP00000071968 ⟸ ENSRNOT00000078977
RGD ID: 13696161 Promoter ID: EPDNEW_R6686 Type: initiation region Name: Me1_1 Description: malic enzyme 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 8 94,368,867 - 94,368,927 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-04-14
Me1
malic enzyme 1
Me1
malic enzyme 1, NADP(+)-dependent, cytosolic
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-02-15
Me1
malic enzyme 1, NADP(+)-dependent, cytosolic
Me1
malic enzyme 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-11-06
Me1
malic enzyme 1
Malic enzyme 1, soluble
Name updated
625702 APPROVED
2002-06-10
Me1
Malic enzyme 1, soluble
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_homology
putative NADP-binding site is similar to the fatty acid synthetase enoyl reductase NADP-binding domain
633307
