Symbol:
Ldhb
Name:
lactate dehydrogenase B
RGD ID:
2997
Description:
Enables several functions, including L-lactate dehydrogenase activity; NAD binding activity; and identical protein binding activity. Involved in NAD metabolic process and lactate metabolic process. Predicted to be located in membrane raft and mitochondrial inner membrane. Predicted to be part of oxidoreductase complex. Predicted to be active in cytosol and mitochondrion. Orthologous to human LDHB (lactate dehydrogenase B); PARTICIPATES IN cysteine and methionine metabolic pathway; gluconeogenesis pathway; glycolysis pathway; INTERACTS WITH (R,R,R)-alpha-tocopherol; 17alpha-ethynylestradiol; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
L-lactate dehydrogenase B; L-lactate dehydrogenase B chain; Lactate dehydrogenease B; LDH heart subunit; LDH-B; LDH-H; Ldh2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
LDHB (lactate dehydrogenase B) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Ldhb (lactate dehydrogenase B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ldhb (lactate dehydrogenase B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
LDHB (lactate dehydrogenase B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
LDHB (lactate dehydrogenase B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ldhb (lactate dehydrogenase B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
LDHB (lactate dehydrogenase B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
LDHB (lactate dehydrogenase B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ldhb (lactate dehydrogenase B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
OR5B12 (olfactory receptor family 5 subfamily B member 12) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Ldhb (lactate dehydrogenase B)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
LDHB (lactate dehydrogenase B)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ldhba (lactate dehydrogenase Ba)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ldhbb (lactate dehydrogenase Bb)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
ldh-1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Ldh
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
ldhb
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Related Pseudogenes:
Ldhb-ps1
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 177,159,389 - 177,177,408 (-) NCBI GRCr8 mRatBN7.2 4 175,428,382 - 175,446,403 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 175,428,385 - 175,446,403 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 181,723,217 - 181,741,234 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 177,507,488 - 177,525,505 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 176,128,058 - 176,146,075 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 176,701,980 - 176,719,999 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 176,701,983 - 176,720,012 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 240,918,027 - 240,936,014 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 180,061,567 - 180,079,473 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 180,306,690 - 180,322,406 (-) NCBI Celera 4 163,963,498 - 163,981,517 (-) NCBI Celera Cytogenetic Map 4 q44 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ldhb Rat (R,R,R)-alpha-tocopherol multiple interactions EXP 6480464 [Quercetin co-treated with alpha-Tocopherol] inhibits the reaction [Isoproterenol results in increased expression of LDHB protein] CTD PMID:21322096 Ldhb Rat 1,1-dichloroethene decreases expression ISO Ldhb (Mus musculus) 6480464 vinylidene chloride results in decreased expression of LDHB mRNA CTD PMID:26682919 Ldhb Rat 17alpha-ethynylestradiol decreases expression ISO Ldhb (Mus musculus) 6480464 Ethinyl Estradiol results in decreased expression of LDHB mRNA CTD PMID:17555576 Ldhb Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of LDHB mRNA CTD PMID:17557909 Ldhb Rat 17beta-estradiol decreases expression ISO Ldhb (Mus musculus) 6480464 Estradiol results in decreased expression of LDHB mRNA CTD PMID:19484750 Ldhb Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of LDHB mRNA CTD PMID:32145629 Ldhb Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of LDHB mRNA CTD PMID:26496021 Ldhb Rat 2,2,2-tetramine multiple interactions EXP 6480464 Trientine inhibits the reaction [Streptozocin results in increased expression of LDHB protein] CTD PMID:19634143 and PMID:21136691 Ldhb Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Ldhb (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Ldhb Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Ldhb (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of LDHB mRNA CTD PMID:15667827 Ldhb Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of LDHB mRNA CTD PMID:34747641 Ldhb Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of LDHB mRNA CTD PMID:22298810 Ldhb Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Ldhb (Mus musculus) 6480464 Tetrachlorodibenzodioxin inhibits the reaction [[Dexamethasone co-treated with rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in increased expression of LDHB mRNA] CTD PMID:16054899 Ldhb Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Ldhb Rat 3,3',4,4',5-pentachlorobiphenyl affects expression ISO Ldhb (Mus musculus) 6480464 3 more ... CTD PMID:37080397 Ldhb Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO Ldhb (Mus musculus) 6480464 [Dexamethasone co-treated with rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in increased expression of LDHB mRNA and Tetrachlorodibenzodioxin inhibits the reaction [[Dexamethasone co-treated with rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in increased expression of LDHB mRNA] CTD PMID:16054899 Ldhb Rat 4,4'-sulfonyldiphenol multiple interactions ISO LDHB (Homo sapiens) 6480464 [bisphenol S co-treated with Fulvestrant] results in increased methylation of LDHB gene CTD PMID:31601247 Ldhb Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of LDHB mRNA CTD PMID:36041667 Ldhb Rat 4,4'-sulfonyldiphenol increases expression ISO LDHB (Homo sapiens) 6480464 bisphenol S results in increased expression of LDHB protein CTD PMID:34186270 Ldhb Rat 4-hydroxyphenyl retinamide increases expression ISO Ldhb (Mus musculus) 6480464 Fenretinide results in increased expression of LDHB mRNA CTD PMID:28973697 Ldhb Rat 5-azacytidine increases expression ISO LDHB (Homo sapiens) 6480464 Azacitidine results in increased expression of LDHB mRNA CTD PMID:23437403 Ldhb Rat 5-fluorouracil affects response to substance ISO LDHB (Homo sapiens) 6480464 LDHB protein affects the susceptibility to Fluorouracil CTD PMID:16217747 Ldhb Rat 5-methyl-4-oxido-2-pyrazin-4-iumcarboxylic acid increases expression ISO LDHB (Homo sapiens) 6480464 acipimox results in increased expression of LDHB mRNA CTD PMID:25352640 Ldhb Rat 7H-xanthine multiple interactions EXP 6480464 [Xanthine co-treated with XDH protein] results in decreased expression of LDHB protein CTD PMID:19464573 Ldhb Rat 9H-xanthine multiple interactions EXP 6480464 [Xanthine co-treated with XDH protein] results in decreased expression of LDHB protein CTD PMID:19464573 Ldhb Rat aflatoxin B1 affects expression ISO LDHB (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of LDHB protein CTD PMID:20106945 Ldhb Rat aflatoxin B1 increases expression ISO Ldhb (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of LDHB mRNA CTD PMID:19770486 Ldhb Rat aldehydo-D-glucose affects metabolic processing ISO LDHB (Homo sapiens) 6480464 LDHB protein affects the metabolism of Glucose CTD PMID:23437403 Ldhb Rat all-trans-retinoic acid decreases expression ISO Ldhb (Mus musculus) 6480464 Tretinoin results in decreased expression of LDHB mRNA CTD PMID:16604517 Ldhb Rat all-trans-retinoic acid decreases expression ISO LDHB (Homo sapiens) 6480464 Tretinoin results in decreased expression of LDHB mRNA CTD PMID:33167477 Ldhb Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of LDHB mRNA CTD PMID:16483693 Ldhb Rat aristolochic acid A decreases expression ISO LDHB (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of LDHB mRNA CTD PMID:33212167 Ldhb Rat arsenite(3-) multiple interactions ISO LDHB (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to LDHB protein] and arsenite promotes the reaction [G3BP1 protein binds to LDHB mRNA] CTD PMID:32406909 Ldhb Rat arsenous acid decreases expression ISO LDHB (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of LDHB protein CTD PMID:19364129 Ldhb Rat Azoxymethane multiple interactions ISO Ldhb (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of LDHB mRNA CTD PMID:29950665 Ldhb Rat benzo[a]pyrene increases expression ISO Ldhb (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of LDHB mRNA CTD PMID:19770486 Ldhb Rat benzo[b]fluoranthene decreases expression ISO Ldhb (Mus musculus) 6480464 benzo(b)fluoranthene results in decreased expression of LDHB mRNA CTD PMID:26377693 Ldhb Rat beta-lapachone increases expression ISO LDHB (Homo sapiens) 6480464 beta-lapachone results in increased expression of LDHB mRNA CTD PMID:38218311 Ldhb Rat bexarotene decreases expression EXP 6480464 bexarotene results in decreased expression of LDHB mRNA CTD PMID:16648578 Ldhb Rat bis(2-ethylhexyl) phthalate decreases expression ISO Ldhb (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of LDHB mRNA CTD PMID:34319233 and PMID:35550907 Ldhb Rat bis(2-ethylhexyl) phthalate increases expression ISO Ldhb (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of LDHB mRNA CTD PMID:33754040 Ldhb Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of LDHB mRNA more ... CTD PMID:26496021 more ... Ldhb Rat bisphenol A decreases expression ISO LDHB (Homo sapiens) 6480464 bisphenol A results in decreased expression of LDHB protein CTD PMID:34186270 Ldhb Rat bisphenol A increases expression ISO Ldhb (Mus musculus) 6480464 bisphenol A results in increased expression of LDHB mRNA CTD PMID:35479511 Ldhb Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of LDHB mRNA and bisphenol A results in decreased expression of LDHB protein CTD PMID:30816183 more ... Ldhb Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of LDHB mRNA CTD PMID:25181051 Ldhb Rat bisphenol AF increases expression ISO LDHB (Homo sapiens) 6480464 bisphenol AF results in increased expression of LDHB protein CTD PMID:34186270 Ldhb Rat Bisphenol B increases expression ISO LDHB (Homo sapiens) 6480464 bisphenol B results in increased expression of LDHB protein CTD PMID:34186270 Ldhb Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of LDHB mRNA CTD PMID:36041667 Ldhb Rat bisphenol F increases expression ISO LDHB (Homo sapiens) 6480464 bisphenol F results in increased expression of LDHB protein CTD PMID:34186270 Ldhb Rat Brodifacoum increases expression EXP 6480464 bromfenacoum results in increased expression of LDHB protein CTD PMID:28903499 Ldhb Rat bromobenzene decreases expression EXP 6480464 bromobenzene results in decreased expression of LDHB mRNA CTD PMID:15056800 Ldhb Rat C60 fullerene increases expression EXP 6480464 fullerene C60 results in increased expression of LDHB mRNA CTD PMID:19167457 Ldhb Rat cadmium dichloride increases expression ISO LDHB (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of LDHB protein CTD PMID:24527689 Ldhb Rat carbon nanotube affects expression ISO Ldhb (Mus musculus) 6480464 Nanotubes and Carbon affects the expression of LDHB protein CTD PMID:21135415 Ldhb Rat carbon nanotube decreases expression ISO Ldhb (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Ldhb Rat casticin decreases expression ISO LDHB (Homo sapiens) 6480464 casticin results in decreased expression of LDHB mRNA CTD PMID:27862857 Ldhb Rat chlorite increases activity ISO LDHB (Homo sapiens) 6480464 chlorite results in increased activity of LDHB protein CTD PMID:27478981 Ldhb Rat chloropicrin increases expression ISO LDHB (Homo sapiens) 6480464 chloropicrin results in increased expression of LDHB mRNA CTD PMID:26352163 Ldhb Rat choline multiple interactions ISO Ldhb (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of LDHB mRNA CTD PMID:20938992 Ldhb Rat ciguatoxin CTX1B affects expression ISO Ldhb (Mus musculus) 6480464 Ciguatoxins affects the expression of LDHB mRNA CTD PMID:18353800 Ldhb Rat cis-caffeic acid multiple interactions EXP 6480464 caffeic acid inhibits the reaction [Isoproterenol results in increased expression of LDHB protein] CTD PMID:21472895 Ldhb Rat clozapine increases expression EXP 6480464 Clozapine results in increased expression of LDHB mRNA CTD PMID:15860345 Ldhb Rat cobalt dichloride decreases expression ISO LDHB (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of LDHB protein CTD PMID:16622835 Ldhb Rat cocaine affects expression EXP 6480464 Cocaine affects the expression of LDHB mRNA CTD PMID:20187946 Ldhb Rat copper atom decreases expression EXP 6480464 Copper results in decreased expression of LDHB mRNA CTD PMID:22465980 Ldhb Rat copper atom increases expression EXP 6480464 Copper results in increased expression of LDHB mRNA CTD PMID:30556269 Ldhb Rat copper(0) decreases expression EXP 6480464 Copper results in decreased expression of LDHB mRNA CTD PMID:22465980 Ldhb Rat copper(0) increases expression EXP 6480464 Copper results in increased expression of LDHB mRNA CTD PMID:30556269 Ldhb Rat copper(II) sulfate affects expression ISO LDHB (Homo sapiens) 6480464 Copper Sulfate affects the expression of LDHB mRNA CTD PMID:19549813 Ldhb Rat crocidolite asbestos decreases methylation ISO LDHB (Homo sapiens) 6480464 Asbestos and Crocidolite results in decreased methylation of LDHB gene CTD PMID:29523930 Ldhb Rat cyclophosphamide affects response to substance ISO LDHB (Homo sapiens) 6480464 LDHB protein affects the susceptibility to Cyclophosphamide CTD PMID:16217747 Ldhb Rat cyclosporin A increases expression ISO LDHB (Homo sapiens) 6480464 Cyclosporine results in increased expression of LDHB mRNA CTD PMID:20106945 Ldhb Rat cyclosporin A decreases expression ISO LDHB (Homo sapiens) 6480464 Cyclosporine results in decreased expression of LDHB mRNA CTD PMID:27989131 Ldhb Rat D-glucose affects metabolic processing ISO LDHB (Homo sapiens) 6480464 LDHB protein affects the metabolism of Glucose CTD PMID:23437403 Ldhb Rat DDE increases expression ISO LDHB (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of LDHB mRNA CTD PMID:38568856 Ldhb Rat dexamethasone multiple interactions ISO Ldhb (Mus musculus) 6480464 [Dexamethasone co-treated with Rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in increased expression of LDHB mRNA and Tetrachlorodibenzodioxin inhibits the reaction [[Dexamethasone co-treated with Rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in increased expression of LDHB mRNA] CTD PMID:16054899 Ldhb Rat dexamethasone increases expression ISO LDHB (Homo sapiens) 6480464 Dexamethasone results in increased expression of LDHB mRNA CTD PMID:25047013 Ldhb Rat dexamethasone decreases expression ISO Ldhb (Mus musculus) 6480464 Dexamethasone results in decreased expression of LDHB protein CTD PMID:33567340 Ldhb Rat dextran sulfate multiple interactions ISO Ldhb (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of LDHB mRNA CTD PMID:29950665 Ldhb Rat diarsenic trioxide decreases expression ISO LDHB (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of LDHB protein CTD PMID:19364129 Ldhb Rat dihydroartemisinin affects binding ISO LDHB (Homo sapiens) 6480464 artenimol analog binds to LDHB protein modified form CTD PMID:26340163 Ldhb Rat dihydroxyacetone decreases expression EXP 6480464 Dihydroxyacetone results in decreased expression of LDHB protein CTD PMID:38582340 Ldhb Rat dioxygen affects response to substance ISO LDHB (Homo sapiens) 6480464 LDHB protein affects the susceptibility to Oxygen deficiency CTD PMID:23437403 Ldhb Rat dioxygen multiple interactions ISO Ldhb (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of LDHB mRNA CTD PMID:30529165 Ldhb Rat disodium selenite increases expression ISO LDHB (Homo sapiens) 6480464 Sodium Selenite results in increased expression of LDHB mRNA CTD PMID:18175754 Ldhb Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of LDHB mRNA CTD PMID:21551480 Ldhb Rat doxorubicin increases expression ISO LDHB (Homo sapiens) 6480464 Doxorubicin results in increased expression of LDHB mRNA CTD PMID:29803840 Ldhb Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of LDHB mRNA CTD PMID:29391264 Ldhb Rat enzyme inhibitor multiple interactions ISO LDHB (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of LDHB protein CTD PMID:23301498 Ldhb Rat ethanol affects splicing ISO Ldhb (Mus musculus) 6480464 Ethanol affects the splicing of LDHB mRNA CTD PMID:30319688 Ldhb Rat fenofibrate increases expression ISO LDHB (Homo sapiens) 6480464 Fenofibrate results in increased expression of LDHB mRNA CTD PMID:25572481 Ldhb Rat folic acid multiple interactions ISO Ldhb (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of LDHB mRNA CTD PMID:20938992 Ldhb Rat fructose multiple interactions EXP 6480464 [Fructose co-treated with bisphenol A] results in decreased expression of LDHB protein CTD PMID:26930160 Ldhb Rat fulvestrant multiple interactions ISO LDHB (Homo sapiens) 6480464 [bisphenol S co-treated with Fulvestrant] results in increased methylation of LDHB gene CTD PMID:31601247 Ldhb Rat gallic acid multiple interactions EXP 6480464 Gallic Acid inhibits the reaction [Isoproterenol results in increased secretion of LDHB protein] CTD PMID:19146839 Ldhb Rat gamma-hexachlorocyclohexane decreases expression ISO Ldhb (Mus musculus) 6480464 Hexachlorocyclohexane results in decreased expression of LDHB protein CTD PMID:6164129 Ldhb Rat genistein multiple interactions ISO LDHB (Homo sapiens) 6480464 ESR2 promotes the reaction [Genistein results in decreased expression of LDHB protein] CTD PMID:20884965 Ldhb Rat genistein decreases expression ISO LDHB (Homo sapiens) 6480464 Genistein results in decreased expression of LDHB protein CTD PMID:20884965 Ldhb Rat glucose affects metabolic processing ISO LDHB (Homo sapiens) 6480464 LDHB protein affects the metabolism of Glucose CTD PMID:23437403 Ldhb Rat haloperidol decreases expression ISO Ldhb (Mus musculus) 6480464 Haloperidol results in decreased expression of LDHB mRNA CTD PMID:16465460 Ldhb Rat haloperidol increases expression EXP 6480464 Haloperidol results in increased expression of LDHB mRNA CTD PMID:15860345 Ldhb Rat heparin decreases expression EXP 6480464 Heparin results in decreased expression of LDHB protein CTD PMID:17488504 Ldhb Rat hyaluronic acid multiple interactions EXP 6480464 Hyaluronic Acid analog inhibits the reaction [Hydrogen Peroxide results in decreased expression of LDHB protein] CTD PMID:23178681 Ldhb Rat hydrogen peroxide affects expression ISO LDHB (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of LDHB mRNA CTD PMID:20044591 Ldhb Rat hydrogen peroxide decreases expression EXP 6480464 Hydrogen Peroxide results in decreased expression of LDHB protein CTD PMID:23178681 Ldhb Rat hydrogen peroxide multiple interactions EXP 6480464 Hyaluronic Acid analog inhibits the reaction [Hydrogen Peroxide results in decreased expression of LDHB protein] CTD PMID:23178681 Ldhb Rat ibuprofen affects expression ISO LDHB (Homo sapiens) 6480464 Ibuprofen affects the expression of LDHB protein CTD PMID:18351690 Ldhb Rat indometacin decreases expression EXP 6480464 Indomethacin results in decreased expression of LDHB mRNA CTD PMID:36868495 Ldhb Rat isoprenaline multiple interactions EXP 6480464 [Quercetin co-treated with alpha-Tocopherol] inhibits the reaction [Isoproterenol results in increased expression of LDHB protein] more ... CTD PMID:17188415 more ... Ldhb Rat isoprenaline increases expression EXP 6480464 Isoproterenol results in increased expression of LDHB protein CTD PMID:17188415 more ... Ldhb Rat isoprenaline increases secretion EXP 6480464 Isoproterenol results in increased secretion of LDHB protein CTD PMID:19146839 Ldhb Rat ivermectin decreases expression ISO LDHB (Homo sapiens) 6480464 Ivermectin results in decreased expression of LDHB protein CTD PMID:32959892 Ldhb Rat ketamine decreases expression EXP 6480464 Ketamine results in decreased expression of LDHB protein CTD PMID:18504422 Ldhb Rat L-methionine multiple interactions ISO Ldhb (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of LDHB mRNA CTD PMID:20938992 Ldhb Rat lanthanum trichloride increases expression EXP 6480464 lanthanum chloride results in increased expression of LDHB mRNA and lanthanum chloride results in increased expression of LDHB protein CTD PMID:29264619 Ldhb Rat manganese atom affects expression EXP 6480464 Manganese affects the expression of LDHB protein CTD PMID:24885898 Ldhb Rat manganese(0) affects expression EXP 6480464 Manganese affects the expression of LDHB protein CTD PMID:24885898 Ldhb Rat Monobutylphthalate increases expression ISO Ldhb (Mus musculus) 6480464 monobutyl phthalate results in increased expression of LDHB protein CTD PMID:20553848 Ldhb Rat N-acetyl-L-cysteine multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [Isoproterenol results in increased expression of LDHB protein] CTD PMID:21671307 Ldhb Rat N-butyl-N-(4-hydroxybutyl)nitrosamine decreases expression ISO Ldhb (Mus musculus) 6480464 Butylhydroxybutylnitrosamine results in decreased expression of LDHB protein CTD PMID:24998975 Ldhb Rat N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of LDHB mRNA CTD PMID:19638242 Ldhb Rat N-nitrosodimethylamine increases expression EXP 6480464 Dimethylnitrosamine results in increased expression of LDHB mRNA CTD PMID:25380136 Ldhb Rat naphthalene multiple interactions ISO Ldhb (Mus musculus) 6480464 [naphthalene co-treated with CFTR gene mutant form] results in decreased expression of LDHB protein CTD PMID:19438287 Ldhb Rat naringin multiple interactions EXP 6480464 naringin inhibits the reaction [Isoproterenol results in increased expression of LDHB protein] CTD PMID:17188415 Ldhb Rat ozone decreases expression ISO Ldhb (Mus musculus) 6480464 Ozone results in decreased expression of LDHB mRNA CTD PMID:12763052 Ldhb Rat paracetamol multiple interactions ISO LDHB (Homo sapiens) 6480464 [Dietary Carbohydrates co-treated with Acetaminophen] results in decreased expression of LDHB mRNA CTD PMID:17093179 Ldhb Rat paraquat increases expression ISO Ldhb (Mus musculus) 6480464 Paraquat results in increased expression of LDHB mRNA and Paraquat results in increased expression of LDHB protein CTD PMID:27111068 Ldhb Rat perfluorooctane-1-sulfonic acid increases expression ISO Ldhb (Mus musculus) 6480464 perfluorooctane sulfonic acid results in increased expression of LDHB protein CTD PMID:26178269 Ldhb Rat phenobarbital increases expression ISO Ldhb (Mus musculus) 6480464 Phenobarbital results in increased expression of LDHB mRNA CTD PMID:19482888 Ldhb Rat phenobarbital multiple interactions ISO Ldhb (Mus musculus) 6480464 NR1I3 protein affects the reaction [Phenobarbital results in increased expression of LDHB mRNA] CTD PMID:19482888 Ldhb Rat phenylpropanolamine decreases expression ISO Ldhb (Mus musculus) 6480464 Phenylpropanolamine results in decreased expression of LDHB mRNA CTD PMID:16465460 Ldhb Rat picrotoxin decreases expression EXP 6480464 Picrotoxin results in decreased expression of LDHB mRNA CTD PMID:15170462 Ldhb Rat pirinixic acid multiple interactions ISO Ldhb (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of LDHB mRNA CTD PMID:19710929 Ldhb Rat pirinixic acid increases expression ISO Ldhb (Mus musculus) 6480464 pirinixic acid results in increased expression of LDHB mRNA CTD PMID:23811191 Ldhb Rat progesterone increases expression EXP 6480464 Progesterone results in increased expression of LDHB mRNA CTD PMID:20726854 Ldhb Rat quercetin multiple interactions EXP 6480464 [Quercetin co-treated with alpha-Tocopherol] inhibits the reaction [Isoproterenol results in increased expression of LDHB protein] CTD PMID:21322096 Ldhb Rat resveratrol decreases expression ISO Ldhb (Mus musculus) 6480464 resveratrol results in decreased expression of LDHB protein CTD PMID:25505154 Ldhb Rat resveratrol multiple interactions ISO LDHB (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of LDHB mRNA CTD PMID:23557933 Ldhb Rat resveratrol affects secretion ISO LDHB (Homo sapiens) 6480464 resveratrol affects the secretion of LDHB protein CTD PMID:24802182 Ldhb Rat rotenone decreases expression ISO LDHB (Homo sapiens) 6480464 Rotenone results in decreased expression of LDHB mRNA CTD PMID:29955902 Ldhb Rat serpentine asbestos increases methylation ISO LDHB (Homo sapiens) 6480464 Asbestos and Serpentine results in increased methylation of LDHB gene CTD PMID:29523930 Ldhb Rat silicon dioxide affects secretion ISO LDHB (Homo sapiens) 6480464 Silicon Dioxide analog affects the secretion of LDHB protein CTD PMID:25895662 Ldhb Rat sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of LDHB mRNA CTD PMID:21297353 Ldhb Rat sodium arsenite decreases expression ISO LDHB (Homo sapiens) 6480464 sodium arsenite results in decreased expression of LDHB mRNA CTD PMID:38568856 Ldhb Rat sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of LDHB protein CTD PMID:29459688 Ldhb Rat sodium arsenite increases expression ISO LDHB (Homo sapiens) 6480464 sodium arsenite results in increased expression of LDHB mRNA CTD PMID:29301061 Ldhb Rat sodium fluoride increases expression ISO Ldhb (Mus musculus) 6480464 Sodium Fluoride results in increased expression of LDHB protein CTD PMID:27548804 and PMID:28918527 Ldhb Rat sodium nitrite increases activity ISO LDHB (Homo sapiens) 6480464 Sodium Nitrite results in increased activity of LDHB protein CTD PMID:26231821 Ldhb Rat Soman decreases expression EXP 6480464 Soman results in decreased expression of LDHB mRNA CTD PMID:19281266 Ldhb Rat streptozocin increases expression EXP 6480464 Streptozocin results in increased expression of LDHB protein CTD PMID:19634143 and PMID:21136691 Ldhb Rat streptozocin multiple interactions EXP 6480464 Trientine inhibits the reaction [Streptozocin results in increased expression of LDHB protein] CTD PMID:19634143 and PMID:21136691 Ldhb Rat tamoxifen affects expression ISO Ldhb (Mus musculus) 6480464 Tamoxifen affects the expression of LDHB mRNA CTD PMID:17555576 Ldhb Rat tanespimycin increases expression ISO LDHB (Homo sapiens) 6480464 tanespimycin analog results in increased expression of LDHB protein CTD PMID:31370342 Ldhb Rat Tesaglitazar increases expression EXP 6480464 tesaglitazar results in increased expression of LDHB mRNA CTD PMID:21515302 Ldhb Rat tetrachloromethane affects expression ISO Ldhb (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of LDHB mRNA CTD PMID:17484886 Ldhb Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of LDHB mRNA CTD PMID:23411599 and PMID:34492290 Ldhb Rat thiram decreases expression ISO LDHB (Homo sapiens) 6480464 Thiram results in decreased expression of LDHB mRNA CTD PMID:38568856 Ldhb Rat titanium dioxide multiple interactions ISO Ldhb (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of LDHB mRNA CTD PMID:29950665 Ldhb Rat toxaphene increases expression EXP 6480464 Toxaphene results in increased expression of LDHB protein CTD PMID:1269500 Ldhb Rat trans-caffeic acid multiple interactions EXP 6480464 caffeic acid inhibits the reaction [Isoproterenol results in increased expression of LDHB protein] CTD PMID:21472895 Ldhb Rat triphenylstannane decreases expression ISO LDHB (Homo sapiens) 6480464 triphenyltin analog results in decreased expression of LDHB protein CTD PMID:31634547 Ldhb Rat troglitazone increases expression EXP 6480464 troglitazone results in increased expression of LDHB mRNA CTD PMID:21515302 Ldhb Rat troglitazone increases expression ISO LDHB (Homo sapiens) 6480464 troglitazone results in increased expression of LDHB mRNA CTD PMID:25572481 Ldhb Rat valproic acid increases expression ISO LDHB (Homo sapiens) 6480464 Valproic Acid results in increased expression of LDHB mRNA CTD PMID:29154799 Ldhb Rat vorinostat decreases expression ISO LDHB (Homo sapiens) 6480464 vorinostat results in decreased expression of LDHB protein CTD PMID:20543569
Imported Annotations - KEGG (archival)
(R,R,R)-alpha-tocopherol (EXP) 1,1-dichloroethene (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP,ISO) 2,2,2-tetramine (EXP) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 4-hydroxyphenyl retinamide (ISO) 5-azacytidine (ISO) 5-fluorouracil (ISO) 5-methyl-4-oxido-2-pyrazin-4-iumcarboxylic acid (ISO) 7H-xanthine (EXP) 9H-xanthine (EXP) aflatoxin B1 (ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) aristolochic acid A (ISO) arsenite(3-) (ISO) arsenous acid (ISO) Azoxymethane (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) beta-lapachone (ISO) bexarotene (EXP) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (EXP,ISO) Brodifacoum (EXP) bromobenzene (EXP) C60 fullerene (EXP) cadmium dichloride (ISO) carbon nanotube (ISO) casticin (ISO) chlorite (ISO) chloropicrin (ISO) choline (ISO) ciguatoxin CTX1B (ISO) cis-caffeic acid (EXP) clozapine (EXP) cobalt dichloride (ISO) cocaine (EXP) copper atom (EXP) copper(0) (EXP) copper(II) sulfate (ISO) crocidolite asbestos (ISO) cyclophosphamide (ISO) cyclosporin A (ISO) D-glucose (ISO) DDE (ISO) dexamethasone (ISO) dextran sulfate (ISO) diarsenic trioxide (ISO) dihydroartemisinin (ISO) dihydroxyacetone (EXP) dioxygen (ISO) disodium selenite (ISO) diuron (EXP) doxorubicin (ISO) endosulfan (EXP) enzyme inhibitor (ISO) ethanol (ISO) fenofibrate (ISO) folic acid (ISO) fructose (EXP) fulvestrant (ISO) gallic acid (EXP) gamma-hexachlorocyclohexane (ISO) genistein (ISO) glucose (ISO) haloperidol (EXP,ISO) heparin (EXP) hyaluronic acid (EXP) hydrogen peroxide (EXP,ISO) ibuprofen (ISO) indometacin (EXP) isoprenaline (EXP) ivermectin (ISO) ketamine (EXP) L-methionine (ISO) lanthanum trichloride (EXP) manganese atom (EXP) manganese(0) (EXP) Monobutylphthalate (ISO) N-acetyl-L-cysteine (EXP) N-butyl-N-(4-hydroxybutyl)nitrosamine (ISO) N-nitrosodiethylamine (EXP) N-nitrosodimethylamine (EXP) naphthalene (ISO) naringin (EXP) ozone (ISO) paracetamol (ISO) paraquat (ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) phenylpropanolamine (ISO) picrotoxin (EXP) pirinixic acid (ISO) progesterone (EXP) quercetin (EXP) resveratrol (ISO) rotenone (ISO) serpentine asbestos (ISO) silicon dioxide (ISO) sodium arsenite (EXP,ISO) sodium fluoride (ISO) sodium nitrite (ISO) Soman (EXP) streptozocin (EXP) tamoxifen (ISO) tanespimycin (ISO) Tesaglitazar (EXP) tetrachloromethane (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) toxaphene (EXP) trans-caffeic acid (EXP) triphenylstannane (ISO) troglitazone (EXP,ISO) valproic acid (ISO) vorinostat (ISO)
1.
Purification and radioimmunoassay of rat lactate dehydrogenase A and B subunits.
Beebee TJ and Carty DS, Biochem J. 1982 Aug 1;205(2):313-20.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
4.
M-LDH serves as a regulatory subunit of the cytosolic substrate-channelling complex in vivo.
Jovanovic S, etal., J Mol Biol. 2007 Aug 10;371(2):349-61. Epub 2007 Jun 2.
5.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
6.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
8.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
9.
GOA pipeline
RGD automated data pipeline
10.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
11.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
12.
Low cytosine triphosphate synthase 2 expression renders resistance to 5-fluorouracil in colorectal cancer.
Tan WL, etal., Cancer Biol Ther. 2011 Mar 15;11(6):599-608. Epub 2011 Mar 15.
13.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
14.
Evolutionary relationships of lactate dehydrogenases (LDHs) from mammals, birds, an amphibian, fish, barley, and bacteria: LDH cDNA sequences from Xenopus, pig, and rat.
Tsuji S, etal., Proc Natl Acad Sci U S A 1994 Sep 27;91(20):9392-6.
15.
Effect of Anabolic Steroid Nandrolone Decanoate on the Properties of Certain Enzymes in the Heart, Liver, and Muscle of Rats, and their Effect on Rats' Cardiac Electrophysiology.
Tylicki A, etal., Horm Metab Res. 2007 Apr;39(4):268-72.
Ldhb Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 177,159,389 - 177,177,408 (-) NCBI GRCr8 mRatBN7.2 4 175,428,382 - 175,446,403 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 175,428,385 - 175,446,403 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 181,723,217 - 181,741,234 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 177,507,488 - 177,525,505 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 176,128,058 - 176,146,075 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 176,701,980 - 176,719,999 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 176,701,983 - 176,720,012 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 240,918,027 - 240,936,014 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 180,061,567 - 180,079,473 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 180,306,690 - 180,322,406 (-) NCBI Celera 4 163,963,498 - 163,981,517 (-) NCBI Celera Cytogenetic Map 4 q44 NCBI
LDHB Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 21,635,342 - 21,657,842 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 21,635,342 - 21,757,857 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 21,788,276 - 21,810,776 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 21,679,543 - 21,702,043 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 21,679,544 - 21,702,042 NCBI Celera 12 26,943,264 - 26,965,789 (-) NCBI Celera Cytogenetic Map 12 p12.1 NCBI HuRef 12 21,561,869 - 21,584,405 (-) NCBI HuRef CHM1_1 12 21,753,523 - 21,776,056 (-) NCBI CHM1_1 T2T-CHM13v2.0 12 21,513,920 - 21,536,444 (-) NCBI T2T-CHM13v2.0
Ldhb Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 142,435,975 - 142,453,683 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 142,435,975 - 142,453,683 (-) Ensembl GRCm39 Ensembl GRCm38 6 142,490,249 - 142,507,957 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 142,490,249 - 142,507,957 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 142,438,769 - 142,456,463 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 142,447,471 - 142,465,165 (-) NCBI MGSCv36 mm8 Celera 6 145,551,908 - 145,569,602 (-) NCBI Celera Cytogenetic Map 6 G2 NCBI cM Map 6 74.17 NCBI
Ldhb Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955413 17,261,118 - 17,283,593 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955413 17,264,337 - 17,283,530 (-) NCBI ChiLan1.0 ChiLan1.0
LDHB Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 75,145,106 - 75,167,533 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 75,141,504 - 75,163,931 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 64,640,994 - 64,663,418 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 67,245,012 - 67,267,487 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 67,245,130 - 67,267,487 (+) Ensembl panpan1.1 panPan2
LDHB Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 27 25,470,666 - 25,493,114 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 27 25,470,665 - 25,492,920 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 27 20,864,321 - 20,886,793 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 27 25,693,648 - 25,716,172 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 27 25,693,609 - 25,716,160 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 27 25,492,290 - 25,514,750 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 27 25,515,724 - 25,538,195 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 27 21,035,083 - 21,057,566 (-) NCBI UU_Cfam_GSD_1.0
Ldhb Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 87,301,989 - 87,321,822 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936548 5,227,666 - 5,244,525 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936548 5,224,905 - 5,244,708 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
LDHB
LDHB Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 11 21,489,815 - 21,511,892 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 11 21,488,814 - 21,511,938 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666069 13,631,514 - 13,654,346 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ldhb
.
Predicted Target Of
Count of predictions: 106 Count of miRNA genes: 91 Interacting mature miRNAs: 99 Transcripts: ENSRNOT00000017965 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
6478754 Anxrr43 Anxiety related response QTL 43 0.14035 locomotor behavior trait (VT:0001392) distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493) 4 144639524 182687754 Rat 1576316 Ept5 Estrogen-induced pituitary tumorigenesis QTL 5 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 4 83428419 177635233 Rat 2303623 Vencon2 Ventilatory control QTL 2 3.8 respiration trait (VT:0001943) minute ventilation (CMO:0000132) 4 135204660 180204660 Rat 724558 Plsm2 Polydactyly-luxate syndrome (PLS) morphotypes QTL 2 0.0003 hindlimb integrity trait (VT:0010563) hind foot phalanges count (CMO:0001949) 4 132422778 177422778 Rat 6478693 Anxrr32 Anxiety related response QTL 32 0.00092 locomotor behavior trait (VT:0001392) measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957) 4 144639524 182687754 Rat 1578674 Bmd12 Bone mineral density QTL 12 3.8 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 4 135699135 180699135 Rat 1331738 Bp209 Blood pressure QTL 209 2.979 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 138503169 179293946 Rat 6478700 Anxrr33 Anxiety related response QTL 33 0.00896 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 144639524 182687754 Rat 10053718 Scort25 Serum corticosterone level QTL 25 2.15 0.0097 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 155561574 182687754 Rat 1549827 Scl46 Serum cholesterol level QTL 46 3.5 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 4 132396220 177396220 Rat 2293659 Bmd35 Bone mineral density QTL 35 4.5 0.0001 femur strength trait (VT:0010010) femoral neck ultimate force (CMO:0001703) 4 137755016 181392681 Rat 10401796 Kidm48 Kidney mass QTL 48 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 4 145568712 182687754 Rat 6478718 Anxrr34 Anxiety related response QTL 34 0.00896 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 144639524 182687754 Rat 2316958 Gluco58 Glucose level QTL 58 10 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 11320076 180699135 Rat 6478748 Anxrr42 Anxiety related response QTL 42 0.28008 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 144639524 182687754 Rat 1300109 Rf13 Renal function QTL 13 3.91 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 4 157710145 182687754 Rat
AI790582
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 175,430,710 - 175,430,819 (+) MAPPER mRatBN7.2 Rnor_6.0 4 176,704,309 - 176,704,417 NCBI Rnor6.0 Rnor_5.0 4 240,920,356 - 240,920,464 UniSTS Rnor5.0 RGSC_v3.4 4 180,063,891 - 180,063,999 UniSTS RGSC3.4 Celera 4 163,965,827 - 163,965,935 UniSTS Cytogenetic Map 4 q44 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000017965 ⟹ ENSRNOP00000017965
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 175,428,385 - 175,446,403 (-) Ensembl Rnor_6.0 Ensembl 4 176,701,983 - 176,720,012 (-) Ensembl
RefSeq Acc Id:
NM_001316333 ⟹ NP_001303262
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 177,159,389 - 177,177,408 (-) NCBI mRatBN7.2 4 175,428,382 - 175,446,403 (-) NCBI Rnor_6.0 4 176,701,980 - 176,719,999 (-) NCBI Celera 4 163,963,498 - 163,981,517 (-) NCBI
Sequence:
CAGGGCGGCAGCCCCGCCTCCTCCTCCTCCTCTTCTTGTAGAGCCAGAGTCGGCTGTCCGCAGAGCAGCCTGCTGACTTTGCAGTGGTTCCCCTGCCTCAGCGCGCCGCAGAGCCTCCTCTTGTCTGG
hide sequence
RefSeq Acc Id:
NM_001316334 ⟹ NP_001303263
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 177,159,389 - 177,177,408 (-) NCBI mRatBN7.2 4 175,428,382 - 175,446,403 (-) NCBI Rnor_6.0 4 176,701,980 - 176,719,999 (-) NCBI Celera 4 163,963,498 - 163,981,517 (-) NCBI
Sequence:
CAGGGCGGCAGCCCCGCCTCCTCCTCCTCCTCTTCTTGTAGAGCCAGAGTCGGCTGTCCGCAGAGCAGCCTGCTGACTTTGCAGTGGTTCCCCTGCCTCAGCGCGCCGCAGAGCCTCCTCTTGTCTGG
hide sequence
RefSeq Acc Id:
NM_012595 ⟹ NP_036727
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 177,159,389 - 177,177,408 (-) NCBI mRatBN7.2 4 175,428,382 - 175,446,403 (-) NCBI Rnor_6.0 4 176,701,980 - 176,719,999 (-) NCBI Rnor_5.0 4 240,918,027 - 240,936,014 (-) NCBI RGSC_v3.4 4 180,061,567 - 180,079,473 (-) RGD Celera 4 163,963,498 - 163,981,517 (-) NCBI
Sequence:
CAGGGCGGCAGCCCCGCCTCCTCCTCCTCCTCTTCTTGTAGAGCCAGAGTCGGCTGTCCGCAGA
hide sequence
RefSeq Acc Id:
NP_036727 ⟸ NM_012595
- Peptide Label:
isoform Ldhb
- UniProtKB:
P42123 (UniProtKB/Swiss-Prot), A6IMU4 (UniProtKB/TrEMBL)
- Sequence:
MATLKEKLIAPVADDETAVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKY
hide sequence
RefSeq Acc Id:
NP_001303262 ⟸ NM_001316333
- Peptide Label:
isoform Ldhbx
- UniProtKB:
P42123 (UniProtKB/Swiss-Prot)
- Sequence:
MATLKEKLIAPVADDETAVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKY
hide sequence
RefSeq Acc Id:
NP_001303263 ⟸ NM_001316334
- Peptide Label:
isoform Ldhb
- UniProtKB:
P42123 (UniProtKB/Swiss-Prot), A6IMU4 (UniProtKB/TrEMBL)
- Sequence:
MATLKEKLIAPVADDETAVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKY
hide sequence
Ensembl Acc Id:
ENSRNOP00000017965 ⟸ ENSRNOT00000017965
RGD ID: 13693490 Promoter ID: EPDNEW_R4014 Type: initiation region Name: Ldhb_1 Description: lactate dehydrogenase B SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 4 176,719,962 - 176,720,022 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-11-06
Ldhb
lactate dehydrogenase B
Lactate dehydrogenease B
Name updated
625702 APPROVED
2002-06-10
Ldhb
Lactate dehydrogenease B
Symbol and Name status set to approved
70586 APPROVED
