Symbol:
Mapk13
Name:
mitogen activated protein kinase 13
RGD ID:
3045
Description:
Enables ATP binding activity and MAP kinase activity. Involved in protein phosphorylation. Predicted to be active in cytoplasm and nucleus. Orthologous to human MAPK13 (mitogen-activated protein kinase 13); PARTICIPATES IN p38 MAPK signaling pathway; amyotrophic lateral sclerosis pathway; Chagas disease pathway; INTERACTS WITH 17alpha-ethynylestradiol; 2,2',5,5'-tetrachlorobiphenyl; 3-chloropropane-1,2-diol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
MAP kinase 13; MAP kinase p38 delta; MAPK 13; MGC124619; mitogen-activated protein kinase 13; mitogen-activated protein kinase p38 delta; Prkm13; stress-activated protein kinase 4
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 6,836,979 - 6,847,197 (+) NCBI GRCr8 mRatBN7.2 20 6,835,277 - 6,845,500 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 6,835,320 - 6,844,222 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 7,546,408 - 7,555,599 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 6,908,260 - 6,917,454 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 7,389,575 - 7,399,109 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 6,018,374 - 6,027,467 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 6,018,374 - 6,027,473 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 8,272,098 - 8,281,191 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 7,055,313 - 7,064,405 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 7,055,597 - 7,064,383 (+) NCBI Celera 20 8,389,500 - 8,398,583 (+) NCBI Celera Cytogenetic Map 20 p12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Mapk13 Rat (1->4)-beta-D-glucan multiple interactions ISO Mapk13 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of MAPK13 mRNA CTD PMID:36331819 Mapk13 Rat (S)-nicotine decreases expression ISO Mapk13 (Mus musculus) 6480464 Nicotine results in decreased expression of MAPK13 mRNA CTD PMID:17135361 Mapk13 Rat 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane decreases expression ISO MAPK13 (Homo sapiens) 6480464 o and p'-DDT results in decreased expression of MAPK13 mRNA CTD PMID:19371625 Mapk13 Rat 1,2-dimethylhydrazine multiple interactions ISO Mapk13 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of MAPK13 mRNA CTD PMID:22206623 Mapk13 Rat 14-Deoxy-11,12-didehydroandrographolide decreases expression ISO MAPK13 (Homo sapiens) 6480464 14-deoxy-11 and 12-didehydroandrographolide results in decreased expression of MAPK13 mRNA CTD PMID:22101062 Mapk13 Rat 17alpha-ethynylestradiol increases expression ISO Mapk13 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of MAPK13 mRNA CTD PMID:17942748 Mapk13 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of MAPK13 mRNA CTD PMID:17557909 Mapk13 Rat 17beta-estradiol increases expression ISO Mapk13 (Mus musculus) 6480464 Estradiol results in increased expression of MAPK13 mRNA CTD PMID:19484750 Mapk13 Rat 17beta-estradiol multiple interactions ISO MAPK13 (Homo sapiens) 6480464 IGF1R mutant form inhibits the reaction [Estradiol results in increased expression of MAPK13 mRNA] CTD PMID:23094148 Mapk13 Rat 17beta-estradiol increases expression ISO MAPK13 (Homo sapiens) 6480464 Estradiol results in increased expression of MAPK13 mRNA CTD PMID:23094148 Mapk13 Rat 2,2',5,5'-tetrachlorobiphenyl increases expression EXP 6480464 2 more ... CTD PMID:23829299 Mapk13 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO MAPK13 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of MAPK13 mRNA CTD PMID:23152189 Mapk13 Rat 2-hydroxypropanoic acid decreases expression ISO MAPK13 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of MAPK13 mRNA CTD PMID:30851411 Mapk13 Rat 3-chloropropane-1,2-diol decreases expression EXP 6480464 alpha-Chlorohydrin results in decreased expression of MAPK13 mRNA CTD PMID:28522335 Mapk13 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO MAPK13 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in decreased expression of MAPK13 mRNA CTD PMID:28628672 Mapk13 Rat 4,4'-sulfonyldiphenol increases expression ISO Mapk13 (Mus musculus) 6480464 bisphenol S results in increased expression of MAPK13 mRNA CTD PMID:30951980 Mapk13 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of MAPK13 mRNA CTD PMID:36041667 Mapk13 Rat 4-hydroxyphenyl retinamide increases expression ISO Mapk13 (Mus musculus) 6480464 Fenretinide results in increased expression of MAPK13 mRNA CTD PMID:28973697 Mapk13 Rat 4-nitrophenol decreases expression ISO Mapk13 (Mus musculus) 6480464 4-nitrophenol results in decreased expression of MAPK13 mRNA CTD PMID:34673133 Mapk13 Rat 5-fluorouracil increases expression ISO MAPK13 (Homo sapiens) 6480464 Fluorouracil results in increased expression of MAPK13 protein CTD PMID:15585135 and PMID:16803524 Mapk13 Rat afimoxifene decreases response to substance ISO MAPK13 (Homo sapiens) 6480464 MAPK13 results in decreased susceptibility to afimoxifene CTD PMID:21233418 Mapk13 Rat Aflatoxin B2 alpha increases methylation ISO MAPK13 (Homo sapiens) 6480464 aflatoxin B2 results in increased methylation of MAPK13 intron CTD PMID:30157460 Mapk13 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of MAPK13 mRNA CTD PMID:35163327 Mapk13 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of MAPK13 mRNA CTD PMID:16483693 Mapk13 Rat aristolochic acid A increases expression ISO MAPK13 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of MAPK13 mRNA CTD PMID:33212167 Mapk13 Rat arsenous acid increases expression ISO MAPK13 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of MAPK13 mRNA CTD PMID:29633893 Mapk13 Rat azathioprine increases expression ISO MAPK13 (Homo sapiens) 6480464 Azathioprine results in increased expression of MAPK13 mRNA CTD PMID:22623647 Mapk13 Rat benzo[a]pyrene increases expression ISO MAPK13 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of MAPK13 mRNA CTD PMID:20106945 more ... Mapk13 Rat benzo[a]pyrene affects methylation ISO MAPK13 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of MAPK13 3' UTR and Benzo(a)pyrene affects the methylation of MAPK13 promoter CTD PMID:27901495 Mapk13 Rat bis(2-chloroethyl) sulfide decreases expression ISO Mapk13 (Mus musculus) 6480464 Mustard Gas results in decreased expression of MAPK13 mRNA CTD PMID:18955075 Mapk13 Rat bis(2-ethylhexyl) phthalate increases expression ISO Mapk13 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of MAPK13 mRNA CTD PMID:33754040 Mapk13 Rat bisphenol A decreases expression ISO MAPK13 (Homo sapiens) 6480464 bisphenol A results in decreased expression of MAPK13 mRNA CTD PMID:19371625 Mapk13 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of MAPK13 mRNA CTD PMID:36041667 Mapk13 Rat bisphenol A increases expression ISO Mapk13 (Mus musculus) 6480464 bisphenol A results in increased expression of MAPK13 mRNA CTD PMID:32156529 Mapk13 Rat bisphenol F increases expression ISO Mapk13 (Mus musculus) 6480464 bisphenol F results in increased expression of MAPK13 mRNA CTD PMID:30951980 Mapk13 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of MAPK13 mRNA CTD PMID:36041667 Mapk13 Rat bisphenol F decreases expression ISO Mapk13 (Mus musculus) 6480464 bisphenol F results in decreased expression of MAPK13 mRNA CTD PMID:38685157 Mapk13 Rat butan-1-ol multiple interactions ISO MAPK13 (Homo sapiens) 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of MAPK13 mRNA CTD PMID:29432896 Mapk13 Rat cadmium dichloride multiple interactions ISO MAPK13 (Homo sapiens) 6480464 [SB 203580 co-treated with Cadmium Chloride] results in increased expression of MAPK13 mRNA CTD PMID:19757093 Mapk13 Rat cadmium dichloride increases expression ISO MAPK13 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of MAPK13 mRNA CTD PMID:32512071 Mapk13 Rat cadmium dichloride decreases methylation EXP 6480464 Cadmium Chloride results in decreased methylation of MAPK13 promoter CTD PMID:22457795 Mapk13 Rat calcitriol increases expression ISO MAPK13 (Homo sapiens) 6480464 Calcitriol results in increased expression of MAPK13 mRNA CTD PMID:16002434 and PMID:26485663 Mapk13 Rat carbamazepine affects expression ISO MAPK13 (Homo sapiens) 6480464 Carbamazepine affects the expression of MAPK13 mRNA CTD PMID:24752500 Mapk13 Rat carbon nanotube increases expression ISO Mapk13 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Mapk13 Rat choline multiple interactions ISO Mapk13 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of MAPK13 mRNA CTD PMID:20938992 Mapk13 Rat cisplatin increases expression ISO MAPK13 (Homo sapiens) 6480464 Cisplatin results in increased expression of MAPK13 mRNA CTD PMID:38498338 Mapk13 Rat copper(II) sulfate increases expression ISO MAPK13 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of MAPK13 mRNA CTD PMID:19549813 Mapk13 Rat cyclosporin A increases expression ISO MAPK13 (Homo sapiens) 6480464 Cyclosporine results in increased expression of MAPK13 mRNA CTD PMID:25562108 Mapk13 Rat dexamethasone multiple interactions ISO MAPK13 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in decreased expression of MAPK13 mRNA CTD PMID:28628672 Mapk13 Rat dextran sulfate multiple interactions ISO Mapk13 (Mus musculus) 6480464 evodiamine inhibits the reaction [Dextran Sulfate results in increased expression of MAPK13 protein] CTD PMID:35362542 Mapk13 Rat dextran sulfate increases expression ISO Mapk13 (Mus musculus) 6480464 Dextran Sulfate results in increased expression of MAPK13 protein CTD PMID:35362542 Mapk13 Rat diarsenic trioxide increases expression ISO MAPK13 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of MAPK13 mRNA CTD PMID:29633893 Mapk13 Rat dibutyl phthalate increases expression ISO Mapk13 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of MAPK13 mRNA CTD PMID:21266533 Mapk13 Rat dichloroacetic acid increases expression ISO Mapk13 (Mus musculus) 6480464 Dichloroacetic Acid results in increased expression of MAPK13 mRNA CTD PMID:28962523 Mapk13 Rat diclofenac affects expression ISO MAPK13 (Homo sapiens) 6480464 Diclofenac affects the expression of MAPK13 mRNA CTD PMID:24752500 Mapk13 Rat dieldrin affects expression EXP 6480464 Dieldrin affects the expression of MAPK13 mRNA CTD PMID:22546817 Mapk13 Rat dioxygen increases expression EXP 6480464 Oxygen results in increased expression of MAPK13 mRNA CTD PMID:22911455 Mapk13 Rat dioxygen increases expression ISO MAPK13 (Homo sapiens) 6480464 Oxygen deficiency results in increased expression of MAPK13 mRNA CTD PMID:26516004 Mapk13 Rat dorsomorphin multiple interactions ISO MAPK13 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Mapk13 Rat doxorubicin increases expression ISO MAPK13 (Homo sapiens) 6480464 Doxorubicin results in increased expression of MAPK13 mRNA CTD PMID:30031762 Mapk13 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of MAPK13 mRNA CTD PMID:29391264 Mapk13 Rat entinostat increases expression ISO MAPK13 (Homo sapiens) 6480464 entinostat results in increased expression of MAPK13 mRNA CTD PMID:26272509 Mapk13 Rat entinostat multiple interactions ISO MAPK13 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MAPK13 mRNA CTD PMID:27188386 Mapk13 Rat ethanol multiple interactions ISO Mapk13 (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in increased expression of MAPK13 mRNA CTD PMID:30517762 Mapk13 Rat Evodiamine multiple interactions ISO Mapk13 (Mus musculus) 6480464 evodiamine inhibits the reaction [Dextran Sulfate results in increased expression of MAPK13 protein] CTD PMID:35362542 Mapk13 Rat folic acid multiple interactions ISO Mapk13 (Mus musculus) 6480464 [1 more ... CTD PMID:20938992 and PMID:22206623 Mapk13 Rat furan increases expression EXP 6480464 furan results in increased expression of MAPK13 mRNA CTD PMID:38160780 Mapk13 Rat genistein decreases expression ISO MAPK13 (Homo sapiens) 6480464 Genistein results in decreased expression of MAPK13 mRNA CTD PMID:19371625 Mapk13 Rat glyphosate decreases expression ISO MAPK13 (Homo sapiens) 6480464 Glyphosate results in decreased expression of MAPK13 mRNA CTD PMID:31295307 Mapk13 Rat graphite affects expression EXP 6480464 Graphite affects the expression of MAPK13 mRNA CTD PMID:29933104 Mapk13 Rat indometacin multiple interactions ISO MAPK13 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in decreased expression of MAPK13 mRNA CTD PMID:28628672 Mapk13 Rat irinotecan affects expression EXP 6480464 Irinotecan affects the expression of MAPK13 mRNA CTD PMID:20097248 Mapk13 Rat L-methionine multiple interactions ISO Mapk13 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of MAPK13 mRNA CTD PMID:20938992 Mapk13 Rat monosodium L-glutamate affects expression EXP 6480464 Sodium Glutamate affects the expression of MAPK13 mRNA CTD PMID:28954212 Mapk13 Rat N-acetyl-L-cysteine multiple interactions ISO MAPK13 (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [cholix toxin and Vibrio cholerae results in increased phosphorylation of MAPK13 protein] CTD PMID:28087840 Mapk13 Rat N-acetyl-L-cysteine multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [[nonylphenol co-treated with octylphenol] results in increased phosphorylation of MAPK13 protein] CTD PMID:38642822 Mapk13 Rat N-methyl-4-phenylpyridinium increases phosphorylation EXP 6480464 1-Methyl-4-phenylpyridinium results in increased phosphorylation of MAPK13 protein CTD PMID:33035625 Mapk13 Rat N-methyl-4-phenylpyridinium multiple interactions EXP 6480464 H 1356 inhibits the reaction [IGF1 protein inhibits the reaction [1-Methyl-4-phenylpyridinium results in increased phosphorylation of MAPK13 protein]] and IGF1 protein inhibits the reaction [1-Methyl-4-phenylpyridinium results in increased phosphorylation of MAPK13 protein] CTD PMID:33035625 Mapk13 Rat nickel atom increases expression ISO MAPK13 (Homo sapiens) 6480464 Nickel results in increased expression of MAPK13 mRNA CTD PMID:25583101 Mapk13 Rat nickel dichloride affects expression EXP 6480464 nickel chloride affects the expression of MAPK13 mRNA CTD PMID:22546817 Mapk13 Rat nickel sulfate decreases expression ISO MAPK13 (Homo sapiens) 6480464 nickel sulfate results in decreased expression of MAPK13 mRNA CTD PMID:22714537 Mapk13 Rat nicotine decreases expression ISO Mapk13 (Mus musculus) 6480464 Nicotine results in decreased expression of MAPK13 mRNA CTD PMID:17135361 Mapk13 Rat nilotinib decreases expression ISO Mapk13 (Mus musculus) 6480464 nilotinib results in decreased expression of MAPK13 protein CTD PMID:38061604 Mapk13 Rat Nonylphenol multiple interactions EXP 6480464 [nonylphenol co-treated with octylphenol] results in increased phosphorylation of MAPK13 protein more ... CTD PMID:38642822 Mapk13 Rat ozone multiple interactions ISO Mapk13 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of MAPK13 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of MAPK13 mRNA CTD PMID:34911549 Mapk13 Rat ozone multiple interactions ISO MAPK13 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of MAPK13 mRNA CTD PMID:35430440 Mapk13 Rat paclitaxel increases expression ISO MAPK13 (Homo sapiens) 6480464 Paclitaxel results in increased expression of MAPK13 protein CTD PMID:15907983 Mapk13 Rat panobinostat multiple interactions ISO MAPK13 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MAPK13 mRNA CTD PMID:27188386 Mapk13 Rat panobinostat increases expression ISO MAPK13 (Homo sapiens) 6480464 panobinostat results in increased expression of MAPK13 mRNA CTD PMID:26272509 Mapk13 Rat paracetamol increases expression ISO MAPK13 (Homo sapiens) 6480464 Acetaminophen results in increased expression of MAPK13 mRNA CTD PMID:22230336 Mapk13 Rat paraquat increases expression ISO Mapk13 (Mus musculus) 6480464 Paraquat results in increased expression of MAPK13 mRNA CTD PMID:28012437 Mapk13 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of MAPK13 mRNA CTD PMID:32680482 Mapk13 Rat paricalcitol multiple interactions ISO MAPK13 (Homo sapiens) 6480464 [Phosphorus co-treated with paricalcitol] results in increased expression of MAPK13 mRNA CTD PMID:17715259 Mapk13 Rat PCB138 decreases expression EXP 6480464 2 more ... CTD PMID:23829299 Mapk13 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Mapk13 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of MAPK13 mRNA CTD PMID:36331819 Mapk13 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of MAPK13 mRNA CTD PMID:35163327 Mapk13 Rat phosphorus atom multiple interactions ISO MAPK13 (Homo sapiens) 6480464 [Phosphorus co-treated with paricalcitol] results in increased expression of MAPK13 mRNA CTD PMID:17715259 Mapk13 Rat phosphorus(.) multiple interactions ISO MAPK13 (Homo sapiens) 6480464 [Phosphorus co-treated with paricalcitol] results in increased expression of MAPK13 mRNA CTD PMID:17715259 Mapk13 Rat pirinixic acid multiple interactions ISO Mapk13 (Mus musculus) 6480464 [pirinixic acid co-treated with PPARA] results in increased expression of MAPK13 mRNA and PPARA protein promotes the reaction [pirinixic acid results in increased expression of MAPK13 mRNA] CTD PMID:17950772 and PMID:20813756 Mapk13 Rat pirinixic acid increases expression ISO Mapk13 (Mus musculus) 6480464 pirinixic acid results in increased expression of MAPK13 mRNA CTD PMID:17950772 more ... Mapk13 Rat pyrogallol increases expression ISO Mapk13 (Mus musculus) 6480464 Pyrogallol results in increased expression of MAPK13 mRNA CTD PMID:20362636 Mapk13 Rat quercetin affects expression ISO MAPK13 (Homo sapiens) 6480464 Quercetin affects the expression of MAPK13 protein CTD PMID:15221776 Mapk13 Rat quercetin increases expression ISO MAPK13 (Homo sapiens) 6480464 Quercetin results in increased expression of MAPK13 mRNA CTD PMID:21632981 Mapk13 Rat rac-lactic acid decreases expression ISO MAPK13 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of MAPK13 mRNA CTD PMID:30851411 Mapk13 Rat resveratrol decreases expression ISO MAPK13 (Homo sapiens) 6480464 resveratrol results in decreased expression of MAPK13 mRNA CTD PMID:19371625 Mapk13 Rat SB 203580 multiple interactions ISO MAPK13 (Homo sapiens) 6480464 [SB 203580 co-treated with Cadmium Chloride] results in increased expression of MAPK13 mRNA CTD PMID:19757093 Mapk13 Rat SB 431542 multiple interactions ISO MAPK13 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Mapk13 Rat silicon dioxide increases expression ISO MAPK13 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of MAPK13 mRNA CTD PMID:25895662 Mapk13 Rat sodium arsenite increases expression ISO MAPK13 (Homo sapiens) 6480464 sodium arsenite results in increased expression of MAPK13 mRNA CTD PMID:20886546 Mapk13 Rat sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of MAPK13 mRNA CTD PMID:35314868 Mapk13 Rat sodium arsenite multiple interactions ISO MAPK13 (Homo sapiens) 6480464 sodium arsenite results in increased phosphorylation of and results in increased activity of MAPK13 protein CTD PMID:15504454 Mapk13 Rat sodium dichromate decreases expression ISO MAPK13 (Homo sapiens) 6480464 sodium bichromate results in decreased expression of MAPK13 mRNA CTD PMID:17685462 Mapk13 Rat sulfates affects methylation ISO MAPK13 (Homo sapiens) 6480464 Sulfates affects the methylation of MAPK13 promoter CTD PMID:25395096 Mapk13 Rat sunitinib increases expression ISO MAPK13 (Homo sapiens) 6480464 Sunitinib results in increased expression of MAPK13 mRNA CTD PMID:31533062 Mapk13 Rat tetrachloromethane multiple interactions ISO Mapk13 (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in increased expression of MAPK13 mRNA CTD PMID:30517762 Mapk13 Rat thioacetamide affects methylation EXP 6480464 Thioacetamide affects the methylation of MAPK13 promoter CTD PMID:25151969 Mapk13 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of MAPK13 mRNA CTD PMID:34492290 Mapk13 Rat titanium dioxide increases expression ISO Mapk13 (Mus musculus) 6480464 titanium dioxide results in increased expression of MAPK13 mRNA CTD PMID:27760801 Mapk13 Rat titanium dioxide affects expression ISO Mapk13 (Mus musculus) 6480464 titanium dioxide affects the expression of MAPK13 mRNA CTD PMID:23557971 Mapk13 Rat triphenyl phosphate affects expression ISO MAPK13 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of MAPK13 mRNA CTD PMID:37042841 Mapk13 Rat tris(2-butoxyethyl) phosphate affects expression ISO MAPK13 (Homo sapiens) 6480464 tris(2-butoxyethyl) phosphate affects the expression of MAPK13 mRNA CTD PMID:29024780 Mapk13 Rat urethane decreases expression ISO MAPK13 (Homo sapiens) 6480464 Urethane results in decreased expression of MAPK13 mRNA CTD PMID:28818685 Mapk13 Rat valproic acid affects expression ISO Mapk13 (Mus musculus) 6480464 Valproic Acid affects the expression of MAPK13 mRNA CTD PMID:17292431 Mapk13 Rat valproic acid increases methylation ISO MAPK13 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of MAPK13 gene CTD PMID:29501571 Mapk13 Rat valproic acid multiple interactions ISO MAPK13 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MAPK13 mRNA CTD PMID:27188386 Mapk13 Rat valproic acid increases expression ISO MAPK13 (Homo sapiens) 6480464 Valproic Acid results in increased expression of MAPK13 mRNA CTD PMID:23179753 more ... Mapk13 Rat valproic acid decreases expression ISO MAPK13 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of MAPK13 mRNA CTD PMID:29154799 and PMID:29501571 Mapk13 Rat vancomycin decreases expression ISO Mapk13 (Mus musculus) 6480464 Vancomycin results in decreased expression of MAPK13 mRNA CTD PMID:18930951 Mapk13 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of MAPK13 mRNA CTD PMID:22570695 Mapk13 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of MAPK13 mRNA CTD PMID:23034163 Mapk13 Rat zearalenone decreases expression ISO MAPK13 (Homo sapiens) 6480464 Zearalenone results in decreased expression of MAPK13 mRNA CTD PMID:19371625
Imported Annotations - KEGG (archival)
(1->4)-beta-D-glucan (ISO) (S)-nicotine (ISO) 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (ISO) 1,2-dimethylhydrazine (ISO) 14-Deoxy-11,12-didehydroandrographolide (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (ISO) 2,2',5,5'-tetrachlorobiphenyl (EXP) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2-hydroxypropanoic acid (ISO) 3-chloropropane-1,2-diol (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 4-hydroxyphenyl retinamide (ISO) 4-nitrophenol (ISO) 5-fluorouracil (ISO) afimoxifene (ISO) Aflatoxin B2 alpha (ISO) alpha-Zearalanol (EXP) ammonium chloride (EXP) aristolochic acid A (ISO) arsenous acid (ISO) azathioprine (ISO) benzo[a]pyrene (ISO) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (EXP,ISO) butan-1-ol (ISO) cadmium dichloride (EXP,ISO) calcitriol (ISO) carbamazepine (ISO) carbon nanotube (ISO) choline (ISO) cisplatin (ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) dexamethasone (ISO) dextran sulfate (ISO) diarsenic trioxide (ISO) dibutyl phthalate (ISO) dichloroacetic acid (ISO) diclofenac (ISO) dieldrin (EXP) dioxygen (EXP,ISO) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP) entinostat (ISO) ethanol (ISO) Evodiamine (ISO) folic acid (ISO) furan (EXP) genistein (ISO) glyphosate (ISO) graphite (EXP) indometacin (ISO) irinotecan (EXP) L-methionine (ISO) monosodium L-glutamate (EXP) N-acetyl-L-cysteine (EXP,ISO) N-methyl-4-phenylpyridinium (EXP) nickel atom (ISO) nickel dichloride (EXP) nickel sulfate (ISO) nicotine (ISO) nilotinib (ISO) Nonylphenol (EXP) ozone (ISO) paclitaxel (ISO) panobinostat (ISO) paracetamol (ISO) paraquat (EXP,ISO) paricalcitol (ISO) PCB138 (EXP) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP) phosphorus atom (ISO) phosphorus(.) (ISO) pirinixic acid (ISO) pyrogallol (ISO) quercetin (ISO) rac-lactic acid (ISO) resveratrol (ISO) SB 203580 (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (EXP,ISO) sodium dichromate (ISO) sulfates (ISO) sunitinib (ISO) tetrachloromethane (ISO) thioacetamide (EXP) titanium dioxide (ISO) triphenyl phosphate (ISO) tris(2-butoxyethyl) phosphate (ISO) urethane (ISO) valproic acid (ISO) vancomycin (ISO) vinclozolin (EXP) zearalenone (ISO)
Biological Process
cellular response to anisomycin (IEA,ISO) cellular response to hydrogen peroxide (IEA,ISO) cellular response to interleukin-1 (IEA,ISO) cellular response to sodium arsenite (IEA,ISO) cellular response to sorbitol (IEA,ISO) cellular response to UV (IEA,ISO) intracellular signal transduction (IBA) MAPK cascade (IEA) positive regulation of inflammatory response (IEA,ISO) positive regulation of interleukin-6 production (IEA,ISO) protein phosphorylation (IDA) response to osmotic stress (IEA,ISO) stress-activated MAPK cascade (IEA,ISO,ISS)
1.
p38 MAP-kinases pathway regulation, function and role in human diseases.
Cuenda A and Rousseau S, Biochim Biophys Acta. 2007 Aug;1773(8):1358-75. Epub 2007 Mar 24.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
4.
Murine p38-delta mitogen-activated protein kinase, a developmentally regulated protein kinase that is activated by stress and proinflammatory cytokines.
Hu MC, etal., J Biol Chem 1999 Mar 12;274(11):7095-102.
5.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
6.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
7.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
8.
GOA pipeline
RGD automated data pipeline
9.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
11.
Melatonin arrests peroxynitrite-induced tau hyperphosphorylation and the overactivation of protein kinases in rat brain.
Yin J, etal., J Pineal Res. 2006 Sep;41(2):124-9.
Mapk13 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 6,836,979 - 6,847,197 (+) NCBI GRCr8 mRatBN7.2 20 6,835,277 - 6,845,500 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 6,835,320 - 6,844,222 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 7,546,408 - 7,555,599 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 6,908,260 - 6,917,454 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 7,389,575 - 7,399,109 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 6,018,374 - 6,027,467 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 6,018,374 - 6,027,473 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 8,272,098 - 8,281,191 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 7,055,313 - 7,064,405 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 7,055,597 - 7,064,383 (+) NCBI Celera 20 8,389,500 - 8,398,583 (+) NCBI Celera Cytogenetic Map 20 p12 NCBI
MAPK13 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 36,130,513 - 36,144,521 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 36,127,809 - 36,144,524 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 36,098,290 - 36,112,298 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 36,206,240 - 36,215,820 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 36,206,239 - 36,215,820 NCBI Celera 6 37,652,800 - 37,662,381 (+) NCBI Celera Cytogenetic Map 6 p21.31 NCBI HuRef 6 35,818,129 - 35,832,173 (+) NCBI HuRef CHM1_1 6 36,100,011 - 36,114,054 (+) NCBI CHM1_1 T2T-CHM13v2.0 6 35,950,829 - 35,964,842 (+) NCBI T2T-CHM13v2.0
Mapk13 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 28,988,260 - 28,997,678 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 28,988,271 - 28,999,207 (+) Ensembl GRCm39 Ensembl GRCm38 17 28,769,286 - 28,778,704 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 28,769,297 - 28,780,233 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 28,906,262 - 28,915,649 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 28,496,946 - 28,506,293 (+) NCBI MGSCv36 mm8 Celera 17 29,324,078 - 29,333,467 (+) NCBI Celera Cytogenetic Map 17 A3.3 NCBI cM Map 17 15.0 NCBI
Mapk13 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955437 3,899,950 - 3,909,114 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955437 3,899,988 - 3,907,781 (+) NCBI ChiLan1.0 ChiLan1.0
MAPK13 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 50,589,442 - 50,619,036 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 46,458,940 - 46,488,555 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 35,689,475 - 35,711,990 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 36,890,205 - 36,904,528 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 36,890,974 - 36,899,388 (+) Ensembl panpan1.1 panPan2
MAPK13 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 12 5,239,783 - 5,248,197 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 12 5,239,750 - 5,248,196 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 12 5,259,690 - 5,268,114 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 12 5,587,473 - 5,595,899 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 12 5,587,535 - 5,595,894 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 12 5,242,126 - 5,250,558 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 12 5,321,188 - 5,329,595 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 12 5,421,369 - 5,429,783 (+) NCBI UU_Cfam_GSD_1.0
Mapk13 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404946 40,741,448 - 40,748,117 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936476 23,212,074 - 23,218,775 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936476 23,212,116 - 23,218,726 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
MAPK13
MAPK13 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 17 35,982,749 - 35,993,956 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 17 35,983,430 - 35,992,468 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666044 36,084,986 - 36,097,950 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Mapk13
.
Predicted Target Of
Count of predictions: 84 Count of miRNA genes: 67 Interacting mature miRNAs: 72 Transcripts: ENSRNOT00000000621 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1641915 Colcr9 Colorectal carcinoma resistance QTL 9 2.97 0.0024 intestine integrity trait (VT:0010554) benign colorectal tumor number (CMO:0001795) 20 1530655 46530655 Rat 2317057 Aia27 Adjuvant induced arthritis QTL 27 2.83 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 20 2892597 26381954 Rat 7387283 Uae44 Urinary albumin excretion QTL 44 0.1712 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 20 1 26123605 Rat 7411668 Foco32 Food consumption QTL 32 8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 1 36600972 Rat 2305926 Iddm37 Insulin dependent diabetes mellitus QTL 37 6 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 20 1527842 46527842 Rat 1354642 Despr15 Despair related QTL 15 0.0027 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 20 1 24159021 Rat 1600382 Edcs3 Endometrial carcinoma susceptibility QTL3 3.5 0.003 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 20 1 25159026 Rat 1558640 Prcs2 Prostate cancer susceptibility QTL 2 3.3 prostate integrity trait (VT:0010571) percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943) 20 4606607 17617956 Rat 1331772 Cdexp2 CD45RC expression in CD8 T cells QTL 2 5.7 CD8-positive T cell quantity (VT:0008077) blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990) 20 3621649 10078919 Rat 8694189 Bw153 Body weight QTL 153 3.13 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 20 1 29191651 Rat 1300152 Bp195 Blood pressure QTL 195 3.46 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 20 3621649 9243559 Rat 4889857 Pur27 Proteinuria QTL 27 12.2 0.001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 20 4606607 17617956 Rat 70154 Insul2 Insulin level QTL 2 3.75 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 20 6691706 17489458 Rat 9590109 Sffal8 Serum free fatty acids level QTL 8 5.32 0.01 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 20 1 29191651 Rat 9590275 Scort15 Serum corticosterone level QTL 15 3.48 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 20 1 29191651 Rat 9589155 Insul32 Insulin level QTL 32 6.38 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 20 1 29191651 Rat 7411650 Foco23 Food consumption QTL 23 20.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 1 29191651 Rat 2317851 Alcrsp22 Alcohol response QTL 22 3.2 0.05 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 20 1 27339237 Rat 1598816 Memor12 Memory QTL 12 2.4 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 20 2606836 47606836 Rat 61432 Cia1 Collagen induced arthritis QTL 1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 20 3621656 14101050 Rat 1641893 Alcrsp7 Alcohol response QTL 7 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 20 1 27339237 Rat 6893685 Bw111 Body weight QTL 111 2.7 0.004 body mass (VT:0001259) body weight (CMO:0000012) 20 1 32578807 Rat 9590252 Scort12 Serum corticosterone level QTL 12 20.46 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 20 1 36600972 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
10
49
112
91
90
59
25
59
6
217
96
92
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000000621 ⟹ ENSRNOP00000000621
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 6,835,320 - 6,844,222 (+) Ensembl Rnor_6.0 Ensembl 20 6,018,374 - 6,027,473 (+) Ensembl
RefSeq Acc Id:
NM_019231 ⟹ NP_062104
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 6,837,019 - 6,846,114 (+) NCBI mRatBN7.2 20 6,835,320 - 6,844,417 (+) NCBI Rnor_6.0 20 6,018,374 - 6,027,467 (+) NCBI Rnor_5.0 20 8,272,098 - 8,281,191 (+) NCBI RGSC_v3.4 20 7,055,313 - 7,064,405 (+) RGD Celera 20 8,389,500 - 8,398,583 (+) RGD
Sequence:
CCCGGGCCGGGAGCCCGCGGGCAGCCACCGCAACCTCCTCGCAGGGCCGCCACCACGGGGTCCGGGATGAGCCTCATTCGGAAAAGGGGCTTCTACAAGCAGGACATCAACAAGACTGCCTGGGAGCT
hide sequence
RefSeq Acc Id:
XM_039098625 ⟹ XP_038954553
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 6,836,992 - 6,847,197 (+) NCBI mRatBN7.2 20 6,835,277 - 6,845,500 (+) NCBI
RefSeq Acc Id:
XM_063279083 ⟹ XP_063135153
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 6,836,979 - 6,847,197 (+) NCBI
RefSeq Acc Id:
XM_063279084 ⟹ XP_063135154
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 6,836,985 - 6,847,197 (+) NCBI
RefSeq Acc Id:
NP_062104 ⟸ NM_019231
- UniProtKB:
A6JJS2 (UniProtKB/TrEMBL), G3V618 (UniProtKB/TrEMBL), Q32Q45 (UniProtKB/TrEMBL)
- Sequence:
MSLIRKRGFYKQDINKTAWELPKTYLAPAHVGSGAYGAVCSAIDKRTGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMHHENVIGLLDVYTPATSVQNFQDFYLVMPFMQTDLQKIMGMEFSEEKVQ
hide sequence
Ensembl Acc Id:
ENSRNOP00000000621 ⟸ ENSRNOT00000000621
RefSeq Acc Id:
XP_038954553 ⟸ XM_039098625
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_063135153 ⟸ XM_063279083
- Peptide Label:
isoform X1
- UniProtKB:
Q32Q45 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063135154 ⟸ XM_063279084
- Peptide Label:
isoform X3
RGD ID: 13701434 Promoter ID: EPDNEW_R11958 Type: initiation region Name: Mapk13_1 Description: mitogen activated protein kinase 13 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 20 6,018,368 - 6,018,428 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-06-10
Mapk13
mitogen activated protein kinase 13
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_homology
mouse homolog is a developmentally regulated protein kinase, and activated by stress and proinflammatory cytokines
69880
