Symbol:
Kras
Name:
KRAS proto-oncogene, GTPase
RGD ID:
2981
Description:
Enables GDP binding activity; GMP binding activity; and LRR domain binding activity. Involved in several processes, including cardiac muscle cell proliferation; positive regulation of NF-kappaB transcription factor activity; and response to corticosteroid. Predicted to be located in cytoplasm and cytoplasmic side of plasma membrane. Predicted to be active in plasma membrane. Used to study bronchiolo-alveolar adenocarcinoma; endometrial adenocarcinoma; hepatocellular adenoma; hepatocellular carcinoma; and renal fibrosis. Biomarker of muscular atrophy. Human ortholog(s) of this gene implicated in several diseases, including Noonan syndrome (multiple); cardiofaciocutaneous syndrome (multiple); gastrointestinal system cancer (multiple); hematologic cancer (multiple); and lung cancer (multiple). Orthologous to human KRAS (KRAS proto-oncogene, GTPase); PARTICIPATES IN the extracellular signal-regulated Raf/Mek/Erk signaling pathway; altered extracellular signal-regulated Raf/Mek/Erk signaling pathway; endometrial cancer pathway; INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
c-K-ras; c-K-ras2 protein; c-Ki-ras; c-Kirsten-ras proto-oncogene; GTPase KRas; K-ras; K-Ras 2; ki-Ras; Kirsten rat sarcoma viral oncogene; Kirsten rat sarcoma viral oncogene homolog; Kirsten rat sarcoma viral oncogene homologue 2 (active); Kras2; p21; v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
KRAS (KRAS proto-oncogene, GTPase) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Kras (Kirsten rat sarcoma viral oncogene homolog) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Kras (KRAS proto-oncogene, GTPase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
KRAS (KRAS proto-oncogene, GTPase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
KRAS (KRAS proto-oncogene, GTPase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Kras (KRAS proto-oncogene, GTPase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
KRAS (KRAS proto-oncogene, GTPase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
KRAS (KRAS proto-oncogene, GTPase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Kras (KRAS proto-oncogene, GTPase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
KRAS (KRAS proto-oncogene, GTPase)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Kras (Kirsten rat sarcoma viral oncogene homolog)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
kras (v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Ras85D
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
let-60
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
krasl
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 179,916,255 - 179,949,613 (-) NCBI GRCr8 mRatBN7.2 4 178,185,418 - 178,218,484 (-) NCBI mRatBN7.2 mRatBN7.2 UTH_Rnor_SHR_Utx 4 184,490,327 - 184,516,219 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 180,274,827 - 180,300,720 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 178,895,248 - 178,921,140 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 179,482,562 - 179,515,483 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 179,486,105 - 179,515,558 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 243,667,912 - 243,696,325 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 182,869,242 - 182,895,106 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 183,114,365 - 183,140,230 (-) NCBI Celera 4 166,708,846 - 166,734,692 (-) NCBI Celera Cytogenetic Map 4 q44 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Kras Rat (S)-colchicine multiple interactions ISO Kras (Mus musculus) 6480464 Colchicine inhibits the reaction [Carbon Tetrachloride results in increased expression of KRAS protein] CTD PMID:38348705 Kras Rat (S)-naringenin multiple interactions ISO KRAS (Homo sapiens) 6480464 [naringenin metabolite co-treated with bisphenol A] results in increased expression of KRAS mRNA CTD PMID:36235125 Kras Rat (trichloromethyl)benzene increases mutagenesis ISO Kras (Mus musculus) 6480464 benzotrichloride results in increased mutagenesis of KRAS gene CTD PMID:8508514 Kras Rat 1,1-dichloroethene increases expression ISO Kras (Mus musculus) 6480464 vinylidene chloride results in increased expression of KRAS mRNA CTD PMID:26682919 Kras Rat 1,2-dimethylhydrazine affects expression ISO Kras (Mus musculus) 6480464 1 and 2-Dimethylhydrazine affects the expression of KRAS mRNA CTD PMID:22206623 Kras Rat 1,2-dimethylhydrazine multiple interactions ISO Kras (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of KRAS mRNA CTD PMID:22206623 Kras Rat 1-nitropyrene increases mutagenesis ISO Kras (Mus musculus) 6480464 1-nitropyrene results in increased mutagenesis of KRAS gene CTD PMID:10396879 more ... Kras Rat 1-nitropyrene multiple interactions ISO Kras (Mus musculus) 6480464 [1-nitropyrene co-treated with KC 400] results in increased mutagenesis of KRAS gene more ... CTD PMID:10396879 more ... Kras Rat 17alpha-ethynylestradiol multiple interactions ISO Kras (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of KRAS mRNA CTD PMID:17942748 Kras Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of KRAS mRNA CTD PMID:29097150 Kras Rat 17beta-estradiol decreases expression ISO KRAS (Homo sapiens) 6480464 Estradiol results in decreased expression of KRAS mRNA CTD PMID:16474171 Kras Rat 17beta-estradiol increases expression ISO Kras (Mus musculus) 6480464 Estradiol results in increased expression of KRAS mRNA CTD PMID:39298647 Kras Rat 17beta-estradiol increases expression ISO KRAS (Homo sapiens) 6480464 Estradiol results in increased expression of KRAS mRNA CTD PMID:23094148 Kras Rat 2,2-Bis(bromomethyl)propane-1,3-diol increases mutagenesis ISO Kras (Mus musculus) 6480464 2 more ... CTD PMID:14713543 Kras Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO KRAS (Homo sapiens) 6480464 Cycloheximide inhibits the reaction [Tetrachlorodibenzodioxin results in increased expression of KRAS mRNA] CTD PMID:11007951 Kras Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of KRAS mRNA CTD PMID:33387578 Kras Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of KRAS mRNA CTD PMID:32109520 Kras Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Kras (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of KRAS mRNA CTD PMID:21570461 Kras Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO KRAS (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of KRAS mRNA CTD PMID:11007951 more ... Kras Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO KRAS (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of KRAS mRNA CTD PMID:22298810 Kras Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Kras (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of KRAS mRNA CTD PMID:14708085 Kras Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Kras (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of KRAS mRNA CTD PMID:19465110 Kras Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Kras (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of KRAS mRNA more ... CTD PMID:11884234 more ... Kras Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of KRAS mRNA CTD PMID:21346803 Kras Rat 2,6-di-tert-butyl-4-methylphenol increases mutagenesis ISO Kras (Mus musculus) 6480464 Butylated Hydroxytoluene results in increased mutagenesis of KRAS gene CTD PMID:20101149 Kras Rat 2,6-dimethoxyphenol multiple interactions ISO KRAS (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1 and 3-dimethyl ether] results in increased expression of and affects the localization of KRAS protein CTD PMID:38598786 Kras Rat 2-trans,6-trans-farnesyl diphosphate multiple interactions EXP 6480464 [FNTA protein binds to FNTB protein] binds to [farnesyl pyrophosphate analog co-treated with KRAS protein] CTD PMID:10673434 Kras Rat 3-methyl-3H-imidazo[4,5-f]quinolin-2-amine increases mutagenesis EXP 6480464 2-amino-3-methylimidazo(4 and 5-f)quinoline results in increased mutagenesis of KRAS gene CTD PMID:8844820 Kras Rat 3-methylcholanthrene multiple interactions ISO Kras (Mus musculus) 6480464 Methylcholanthrene promotes the reaction [GATA6 protein binds to KRAS exon] and Methylcholanthrene promotes the reaction [NFYA protein binds to KRAS exon] CTD PMID:16271038 Kras Rat 3-methylcholanthrene increases mutagenesis ISO Kras (Mus musculus) 6480464 Methylcholanthrene results in increased mutagenesis of KRAS gene CTD PMID:11195466 and PMID:20101149 Kras Rat 4,4'-sulfonyldiphenol increases expression ISO Kras (Mus musculus) 6480464 bisphenol S results in increased expression of KRAS mRNA CTD PMID:39298647 Kras Rat 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one increases mutagenesis EXP 6480464 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone results in increased mutagenesis of KRAS gene CTD PMID:18271921 Kras Rat 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one multiple interactions ISO Kras (Mus musculus) 6480464 [Lipopolysaccharides co-treated with 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone] results in increased mutagenesis of KRAS gene CTD PMID:21868532 Kras Rat 4-nitrophenol decreases expression ISO Kras (Mus musculus) 6480464 4-nitrophenol results in decreased expression of KRAS mRNA CTD PMID:34673133 Kras Rat 4-vinylcyclohexene dioxide affects expression ISO Kras (Mus musculus) 6480464 4-vinyl-1-cyclohexene dioxide affects the expression of KRAS mRNA CTD PMID:20829426 Kras Rat 5-aza-2'-deoxycytidine multiple interactions ISO KRAS (Homo sapiens) 6480464 Decitabine inhibits the reaction [arsenite results in increased expression of KRAS protein] CTD PMID:24704393 Kras Rat 5-fluorouracil decreases expression ISO KRAS (Homo sapiens) 6480464 Fluorouracil results in decreased expression of KRAS protein CTD PMID:15585135 and PMID:16803524 Kras Rat 5-fluorouracil increases expression ISO KRAS (Homo sapiens) 6480464 Fluorouracil results in increased expression of KRAS mRNA mutant form CTD PMID:38423379 Kras Rat 5-Methylchrysene increases mutagenesis ISO Kras (Mus musculus) 6480464 5-methylchrysene results in increased mutagenesis of KRAS gene CTD PMID:8571376 and PMID:9659573 Kras Rat acrolein decreases expression ISO KRAS (Homo sapiens) 6480464 Acrolein results in decreased expression of KRAS protein CTD PMID:24812010 Kras Rat actinomycin D multiple interactions ISO KRAS (Homo sapiens) 6480464 Dactinomycin inhibits the reaction [[KRAS protein mutant form affects the susceptibility to vemurafenib] which results in increased expression of TNFRSF10B mRNA] CTD PMID:27222248 Kras Rat afimoxifene affects response to substance ISO KRAS (Homo sapiens) 6480464 KRAS gene affects the susceptibility to afimoxifene CTD PMID:21482774 Kras Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of KRAS mRNA CTD PMID:16483693 Kras Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of KRAS mRNA CTD PMID:30779732 Kras Rat antirheumatic drug decreases expression ISO KRAS (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of KRAS mRNA CTD PMID:24449571 Kras Rat Antrocin decreases expression ISO KRAS (Homo sapiens) 6480464 antrocin analog results in decreased expression of KRAS protein CTD PMID:36565974 Kras Rat aristolochic acid A increases mutagenesis EXP 6480464 aristolochic acid I results in increased mutagenesis of KRAS gene CTD PMID:21642617 Kras Rat aristolochic acid A decreases expression ISO KRAS (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of KRAS mRNA CTD PMID:33212167 Kras Rat Aroclor 1254 decreases expression ISO Kras (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of KRAS mRNA and Chlorodiphenyl (54% Chlorine) results in decreased expression of KRAS protein CTD PMID:23650126 Kras Rat Aroclor 1254 affects localization ISO Kras (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) affects the localization of KRAS protein CTD PMID:9525281 Kras Rat ARS-1620 affects binding ISO KRAS (Homo sapiens) 6480464 ARS-1620 binds to KRAS protein mutant form CTD PMID:31666701 Kras Rat arsane multiple interactions ISO KRAS (Homo sapiens) 6480464 KRAS affects the reaction [Arsenic results in increased phosphorylation of MAPK1 protein] more ... CTD PMID:25273566 Kras Rat arsane increases mutagenesis ISO KRAS (Homo sapiens) 6480464 Arsenic results in increased mutagenesis of KRAS gene CTD PMID:32344290 Kras Rat arsane affects response to substance ISO KRAS (Homo sapiens) 6480464 KRAS affects the susceptibility to Arsenic CTD PMID:25273566 Kras Rat arsenic atom multiple interactions ISO KRAS (Homo sapiens) 6480464 KRAS affects the reaction [Arsenic results in increased phosphorylation of MAPK1 protein] more ... CTD PMID:25273566 Kras Rat arsenic atom increases mutagenesis ISO KRAS (Homo sapiens) 6480464 Arsenic results in increased mutagenesis of KRAS gene CTD PMID:32344290 Kras Rat arsenic atom affects response to substance ISO KRAS (Homo sapiens) 6480464 KRAS affects the susceptibility to Arsenic CTD PMID:25273566 Kras Rat arsenite(3-) multiple interactions ISO KRAS (Homo sapiens) 6480464 decitabine inhibits the reaction [arsenite results in increased expression of KRAS protein] and MIRLET7C mRNA inhibits the reaction [arsenite results in increased expression of KRAS protein] CTD PMID:24704393 Kras Rat arsenite(3-) increases mutagenesis ISO KRAS (Homo sapiens) 6480464 arsenite results in increased mutagenesis of KRAS gene mutant form CTD PMID:31009485 Kras Rat arsenite(3-) increases expression ISO KRAS (Homo sapiens) 6480464 arsenite results in increased expression of KRAS protein CTD PMID:24704393 Kras Rat asbestos increases mutagenesis ISO KRAS (Homo sapiens) 6480464 Asbestos results in increased mutagenesis of KRAS gene CTD PMID:12725029 Kras Rat Azoxymethane increases mutagenesis EXP 6480464 Azoxymethane results in increased mutagenesis of KRAS gene CTD PMID:12839936 and PMID:21370285 Kras Rat Azoxymethane multiple interactions ISO Kras (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of KRAS mRNA CTD PMID:29950665 Kras Rat Azoxymethane multiple interactions EXP 6480464 Ursodeoxycholic Acid inhibits the reaction [Azoxymethane results in increased mutagenesis of KRAS gene] CTD PMID:12839936 Kras Rat Benz[j]aceanthrylene increases mutagenesis ISO Kras (Mus musculus) 6480464 benz(j)aceanthrylene results in increased mutagenesis of KRAS gene CTD PMID:9659573 Kras Rat benzene increases response to substance ISO Kras (Mus musculus) 6480464 KRAS gene polymorphism results in increased susceptibility to Benzene CTD PMID:12807761 Kras Rat benzo[a]pyrene increases expression ISO Kras (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of KRAS mRNA CTD PMID:22228805 Kras Rat benzo[a]pyrene affects methylation ISO KRAS (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of KRAS promoter CTD PMID:27901495 Kras Rat benzo[a]pyrene increases mutagenesis ISO Kras (Mus musculus) 6480464 Benzo(a)pyrene results in increased mutagenesis of KRAS gene CTD PMID:19658153 more ... Kras Rat benzo[a]pyrene diol epoxide I increases expression ISO KRAS (Homo sapiens) 6480464 7 more ... CTD PMID:18567617 Kras Rat benzo[a]pyrene diol epoxide I decreases expression ISO KRAS (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 and PMID:20018196 Kras Rat benzo[b]fluoranthene increases mutagenesis ISO Kras (Mus musculus) 6480464 benzo(b)fluoranthene results in increased mutagenesis of KRAS gene CTD PMID:8571376 and PMID:9659573 Kras Rat bisphenol A decreases expression ISO KRAS (Homo sapiens) 6480464 bisphenol A results in decreased expression of KRAS mRNA CTD PMID:16474171 Kras Rat bisphenol A increases expression ISO KRAS (Homo sapiens) 6480464 bisphenol A results in increased expression of KRAS mRNA CTD PMID:36982678 Kras Rat bisphenol A multiple interactions ISO KRAS (Homo sapiens) 6480464 [bisphenol A co-treated with Quercetin metabolite] results in increased expression of KRAS mRNA more ... CTD PMID:36235125 and PMID:36982678 Kras Rat bisphenol A decreases expression ISO Kras (Mus musculus) 6480464 bisphenol A results in decreased expression of KRAS mRNA CTD PMID:33221593 Kras Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of KRAS gene CTD PMID:28505145 Kras Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of KRAS mRNA CTD PMID:29097150 Kras Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of KRAS mRNA CTD PMID:25181051 Kras Rat bisphenol A increases expression ISO Kras (Mus musculus) 6480464 bisphenol A results in increased expression of KRAS mRNA CTD PMID:26063408 Kras Rat bisphenol A increases mutagenesis ISO KRAS (Homo sapiens) 6480464 bisphenol A results in increased mutagenesis of KRAS gene CTD PMID:11342245 Kras Rat bleomycin A2 multiple interactions ISO Kras (Mus musculus) 6480464 [Bleomycin co-treated with 1-nitropyrene] results in increased mutagenesis of KRAS gene CTD PMID:12616606 Kras Rat buta-1,3-diene increases mutagenesis ISO Kras (Mus musculus) 6480464 1 and 3-butadiene results in increased mutagenesis of KRAS gene CTD PMID:11397402 Kras Rat cadmium atom increases expression ISO KRAS (Homo sapiens) 6480464 Cadmium results in increased expression of KRAS mRNA and Cadmium results in increased expression of KRAS protein CTD PMID:20049202 Kras Rat cadmium atom decreases expression ISO KRAS (Homo sapiens) 6480464 Cadmium results in decreased expression of KRAS mRNA CTD PMID:21120746 Kras Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of KRAS mRNA CTD PMID:33453195 Kras Rat cadmium dichloride multiple interactions ISO KRAS (Homo sapiens) 6480464 KRAS protein inhibits the reaction [Cadmium Chloride results in decreased expression of MIR155 mRNA] more ... CTD PMID:27510461 Kras Rat cadmium dichloride increases expression ISO KRAS (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of KRAS mRNA and Cadmium Chloride results in increased expression of KRAS protein CTD PMID:23811327 more ... Kras Rat cannabidiol decreases expression EXP 6480464 Cannabidiol results in decreased expression of KRAS mRNA CTD PMID:32553926 Kras Rat cannabidiol multiple interactions ISO KRAS (Homo sapiens) 6480464 [Oxygen co-treated with Ozone co-treated with Cannabidiol] results in decreased expression of KRAS mRNA CTD PMID:32992648 Kras Rat carbamazepine affects expression ISO KRAS (Homo sapiens) 6480464 Carbamazepine affects the expression of KRAS mRNA CTD PMID:24752500 Kras Rat carbon nanotube increases mutagenesis ISO Kras (Mus musculus) 6480464 Nanotubes and Carbon results in increased mutagenesis of KRAS gene CTD PMID:24213921 Kras Rat ceruletide multiple interactions ISO Kras (Mus musculus) 6480464 (+)-JQ1 compound inhibits the reaction [[KRAS protein mutant form co-treated with Ceruletide] results in increased expression of BRD4 protein] more ... CTD PMID:26390243 Kras Rat CGP 52608 multiple interactions ISO KRAS (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to KRAS gene] CTD PMID:28238834 Kras Rat chloroethene multiple interactions ISO KRAS (Homo sapiens) 6480464 CYP2E1 gene polymorphism promotes the reaction [Vinyl Chloride affects the mutagenesis of KRAS gene] more ... CTD PMID:12705718 more ... Kras Rat chloroethene increases mutagenesis ISO KRAS (Homo sapiens) 6480464 Vinyl Chloride results in increased mutagenesis of KRAS gene CTD PMID:10629081 more ... Kras Rat chloroethene increases response to substance ISO Kras (Mus musculus) 6480464 KRAS gene polymorphism results in increased susceptibility to Vinyl Chloride CTD PMID:12807761 Kras Rat chloroprene increases mutagenesis ISO Kras (Mus musculus) 6480464 Chloroprene results in increased mutagenesis of KRAS gene CTD PMID:10223196 and PMID:11397402 Kras Rat chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of KRAS mRNA CTD PMID:18668222 Kras Rat chymostatin multiple interactions ISO KRAS (Homo sapiens) 6480464 chymostatin inhibits the reaction [KRAS protein mutant form results in increased expression of AGT protein] more ... CTD PMID:33380422 Kras Rat cisplatin multiple interactions ISO KRAS (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of KRAS mRNA CTD PMID:27392435 Kras Rat cisplatin decreases expression ISO KRAS (Homo sapiens) 6480464 Cisplatin results in decreased expression of KRAS mRNA CTD PMID:27392435 Kras Rat clofibrate increases expression ISO Kras (Mus musculus) 6480464 Clofibrate results in increased expression of KRAS mRNA CTD PMID:23811191 Kras Rat cobalt atom increases mutagenesis EXP 6480464 Cobalt results in increased mutagenesis of KRAS gene CTD PMID:34468815 Kras Rat cobalt atom increases mutagenesis ISO Kras (Mus musculus) 6480464 Cobalt results in increased mutagenesis of KRAS gene CTD PMID:34468815 Kras Rat cobimetinib increases response to substance ISO KRAS (Homo sapiens) 6480464 KRAS protein mutant form results in increased susceptibility to cobimetinib CTD PMID:22084396 Kras Rat cobimetinib multiple interactions ISO KRAS (Homo sapiens) 6480464 2-(1H-indazol-4-yl)-6-(4-methanesulfonylpiperazin-1-ylmethyl)-4-morpholin-4-ylthieno(3 more ... CTD PMID:22084396 Kras Rat copper atom increases expression EXP 6480464 Copper deficiency results in increased expression of KRAS mRNA and Copper results in increased expression of KRAS mRNA CTD PMID:17418555 and PMID:22465980 Kras Rat copper atom multiple interactions ISO KRAS (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of KRAS mRNA CTD PMID:30911355 Kras Rat copper(0) increases expression EXP 6480464 Copper deficiency results in increased expression of KRAS mRNA and Copper results in increased expression of KRAS mRNA CTD PMID:17418555 and PMID:22465980 Kras Rat copper(0) multiple interactions ISO KRAS (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of KRAS mRNA CTD PMID:30911355 Kras Rat coumestrol decreases expression ISO KRAS (Homo sapiens) 6480464 Coumestrol results in decreased expression of KRAS mRNA CTD PMID:19167446 Kras Rat crizotinib decreases response to substance ISO KRAS (Homo sapiens) 6480464 KRAS protein mutant form results in decreased susceptibility to crizotinib CTD PMID:22235099 Kras Rat cumene multiple interactions ISO Kras (Mus musculus) 6480464 [cumene co-treated with KRAS gene mutant form] results in decreased expression of CCN1 mRNA more ... CTD PMID:18648096 Kras Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of KRAS mRNA CTD PMID:26577399 Kras Rat curcumin decreases expression ISO KRAS (Homo sapiens) 6480464 Curcumin analog results in decreased expression of KRAS mRNA and Curcumin results in decreased expression of KRAS mRNA CTD PMID:17041101 Kras Rat curcumin multiple interactions ISO Kras (Mus musculus) 6480464 Curcumin affects the reaction [KRAS protein affects the localization of TRP53 protein] and Curcumin inhibits the reaction [KRAS protein results in decreased expression of XPO1 protein] CTD PMID:21519798 Kras Rat cycloheximide multiple interactions ISO KRAS (Homo sapiens) 6480464 Cycloheximide inhibits the reaction [Tetrachlorodibenzodioxin results in increased expression of KRAS mRNA] CTD PMID:11007951 Kras Rat Cyclopenta[cd]pyrene increases mutagenesis ISO Kras (Mus musculus) 6480464 cyclopenta(c and d)pyrene results in increased mutagenesis of KRAS gene CTD PMID:9659573 Kras Rat dabrafenib multiple interactions ISO KRAS (Homo sapiens) 6480464 [KRAS protein affects the susceptibility to dabrafenib] which affects the expression of TNFRSF10B protein more ... CTD PMID:27222248 Kras Rat dabrafenib affects response to substance ISO KRAS (Homo sapiens) 6480464 KRAS protein affects the susceptibility to dabrafenib CTD PMID:27222248 Kras Rat dextran sulfate multiple interactions ISO Kras (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of KRAS mRNA and Erianin inhibits the reaction [Dextran Sulfate results in decreased expression of KRAS protein] CTD PMID:29950665 and PMID:32272095 Kras Rat dextran sulfate decreases expression ISO Kras (Mus musculus) 6480464 Dextran Sulfate results in decreased expression of KRAS protein CTD PMID:32272095 Kras Rat dibenzo[a,l]pyrene increases mutagenesis ISO Kras (Mus musculus) 6480464 dibenzo(a and l)pyrene results in increased mutagenesis of KRAS gene CTD PMID:9659573 Kras Rat Dibutyl phosphate affects expression ISO KRAS (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of KRAS mRNA CTD PMID:37042841 Kras Rat dichlorine multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in decreased expression of KRAS mRNA CTD PMID:18636392 Kras Rat diclofenac affects expression ISO KRAS (Homo sapiens) 6480464 Diclofenac affects the expression of KRAS mRNA CTD PMID:24752500 Kras Rat dioxygen multiple interactions ISO KRAS (Homo sapiens) 6480464 [Oxygen co-treated with Ozone co-treated with Cannabidiol] results in decreased expression of KRAS mRNA and [Oxygen co-treated with Ozone] results in decreased expression of KRAS mRNA CTD PMID:32992648 Kras Rat dorsomorphin multiple interactions ISO KRAS (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Kras Rat doxorubicin decreases expression ISO KRAS (Homo sapiens) 6480464 Doxorubicin results in decreased expression of KRAS mRNA CTD PMID:29803840 Kras Rat doxorubicin increases expression ISO KRAS (Homo sapiens) 6480464 Doxorubicin results in increased expression of KRAS mRNA mutant form and Doxorubicin results in increased expression of KRAS protein mutant form CTD PMID:38423379 Kras Rat emamectin benzoate decreases expression ISO KRAS (Homo sapiens) 6480464 emamectin benzoate results in decreased expression of KRAS mRNA CTD PMID:38901726 Kras Rat erlotinib hydrochloride increases response to substance ISO KRAS (Homo sapiens) 6480464 KRAS protein results in increased susceptibility to Erlotinib Hydrochloride CTD PMID:20705357 Kras Rat ethanol affects splicing ISO Kras (Mus musculus) 6480464 Ethanol affects the splicing of KRAS mRNA CTD PMID:30319688 Kras Rat farnesyl diphosphate multiple interactions EXP 6480464 [FNTA protein binds to FNTB protein] binds to [farnesyl pyrophosphate analog co-treated with KRAS protein] CTD PMID:10673434 Kras Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of KRAS mRNA CTD PMID:24136188 Kras Rat folic acid increases expression ISO Kras (Mus musculus) 6480464 Folic Acid results in increased expression of KRAS mRNA CTD PMID:2566606 Kras Rat folic acid multiple interactions ISO Kras (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of KRAS mRNA CTD PMID:22206623 Kras Rat folic acid decreases expression ISO Kras (Mus musculus) 6480464 Folic Acid results in decreased expression of KRAS mRNA CTD PMID:25629700 Kras Rat furfural multiple interactions ISO KRAS (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of KRAS protein CTD PMID:38598786 Kras Rat GDP multiple interactions ISO KRAS (Homo sapiens) 6480464 KRAS protein mutant form inhibits the reaction [SOS1 protein inhibits the reaction [Guanosine Diphosphate binds to KRAS protein]] and SOS1 protein inhibits the reaction [Guanosine Diphosphate binds to KRAS protein] CTD PMID:28154176 Kras Rat GDP affects binding ISO KRAS (Homo sapiens) 6480464 Guanosine Diphosphate binds to KRAS protein and Guanosine Diphosphate binds to KRAS protein mutant form CTD PMID:28154176 Kras Rat gefitinib affects response to substance ISO KRAS (Homo sapiens) 6480464 KRAS protein mutant form affects the susceptibility to gefitinib CTD PMID:17270025 Kras Rat gefitinib decreases response to substance ISO KRAS (Homo sapiens) 6480464 KRAS protein results in decreased susceptibility to gefitinib CTD PMID:28739874 Kras Rat gefitinib multiple interactions ISO KRAS (Homo sapiens) 6480464 KRAS protein affects the reaction [EGFR protein affects the susceptibility to gefitinib] CTD PMID:28739874 Kras Rat genistein decreases expression ISO KRAS (Homo sapiens) 6480464 Genistein results in decreased expression of KRAS mRNA CTD PMID:15256057 and PMID:16474171 Kras Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of KRAS mRNA CTD PMID:22061828 Kras Rat geraniol multiple interactions EXP 6480464 geraniol inhibits the reaction [Methylnitronitrosoguanidine results in increased expression of KRAS mRNA] CTD PMID:28428697 Kras Rat GTP multiple interactions ISO KRAS (Homo sapiens) 6480464 KRAS protein mutant form inhibits the reaction [RASA1 protein promotes the reaction [KRAS protein results in increased hydrolysis of Guanosine Triphosphate]] and RASA1 protein promotes the reaction [KRAS protein results in increased hydrolysis of Guanosine Triphosphate] CTD PMID:28154176 Kras Rat GTP affects binding ISO KRAS (Homo sapiens) 6480464 Guanosine Triphosphate binds to KRAS protein and Guanosine Triphosphate binds to KRAS protein mutant form CTD PMID:28154176 Kras Rat GTP increases hydrolysis ISO KRAS (Homo sapiens) 6480464 KRAS protein mutant form results in increased hydrolysis of Guanosine Triphosphate and KRAS protein results in increased hydrolysis of Guanosine Triphosphate CTD PMID:28154176 Kras Rat guanosine multiple interactions ISO KRAS (Homo sapiens) 6480464 Guanosine inhibits the reaction [tiazofurin results in decreased expression of KRAS] CTD PMID:9381980 Kras Rat haloperidol increases expression EXP 6480464 Haloperidol results in increased expression of KRAS mRNA CTD PMID:15860345 Kras Rat hydrogen peroxide multiple interactions ISO Kras (Mus musculus) 158013773 melatonin inhibits the reaction [hydrogen peroxide increases expression of Kras protein in C-kit+ cardiac progenitor cells] RGD Kras Rat hydrogen peroxide increases expression ISO Kras (Mus musculus) 158013773 hydrogen peroxide increases expression of Kras protein in C-kit+ cardiac progenitor cells RGD Kras Rat hydroquinone multiple interactions ISO KRAS (Homo sapiens) 6480464 [PARP1 protein affects the susceptibility to hydroquinone] which affects the expression of KRAS protein CTD PMID:28444915 Kras Rat hydroquinone increases expression ISO KRAS (Homo sapiens) 6480464 hydroquinone results in increased expression of KRAS protein CTD PMID:27515134 Kras Rat hydroquinone affects expression ISO KRAS (Homo sapiens) 6480464 hydroquinone affects the expression of KRAS mRNA CTD PMID:27515134 Kras Rat hydroxyurea decreases expression ISO Kras (Mus musculus) 6480464 Hydroxyurea results in decreased expression of KRAS mRNA CTD PMID:12929121 Kras Rat ionomycin multiple interactions ISO KRAS (Homo sapiens) 6480464 Methohexital inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in increased activity of KRAS protein] more ... CTD PMID:15263067 Kras Rat irbesartan multiple interactions ISO Kras (Mus musculus) 6480464 Irbesartan inhibits the reaction [KRAS protein mutant form results in increased expression of CDKN2A protein] CTD PMID:33380422 Kras Rat irbesartan multiple interactions ISO KRAS (Homo sapiens) 6480464 Irbesartan inhibits the reaction [KRAS protein mutant form results in increased expression of CDKN1A protein] CTD PMID:33380422 Kras Rat isoprenaline increases expression ISO Kras (Mus musculus) 6480464 Isoproterenol results in increased expression of KRAS mRNA CTD PMID:21335049 Kras Rat isoprene increases mutagenesis ISO Kras (Mus musculus) 6480464 isoprene results in increased mutagenesis of KRAS gene CTD PMID:11397402 and PMID:9111215 Kras Rat isotretinoin decreases expression ISO KRAS (Homo sapiens) 6480464 Isotretinoin results in decreased expression of KRAS mRNA CTD PMID:20436886 Kras Rat ivermectin decreases expression ISO KRAS (Homo sapiens) 6480464 Ivermectin results in decreased expression of KRAS protein CTD PMID:32959892 Kras Rat kainic acid increases expression EXP 6480464 Kainic Acid results in increased expression of KRAS mRNA CTD PMID:19700661 Kras Rat L-744832 multiple interactions ISO KRAS (Homo sapiens) 6480464 [GGTI 2147 co-treated with L 744832] results in decreased prenylation of KRAS protein CTD PMID:16156861 Kras Rat lapatinib multiple interactions ISO KRAS (Homo sapiens) 6480464 KRAS protein affects the reaction [EGFR protein affects the susceptibility to lapatinib] CTD PMID:28739874 Kras Rat lapatinib decreases response to substance ISO KRAS (Homo sapiens) 6480464 KRAS protein results in decreased susceptibility to lapatinib CTD PMID:28739874 Kras Rat lead diacetate decreases expression ISO Kras (Mus musculus) 6480464 lead acetate results in decreased expression of KRAS mRNA CTD PMID:21829687 Kras Rat lead diacetate multiple interactions ISO KRAS (Homo sapiens) 6480464 [lead acetate co-treated with zinc protoporphyrin] results in decreased expression of KRAS mRNA CTD PMID:22839698 Kras Rat lead diacetate increases expression ISO Kras (Mus musculus) 6480464 lead acetate results in increased expression of KRAS mRNA CTD PMID:25270620 Kras Rat lead(0) increases expression ISO Kras (Mus musculus) 6480464 Lead results in increased expression of KRAS protein CTD PMID:19727529 Kras Rat lipopolysaccharide multiple interactions ISO Kras (Mus musculus) 6480464 [Lipopolysaccharides co-treated with 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone] results in increased mutagenesis of KRAS gene CTD PMID:21868532 Kras Rat lipopolysaccharide increases expression ISO KRAS (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of KRAS mRNA CTD PMID:35953652 Kras Rat losartan multiple interactions ISO KRAS (Homo sapiens) 6480464 Losartan inhibits the reaction [KRAS protein mutant form results in increased expression of CDKN1A protein] and Losartan inhibits the reaction [KRAS protein mutant form results in increased expression of CDKN2A protein] CTD PMID:33380422 Kras Rat lovastatin decreases prenylation ISO KRAS (Homo sapiens) 6480464 Lovastatin results in decreased prenylation of KRAS protein CTD PMID:16156861 Kras Rat lovastatin increases expression ISO Kras (Mus musculus) 6480464 Lovastatin results in increased expression of KRAS protein CTD PMID:12907238 Kras Rat lovastatin affects localization ISO Kras (Mus musculus) 6480464 Lovastatin affects the localization of KRAS protein CTD PMID:12106604 Kras Rat lovastatin increases activity ISO Kras (Mus musculus) 6480464 Lovastatin results in increased activity of KRAS protein CTD PMID:17005160 Kras Rat luzindole multiple interactions ISO Kras (Mus musculus) 158013773 luzindole inhibits the reaction [melatonin inhibits the reaction [hydrogen peroxide increases expression of Kras protein in C-kit+ cardiac progenitor cells]] RGD Kras Rat manumycin A multiple interactions ISO KRAS (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [manumycin results in decreased activity of KRAS protein] CTD PMID:19409983 Kras Rat manumycin A decreases activity ISO KRAS (Homo sapiens) 6480464 manumycin results in decreased activity of KRAS protein CTD PMID:19409983 Kras Rat MeIQx increases mutagenesis EXP 6480464 2-amino-3 more ... CTD PMID:18271921 Kras Rat mercury dibromide decreases expression ISO KRAS (Homo sapiens) 6480464 mercuric bromide results in decreased expression of KRAS mRNA CTD PMID:26272509 Kras Rat mercury dibromide multiple interactions ISO KRAS (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of KRAS mRNA CTD PMID:27188386 Kras Rat metformin multiple interactions ISO KRAS (Homo sapiens) 6480464 [Paclitaxel co-treated with Metformin] results in decreased expression of KRAS mRNA CTD PMID:29309887 Kras Rat methohexital multiple interactions ISO KRAS (Homo sapiens) 6480464 Methohexital inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in increased activity of KRAS protein] CTD PMID:15263067 Kras Rat methotrexate increases response to substance ISO KRAS (Homo sapiens) 6480464 KRAS gene mutant form results in increased susceptibility to Methotrexate CTD PMID:24688052 Kras Rat methotrexate decreases expression ISO KRAS (Homo sapiens) 6480464 Methotrexate results in decreased expression of KRAS mRNA more ... CTD PMID:24688052 Kras Rat metyrapone multiple interactions EXP 6480464 [[Air Pollutants results in increased abundance of Ozone] which co-treated with Metyrapone] results in increased expression of KRAS mRNA CTD PMID:37088303 Kras Rat monosodium L-glutamate decreases expression EXP 6480464 Sodium Glutamate results in decreased expression of KRAS mRNA CTD PMID:20928830 Kras Rat Morindone multiple interactions ISO KRAS (Homo sapiens) 6480464 [KRAS protein mutant form affects the susceptibility to morindone] which affects the expression of BRAF protein and [KRAS protein mutant form affects the susceptibility to morindone] which affects the expression of PIK3CA protein mutant form CTD PMID:38423379 Kras Rat Morindone affects response to substance ISO KRAS (Homo sapiens) 6480464 KRAS protein mutant form affects the susceptibility to morindone CTD PMID:38423379 Kras Rat Morindone decreases expression ISO KRAS (Homo sapiens) 6480464 morindone results in decreased expression of KRAS mRNA mutant form CTD PMID:38423379 Kras Rat Morindone increases expression ISO KRAS (Homo sapiens) 6480464 morindone results in increased expression of KRAS protein mutant form CTD PMID:38423379 Kras Rat N,N-bis(2-hydroxypropyl)nitrosamine increases mutagenesis EXP 6480464 diisopropanolnitrosamine results in increased mutagenesis of KRAS gene CTD PMID:18271921 Kras Rat N-acetyl-L-cysteine multiple interactions ISO KRAS (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [manumycin results in decreased activity of KRAS protein] CTD PMID:19409983 Kras Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal increases expression ISO KRAS (Homo sapiens) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased expression of KRAS mRNA CTD PMID:31806706 Kras Rat N-ethyl-N-nitrosourea multiple interactions ISO Kras (Mus musculus) 6480464 Ethylnitrosourea promotes the reaction [GATA6 protein binds to KRAS exon] and Ethylnitrosourea promotes the reaction [NFYA protein binds to KRAS exon] CTD PMID:16271038 Kras Rat N-ethyl-N-nitrosourea increases mutagenesis ISO Kras (Mus musculus) 6480464 Ethylnitrosourea results in increased mutagenesis of KRAS gene CTD PMID:15790496 Kras Rat N-methyl-N'-nitro-N-nitrosoguanidine multiple interactions EXP 6480464 geraniol inhibits the reaction [Methylnitronitrosoguanidine results in increased expression of KRAS mRNA] CTD PMID:28428697 Kras Rat N-methyl-N'-nitro-N-nitrosoguanidine increases expression EXP 6480464 Methylnitronitrosoguanidine results in increased expression of KRAS mRNA CTD PMID:28428697 Kras Rat N-methyl-N-nitrosourea decreases response to substance EXP 6480464 KRAS protein results in decreased susceptibility to Methylnitrosourea CTD PMID:11973638 Kras Rat N-methyl-N-nitrosourea increases mutagenesis ISO Kras (Mus musculus) 6480464 Methylnitrosourea results in increased mutagenesis of KRAS gene CTD PMID:12483526 and PMID:18062963 Kras Rat N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of KRAS mRNA CTD PMID:7910516 Kras Rat N-nitrosodiethylamine increases expression ISO Kras (Mus musculus) 6480464 Diethylnitrosamine results in increased expression of KRAS mRNA CTD PMID:26464624 Kras Rat N-nitrosodimethylamine affects localization ISO Kras (Mus musculus) 6480464 Dimethylnitrosamine affects the localization of KRAS protein CTD PMID:11884234 Kras Rat N-nitrosodimethylamine multiple interactions ISO Kras (Mus musculus) 6480464 Dimethylnitrosamine results in decreased expression of and affects the localization of KRAS protein more ... CTD PMID:11884234 and PMID:19555203 Kras Rat nicotinic acid affects localization ISO Kras (Mus musculus) 6480464 Niacin affects the localization of KRAS protein CTD PMID:12106604 Kras Rat nitrates multiple interactions ISO Kras (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of KRAS mRNA CTD PMID:35964746 Kras Rat ochratoxin A decreases expression ISO KRAS (Homo sapiens) 6480464 ochratoxin A results in decreased expression of KRAS mRNA CTD PMID:30559759 Kras Rat oncrasin-1 increases response to substance ISO KRAS (Homo sapiens) 6480464 KRAS protein mutant form results in increased susceptibility to oncrasin-1 CTD PMID:21443218 Kras Rat oxirane increases mutagenesis ISO Kras (Mus musculus) 6480464 Ethylene Oxide results in increased mutagenesis of KRAS gene CTD PMID:24029818 Kras Rat oxybenzone increases expression ISO KRAS (Homo sapiens) 6480464 oxybenzone results in increased expression of KRAS mRNA CTD PMID:36581016 Kras Rat ozone multiple interactions EXP 6480464 [[Air Pollutants results in increased abundance of Ozone] which co-treated with Metyrapone] results in increased expression of KRAS mRNA more ... CTD PMID:18636392 and PMID:37088303 Kras Rat ozone multiple interactions ISO KRAS (Homo sapiens) 6480464 [Oxygen co-treated with Ozone co-treated with Cannabidiol] results in decreased expression of KRAS mRNA and [Oxygen co-treated with Ozone] results in decreased expression of KRAS mRNA CTD PMID:32992648 Kras Rat ozone increases expression EXP 6480464 Ozone results in increased expression of KRAS mRNA CTD PMID:16330353 Kras Rat p-chloromercuribenzoic acid decreases expression ISO KRAS (Homo sapiens) 6480464 p-Chloromercuribenzoic Acid results in decreased expression of KRAS mRNA CTD PMID:26272509 Kras Rat p-chloromercuribenzoic acid multiple interactions ISO KRAS (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of KRAS mRNA CTD PMID:27188386 Kras Rat paclitaxel multiple interactions ISO KRAS (Homo sapiens) 6480464 [Paclitaxel co-treated with Metformin] results in decreased expression of KRAS mRNA CTD PMID:29309887 Kras Rat paracetamol affects expression ISO Kras (Mus musculus) 6480464 Acetaminophen affects the expression of KRAS mRNA CTD PMID:17562736 Kras Rat PD 0325901 multiple interactions ISO Kras (Mus musculus) 6480464 [mirdametinib affects the susceptibility to KRAS protein] affects the reaction [NVP-BKM120 results in decreased expression of MKI67 protein] CTD PMID:24576621 Kras Rat PD 0325901 multiple interactions ISO KRAS (Homo sapiens) 6480464 KRAS protein affects the reaction [mirdametinib inhibits the reaction [NVP-BKM120 results in increased phosphorylation of MAPK1 protein]] more ... CTD PMID:24576621 Kras Rat pemetrexed increases response to substance ISO KRAS (Homo sapiens) 6480464 KRAS gene mutant form results in increased susceptibility to Pemetrexed CTD PMID:24688052 Kras Rat pemetrexed decreases expression ISO KRAS (Homo sapiens) 6480464 Pemetrexed results in decreased expression of KRAS mRNA more ... CTD PMID:24688052 Kras Rat pentobarbital multiple interactions ISO KRAS (Homo sapiens) 6480464 Pentobarbital inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in increased activity of KRAS protein] CTD PMID:15263067 Kras Rat phlorizin decreases expression ISO Kras (Mus musculus) 6480464 Phlorhizin results in decreased expression of KRAS mRNA CTD PMID:22538082 Kras Rat phorbol 13-acetate 12-myristate multiple interactions ISO KRAS (Homo sapiens) 6480464 Methohexital inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in increased activity of KRAS protein] more ... CTD PMID:15263067 Kras Rat phorbol 13-acetate 12-myristate multiple interactions ISO Kras (Mus musculus) 6480464 [sodium arsenite co-treated with Tetradecanoylphorbol Acetate] results in increased expression of KRAS mRNA and [sodium arsenite co-treated with Tetradecanoylphorbol Acetate] results in increased expression of KRAS protein CTD PMID:16368122 Kras Rat picrotoxin decreases expression EXP 6480464 Picrotoxin results in decreased expression of KRAS mRNA CTD PMID:15170462 Kras Rat piperonyl butoxide increases mutagenesis ISO KRAS (Homo sapiens) 6480464 Piperonyl Butoxide results in increased mutagenesis of KRAS gene CTD PMID:7565889 Kras Rat pirinixic acid multiple interactions ISO KRAS (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of KRAS mRNA CTD PMID:19710929 Kras Rat quercetin multiple interactions ISO KRAS (Homo sapiens) 6480464 [bisphenol A co-treated with Quercetin metabolite] results in increased expression of KRAS mRNA more ... CTD PMID:19424582 and PMID:36982678 Kras Rat quercetin increases expression ISO KRAS (Homo sapiens) 6480464 Quercetin metabolite results in increased expression of KRAS mRNA and Quercetin results in increased expression of KRAS mRNA CTD PMID:36982678 Kras Rat quercetin decreases expression ISO KRAS (Homo sapiens) 6480464 Quercetin results in decreased expression of KRAS mRNA and Quercetin results in decreased expression of KRAS protein CTD PMID:10652438 and PMID:9381980 Kras Rat Rebamipide increases expression EXP 6480464 rebamipide results in increased expression of KRAS mRNA CTD PMID:18299717 Kras Rat resveratrol decreases expression ISO KRAS (Homo sapiens) 6480464 resveratrol results in decreased expression of KRAS mRNA and resveratrol results in decreased expression of KRAS protein CTD PMID:12002526 more ... Kras Rat resveratrol multiple interactions ISO KRAS (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of KRAS mRNA CTD PMID:23557933 Kras Rat resveratrol decreases expression ISO Kras (Mus musculus) 6480464 resveratrol results in decreased expression of KRAS protein mutant form CTD PMID:25280562 Kras Rat riddelliine increases mutagenesis ISO Kras (Mus musculus) 6480464 riddelliine results in increased mutagenesis of KRAS gene CTD PMID:13678655 and PMID:20737008 Kras Rat sarin decreases expression EXP 6480464 Sarin results in decreased expression of KRAS mRNA CTD PMID:16733813 Kras Rat SB 431542 multiple interactions ISO KRAS (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Kras Rat secobarbital multiple interactions ISO KRAS (Homo sapiens) 6480464 Secobarbital inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in increased activity of KRAS protein] CTD PMID:15263067 Kras Rat selumetinib multiple interactions ISO KRAS (Homo sapiens) 6480464 AZD 6244 inhibits the reaction [[KRAS protein mutant form affects the susceptibility to vemurafenib] promotes the reaction [TNFRSF10B protein results in increased cleavage of CASP3 protein]] more ... CTD PMID:27222248 Kras Rat sevoflurane decreases expression ISO KRAS (Homo sapiens) 6480464 Sevoflurane results in decreased expression of KRAS mRNA CTD PMID:35953652 Kras Rat simvastatin decreases prenylation ISO KRAS (Homo sapiens) 6480464 Simvastatin results in decreased prenylation of KRAS protein CTD PMID:8063617 Kras Rat sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of KRAS mRNA CTD PMID:11241755 Kras Rat sodium arsenite multiple interactions ISO Kras (Mus musculus) 6480464 [sodium arsenite co-treated with Tetradecanoylphorbol Acetate] results in increased expression of KRAS mRNA and [sodium arsenite co-treated with Tetradecanoylphorbol Acetate] results in increased expression of KRAS protein CTD PMID:16368122 Kras Rat sodium arsenite affects expression ISO KRAS (Homo sapiens) 6480464 sodium arsenite affects the expression of KRAS protein CTD PMID:17384772 Kras Rat sodium arsenite affects expression ISO Kras (Mus musculus) 6480464 sodium arsenite affects the expression of KRAS mRNA CTD PMID:16507464 Kras Rat sodium arsenite increases expression ISO KRAS (Homo sapiens) 6480464 sodium arsenite results in increased expression of KRAS protein CTD PMID:24431212 and PMID:25804888 Kras Rat sodium arsenite increases expression ISO Kras (Mus musculus) 6480464 sodium arsenite results in increased expression of KRAS mRNA and sodium arsenite results in increased expression of KRAS protein CTD PMID:16014739 and PMID:16507464 Kras Rat sodium chloride multiple interactions ISO KRAS (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of KRAS protein more ... CTD PMID:38598786 Kras Rat Soman increases expression EXP 6480464 Soman results in increased expression of KRAS mRNA CTD PMID:19281266 Kras Rat sotorasib increases response to substance ISO KRAS (Homo sapiens) 6480464 KRAS protein mutant form results in increased susceptibility to sotorasib CTD PMID:31666701 Kras Rat sotorasib affects binding ISO KRAS (Homo sapiens) 6480464 sotorasib binds to KRAS protein mutant form CTD PMID:31666701 Kras Rat sotorasib multiple interactions ISO KRAS (Homo sapiens) 6480464 KRAS protein affects the reaction [sotorasib results in decreased phosphorylation of MAPK1 protein] and KRAS protein affects the reaction [sotorasib results in decreased phosphorylation of MAPK3 protein] CTD PMID:31666701 Kras Rat styrene increases response to substance ISO Kras (Mus musculus) 6480464 KRAS gene polymorphism results in increased susceptibility to Styrene CTD PMID:12807761 Kras Rat sulfur dioxide increases expression EXP 6480464 Sulfur Dioxide results in increased expression of KRAS mRNA and Sulfur Dioxide results in increased expression of KRAS protein CTD PMID:19434695 Kras Rat sulindac affects response to substance ISO KRAS (Homo sapiens) 6480464 KRAS protein affects the susceptibility to Sulindac CTD PMID:11751493 Kras Rat sunitinib decreases expression ISO KRAS (Homo sapiens) 6480464 Sunitinib results in decreased expression of KRAS protein CTD PMID:39025287 Kras Rat tacrolimus hydrate increases expression ISO Kras (Mus musculus) 6480464 Tacrolimus results in increased expression of KRAS mRNA CTD PMID:25270620 Kras Rat Tanshinone I decreases response to substance ISO KRAS (Homo sapiens) 6480464 KRAS mRNA results in decreased susceptibility to tanshinone CTD PMID:30506648 Kras Rat Tanshinone I multiple interactions ISO Kras (Mus musculus) 6480464 tanshinone inhibits the reaction [Carbon Tetrachloride results in increased expression of KRAS protein] CTD PMID:38348705 Kras Rat Tanshinone I decreases expression ISO KRAS (Homo sapiens) 6480464 tanshinone results in decreased expression of KRAS mRNA and tanshinone results in decreased expression of KRAS protein CTD PMID:30506648 Kras Rat Temsirolimus decreases response to substance ISO KRAS (Homo sapiens) 6480464 KRAS protein mutant form results in decreased susceptibility to temsirolimus CTD PMID:24493623 Kras Rat Temsirolimus multiple interactions ISO KRAS (Homo sapiens) 6480464 KRAS protein mutant form inhibits the reaction [temsirolimus inhibits the reaction [CIP2A protein binds to MTOR protein]] more ... CTD PMID:24493623 Kras Rat testosterone enanthate affects expression ISO KRAS (Homo sapiens) 6480464 testosterone enanthate affects the expression of KRAS mRNA CTD PMID:17440010 Kras Rat tetrachloromethane affects expression ISO Kras (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of KRAS mRNA CTD PMID:17484886 Kras Rat tetrachloromethane multiple interactions ISO Kras (Mus musculus) 6480464 Colchicine inhibits the reaction [Carbon Tetrachloride results in increased expression of KRAS protein] and tanshinone inhibits the reaction [Carbon Tetrachloride results in increased expression of KRAS protein] CTD PMID:38348705 Kras Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of KRAS mRNA CTD PMID:33387578 Kras Rat tetrachloromethane increases expression ISO Kras (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of KRAS mRNA and Carbon Tetrachloride results in increased expression of KRAS protein CTD PMID:31919559 and PMID:38348705 Kras Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of KRAS mRNA CTD PMID:31150632 and PMID:8847708 Kras Rat Tetranitromethane increases mutagenesis ISO Kras (Mus musculus) 6480464 Tetranitromethane results in increased mutagenesis of KRAS gene CTD PMID:14713543 Kras Rat thiamylal multiple interactions ISO KRAS (Homo sapiens) 6480464 Thiamylal inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in increased activity of KRAS protein] CTD PMID:15263067 Kras Rat thimerosal decreases expression ISO KRAS (Homo sapiens) 6480464 Thimerosal results in decreased expression of KRAS mRNA CTD PMID:27188386 Kras Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of KRAS mRNA CTD PMID:34492290 Kras Rat tiazofurine multiple interactions ISO KRAS (Homo sapiens) 6480464 Guanosine inhibits the reaction [tiazofurin results in decreased expression of KRAS] CTD PMID:9381980 Kras Rat tiazofurine decreases expression ISO KRAS (Homo sapiens) 6480464 tiazofurin results in decreased expression of KRAS CTD PMID:9381980 Kras Rat tipifarnib increases expression EXP 6480464 tipifarnib results in increased expression of KRAS mRNA CTD PMID:16403772 Kras Rat titanium dioxide decreases expression ISO Kras (Mus musculus) 6480464 titanium dioxide results in decreased expression of KRAS mRNA CTD PMID:23557971 Kras Rat titanium dioxide decreases methylation ISO Kras (Mus musculus) 6480464 titanium dioxide results in decreased methylation of KRAS gene CTD PMID:35295148 Kras Rat titanium dioxide multiple interactions ISO Kras (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of KRAS mRNA CTD PMID:29950665 Kras Rat titanium dioxide affects expression ISO Kras (Mus musculus) 6480464 titanium dioxide affects the expression of KRAS mRNA CTD PMID:17656681 Kras Rat toluene affects expression EXP 6480464 Toluene affects the expression of KRAS mRNA CTD PMID:21827849 Kras Rat trimetrexate increases response to substance ISO KRAS (Homo sapiens) 6480464 KRAS gene mutant form results in increased susceptibility to Trimetrexate CTD PMID:24688052 Kras Rat Triptolide increases expression EXP 6480464 triptolide results in increased expression of KRAS mRNA CTD PMID:23639586 Kras Rat triptonide increases expression ISO Kras (Mus musculus) 6480464 triptonide results in increased expression of KRAS mRNA CTD PMID:33045310 Kras Rat urethane affects response to substance ISO Kras (Mus musculus) 6480464 KRAS gene affects the susceptibility to Urethane CTD PMID:11807781 Kras Rat urethane decreases expression ISO KRAS (Homo sapiens) 6480464 Urethane results in decreased expression of KRAS mRNA CTD PMID:28818685 Kras Rat urethane increases mutagenesis ISO Kras (Mus musculus) 6480464 Urethane results in increased mutagenesis of KRAS gene CTD PMID:10779650 Kras Rat urethane increases mutagenesis EXP 6480464 Urethane results in increased mutagenesis of KRAS gene CTD PMID:18271921 Kras Rat urethane decreases expression ISO Kras (Mus musculus) 6480464 Urethane results in decreased expression of KRAS mRNA CTD PMID:16289808 Kras Rat ursodeoxycholic acid multiple interactions EXP 6480464 Ursodeoxycholic Acid inhibits the reaction [Azoxymethane results in increased mutagenesis of KRAS gene] CTD PMID:12839936 Kras Rat valproic acid increases expression ISO KRAS (Homo sapiens) 6480464 Valproic Acid results in increased expression of KRAS mRNA CTD PMID:28001369 Kras Rat vemurafenib affects response to substance ISO KRAS (Homo sapiens) 6480464 KRAS protein mutant form affects the susceptibility to vemurafenib CTD PMID:27222248 Kras Rat vemurafenib multiple interactions ISO KRAS (Homo sapiens) 6480464 [KRAS protein mutant form affects the susceptibility to vemurafenib] promotes the reaction [TNFRSF10B protein results in increased cleavage of CASP3 protein] more ... CTD PMID:27222248 Kras Rat vinyl carbamate multiple interactions ISO Kras (Mus musculus) 6480464 diallyl sulfone inhibits the reaction [vinyl carbamate results in increased mutagenesis of KRAS gene] CTD PMID:20205516 Kras Rat vinyl carbamate increases mutagenesis ISO Kras (Mus musculus) 6480464 vinyl carbamate results in increased mutagenesis of KRAS gene CTD PMID:20205516 Kras Rat zearalenone decreases expression ISO Kras (Mus musculus) 6480464 Zearalenone results in decreased expression of KRAS mRNA CTD PMID:30717214 Kras Rat zearalenone increases expression ISO Kras (Mus musculus) 6480464 Zearalenone results in increased expression of KRAS mRNA CTD PMID:29758222 Kras Rat zidovudine increases mutagenesis ISO Kras (Mus musculus) 6480464 Zidovudine results in increased mutagenesis of KRAS gene CTD PMID:18800350 Kras Rat zinc protoporphyrin multiple interactions ISO KRAS (Homo sapiens) 6480464 [lead acetate co-treated with zinc protoporphyrin] results in decreased expression of KRAS mRNA CTD PMID:22839698 Kras Rat zoledronic acid increases expression ISO KRAS (Homo sapiens) 6480464 zoledronic acid results in increased expression of KRAS protein CTD PMID:28871336
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
Acute Experimental Pancreatitis (IEP) acute lymphoblastic leukemia (ISO) acute myeloid leukemia (ISO) adenocarcinoma (ISO) adenoma (ISO) anaplastic astrocytoma (ISO) anemia (ISO) angiosarcoma (ISO) Animal Disease Models (ISO) arteriovenous malformations of the brain (ISO,ISS) autoimmune lymphoproliferative syndrome type 4 (ISO) breast adenocarcinoma (ISO) breast cancer (ISO) Breast Cancer, Familial (ISO) Breast Neoplasms (ISO) bronchiolo-alveolar adenocarcinoma (IMP) Capillary Malformation-Arteriovenous Malformation 1 (ISO) Carcinogenesis (ISO) carcinoma (ISO) cardiofaciocutaneous syndrome (ISO) cardiofaciocutaneous syndrome 1 (ISO) cardiofaciocutaneous syndrome 2 (ISO) cardiomyopathy (ISO) Cecal Neoplasms (ISO) cholangiocarcinoma (ISO) chronic myelogenous leukemia, BCR-ABL1 positive (ISO) Colonic Neoplasms (ISO) colorectal cancer (ISO) Colorectal Neoplasms (ISO) Costello syndrome (ISO) dilated cardiomyopathy (ISO) disease of cellular proliferation (ISO) Disease Progression (ISO) Encephalocraniocutaneous Lipomatosis (ISO) endometrial adenocarcinoma (IAGP) endometrial carcinoma (ISO) endometrial hyperplasia (ISO) Endometrial Hyperplasia without Atypia (ISO) Endometrial Intraepithelial Neoplasia (ISO) Endometrial Neoplasms (ISO) Endometrioid Carcinomas (ISO) endometriosis (ISO,ISS) epidermal nevus (ISO) Experimental Liver Neoplasms (IEP,ISO) Experimental Neoplasms (ISO) Experimental Sarcoma (IAGP) Familial Pancreatic Carcinoma (ISO) fibrillary astrocytoma (ISO) follicular thyroid carcinoma (ISO) gallbladder cancer (ISO) Gallbladder Neoplasms (ISO) gastrointestinal stromal tumor (ISO) genetic disease (ISO) glioblastoma (ISO) hepatocellular adenoma (IAGP) hepatocellular carcinoma (IAGP,ISO) hereditary breast ovarian cancer syndrome (ISO) hereditary diffuse gastric cancer (ISO) high grade glioma (ISO) Hodgkin's lymphoma (ISO) Hydrops Fetalis (ISO) hypertension (ISO) intellectual disability (ISO) intrahepatic cholangiocarcinoma (ISO,ISS) juvenile myelomonocytic leukemia (ISO,ISS) juvenile rheumatoid arthritis (ISO) Kidney Neoplasms (IDA) Klatskin's tumor (ISO) Leukocytosis (ISO) linear nevus sebaceous syndrome (ISO) Liver Neoplasms (ISO) lung adenocarcinoma (ISO) lung cancer (ISO,ISS) lung carcinoma (ISO) Lung Neoplasms (ISO) lung non-small cell carcinoma (ISO) Lung Reperfusion Injury (ISO) lung sarcomatoid carcinoma (ISO) lung squamous cell carcinoma (ISO) lymphoma (ISO) Lynch syndrome (ISO) malignant astrocytoma (ISO) Mouth Neoplasms (ISO) Multiple Abnormalities (ISO) multiple myeloma (ISO) muscular atrophy (IEP) myelodysplastic syndrome (ISO) myeloid neoplasm (ISO) myeloid sarcoma (ISO) Neoplasm Metastasis (ISO) Neoplastic Cell Transformation (ISO) neuroblastoma (ISO) Noonan syndrome (ISO) Noonan syndrome 1 (ISO) Noonan syndrome 3 (ISO,ISS) oculoectodermal syndrome (ISO) Ovarian Neoplasms (ISO) ovary serous adenocarcinoma (ISO) pancreatic cancer (ISO) pancreatic carcinoma (ISO,ISS) pancreatic ductal carcinoma (ISO) pancreatic mucinous cystadenoma (ISO) Paraproteinemias (ISO) Parasitic Liver Diseases (ISO) Penile Neoplasms (ISO) pilocytic astrocytoma (ISO) plasma cell neoplasm (ISO) prostate cancer (ISS) Prostate Cancer, Hereditary, 1 (ISO) prostate carcinoma in situ (ISO) Prostatic Neoplasms (ISO) RASopathy (ISO) Recurrence (ISO) renal cell carcinoma (ISO) renal fibrosis (IMP) Sebaceous Nevus Syndrome and Hemimegalencephaly (ISO) seminoma (ISO) Splenomegaly (ISO) squamous cell carcinoma (ISO) stomach cancer (ISO) stomach carcinoma (ISO) Stomach Neoplasms (ISO) T-cell acute lymphoblastic leukemia (ISO) teratoma (ISO) Thyroid Carcinoma, Nonmedullary 1 (ISO) Thyroid Neoplasms (ISO) transitional cell carcinoma (ISO) Triple Negative Breast Neoplasms (ISO) urinary bladder cancer (ISO) Urinary Bladder Neoplasm (ISO) Uterine Cervical Neoplasms (ISO) Uterine Neoplasms (ISO) Vascular Malformations (ISO)
(S)-colchicine (ISO) (S)-naringenin (ISO) (trichloromethyl)benzene (ISO) 1,1-dichloroethene (ISO) 1,2-dimethylhydrazine (ISO) 1-nitropyrene (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (ISO) 2,2-Bis(bromomethyl)propane-1,3-diol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2,6-di-tert-butyl-4-methylphenol (ISO) 2,6-dimethoxyphenol (ISO) 2-trans,6-trans-farnesyl diphosphate (EXP) 3-methyl-3H-imidazo[4,5-f]quinolin-2-amine (EXP) 3-methylcholanthrene (ISO) 4,4'-sulfonyldiphenol (ISO) 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (EXP,ISO) 4-nitrophenol (ISO) 4-vinylcyclohexene dioxide (ISO) 5-aza-2'-deoxycytidine (ISO) 5-fluorouracil (ISO) 5-Methylchrysene (ISO) acrolein (ISO) actinomycin D (ISO) afimoxifene (ISO) ammonium chloride (EXP) amphetamine (EXP) antirheumatic drug (ISO) Antrocin (ISO) aristolochic acid A (EXP,ISO) Aroclor 1254 (ISO) ARS-1620 (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) asbestos (ISO) Azoxymethane (EXP,ISO) Benz[j]aceanthrylene (ISO) benzene (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) benzo[b]fluoranthene (ISO) bisphenol A (EXP,ISO) bleomycin A2 (ISO) buta-1,3-diene (ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) cannabidiol (EXP,ISO) carbamazepine (ISO) carbon nanotube (ISO) ceruletide (ISO) CGP 52608 (ISO) chloroethene (ISO) chloroprene (ISO) chlorpyrifos (EXP) chymostatin (ISO) cisplatin (ISO) clofibrate (ISO) cobalt atom (EXP,ISO) cobimetinib (ISO) copper atom (EXP,ISO) copper(0) (EXP,ISO) coumestrol (ISO) crizotinib (ISO) cumene (ISO) Cuprizon (EXP) curcumin (ISO) cycloheximide (ISO) Cyclopenta[cd]pyrene (ISO) dabrafenib (ISO) dextran sulfate (ISO) dibenzo[a,l]pyrene (ISO) Dibutyl phosphate (ISO) dichlorine (EXP) diclofenac (ISO) dioxygen (ISO) dorsomorphin (ISO) doxorubicin (ISO) emamectin benzoate (ISO) erlotinib hydrochloride (ISO) ethanol (ISO) farnesyl diphosphate (EXP) flutamide (EXP) folic acid (ISO) furfural (ISO) GDP (ISO) gefitinib (ISO) genistein (ISO) gentamycin (EXP) geraniol (EXP) GTP (ISO) guanosine (ISO) haloperidol (EXP) hydrogen peroxide (ISO) hydroquinone (ISO) hydroxyurea (ISO) ionomycin (ISO) irbesartan (ISO) isoprenaline (ISO) isoprene (ISO) isotretinoin (ISO) ivermectin (ISO) kainic acid (EXP) L-744832 (ISO) lapatinib (ISO) lead diacetate (ISO) lead(0) (ISO) lipopolysaccharide (ISO) losartan (ISO) lovastatin (ISO) luzindole (ISO) manumycin A (ISO) MeIQx (EXP) mercury dibromide (ISO) metformin (ISO) methohexital (ISO) methotrexate (ISO) metyrapone (EXP) monosodium L-glutamate (EXP) Morindone (ISO) N,N-bis(2-hydroxypropyl)nitrosamine (EXP) N-acetyl-L-cysteine (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) N-ethyl-N-nitrosourea (ISO) N-methyl-N'-nitro-N-nitrosoguanidine (EXP) N-methyl-N-nitrosourea (EXP,ISO) N-nitrosodiethylamine (EXP,ISO) N-nitrosodimethylamine (ISO) nicotinic acid (ISO) nitrates (ISO) ochratoxin A (ISO) oncrasin-1 (ISO) oxirane (ISO) oxybenzone (ISO) ozone (EXP,ISO) p-chloromercuribenzoic acid (ISO) paclitaxel (ISO) paracetamol (ISO) PD 0325901 (ISO) pemetrexed (ISO) pentobarbital (ISO) phlorizin (ISO) phorbol 13-acetate 12-myristate (ISO) picrotoxin (EXP) piperonyl butoxide (ISO) pirinixic acid (ISO) quercetin (ISO) Rebamipide (EXP) resveratrol (ISO) riddelliine (ISO) sarin (EXP) SB 431542 (ISO) secobarbital (ISO) selumetinib (ISO) sevoflurane (ISO) simvastatin (ISO) sodium arsenite (EXP,ISO) sodium chloride (ISO) Soman (EXP) sotorasib (ISO) styrene (ISO) sulfur dioxide (EXP) sulindac (ISO) sunitinib (ISO) tacrolimus hydrate (ISO) Tanshinone I (ISO) Temsirolimus (ISO) testosterone enanthate (ISO) tetrachloromethane (EXP,ISO) Tetranitromethane (ISO) thiamylal (ISO) thimerosal (ISO) thioacetamide (EXP) tiazofurine (ISO) tipifarnib (EXP) titanium dioxide (ISO) toluene (EXP) trimetrexate (ISO) Triptolide (EXP) triptonide (ISO) urethane (EXP,ISO) ursodeoxycholic acid (EXP) valproic acid (ISO) vemurafenib (ISO) vinyl carbamate (ISO) zearalenone (ISO) zidovudine (ISO) zinc protoporphyrin (ISO) zoledronic acid (ISO)
Biological Process
actin cytoskeleton organization (IEA,ISO) cardiac muscle cell proliferation (IEP) cell population proliferation (IEA,ISO) cytokine-mediated signaling pathway (IMP) epithelial tube branching involved in lung morphogenesis (IEA,ISO) female pregnancy (IEP) forebrain astrocyte development (IEA,ISO) gene expression (IEA,ISO) glial cell proliferation (IEA,ISO) homeostasis of number of cells within a tissue (IEA,ISO) liver development (IEP) myoblast proliferation (IEP) negative regulation of epithelial cell differentiation (IEA,ISO) negative regulation of neuron apoptotic process (IEA,ISO) neuron apoptotic process (IEA,ISO) positive regulation of cellular senescence (IMP) positive regulation of endothelial cell proliferation (IEA) positive regulation of gene expression (IEA,ISO) positive regulation of glial cell proliferation (IEA,ISO) positive regulation of MAP kinase activity (IMP) positive regulation of NF-kappaB transcription factor activity (IMP) positive regulation of nitric-oxide synthase activity (IMP) positive regulation of Rac protein signal transduction (IEA,ISO) Rac protein signal transduction (IEA,ISO) Ras protein signal transduction (IBA,IEA,ISO) regulation of long-term neuronal synaptic plasticity (IEA,ISO) regulation of synaptic transmission, GABAergic (IEA,ISO) response to glucocorticoid (IEP) response to gravity (IEP) response to isolation stress (IEP) response to mineralocorticoid (IEP) signal transduction (IEA) skeletal muscle cell differentiation (IEA,ISO) striated muscle cell differentiation (IEA,ISO) type I pneumocyte differentiation (IEA,ISO) visual learning (IEA,ISO)
1.
GFAP-Cre-mediated activation of oncogenic K-ras results in expansion of the subventricular zone and infiltrating glioma.
Abel TW, etal., Mol Cancer Res. 2009 May;7(5):645-53. doi: 10.1158/1541-7786.MCR-08-0477. Epub 2009 May 12.
2.
Cigarette smoking is strongly associated with mutation of the K-ras gene in patients with primary adenocarcinoma of the lung.
Ahrendt SA, etal., Cancer. 2001 Sep 15;92(6):1525-30.
3.
Association in the expression of Kirsten-ras oncogene and the major histocompatibility complex class I antigens in fibrosarcoma tumor cell variants exhibiting different metastatic capabilities.
Alon Y, etal., Cancer Res. 1987 May 15;47(10):2553-7.
4.
The molecular biology of endometrial cancers and the implications for pathogenesis, classification, and targeted therapies.
Bansal N, etal., Cancer Control. 2009 Jan;16(1):8-13.
5.
Mutational and nonmutational activation of p21ras in rat colonic azoxymethane-induced tumors: effects on mitogen-activated protein kinase, cyclooxygenase-2, and cyclin D1.
Bissonnette M, etal., Cancer Res. 2000 Aug 15;60(16):4602-9.
6.
Biochemical characterization of a novel KRAS insertion mutation from a human leukemia.
Bollag G, etal., J Biol Chem. 1996 Dec 20;271(51):32491-4.
7.
Activation of RAS family genes in urothelial carcinoma.
Boulalas I, etal., J Urol. 2009 May;181(5):2312-9. Epub 2009 Mar 19.
8.
Mammalian K-ras2 is a corticosteroid-induced gene in vivo.
Brennan FE and Fuller PJ, Endocrinology. 2006 Jun;147(6):2809-16. Epub 2006 Mar 16.
9.
Long noncoding RNA H19 mediates melatonin inhibition of premature senescence of c-kit(+) cardiac progenitor cells by promoting miR-675.
Cai B, etal., J Pineal Res. 2016 Aug;61(1):82-95. doi: 10.1111/jpi.12331. Epub 2016 Apr 29.
10.
K-ras codon 12 and 61 point mutations in bromodeoxyuridine- and N-nitrosomethylurea-induced rat renal mesenchymal tumors.
Calvert RJ, etal., Cancer Lett. 1996 Dec 3;109(1-2):1-7.
11.
The degradation of cell cycle regulators by SKP2/CKS1 ubiquitin ligase is genetically controlled in rodent liver cancer and contributes to determine the susceptibility to the disease.
Calvisi DF, etal., Int J Cancer. 2009 Jun 16.
12.
ZFP36 protects lungs from intestinal I/R-induced injury and fibrosis through the CREBBP/p53/p21/Bax pathway.
Cao Y, etal., Cell Death Dis. 2021 Jul 8;12(7):685. doi: 10.1038/s41419-021-03950-y.
13.
Mutant KRAS, chromosomal instability and prognosis in colorectal cancer.
Castagnola P and Giaretti W, Biochim Biophys Acta. 2005 Nov 25;1756(2):115-25. Epub 2005 Jul 13.
14.
Expression of c-Ki-ras in developing rat liver.
Chan SO, etal., Comp Biochem Physiol B. 1992 May;102(1):111-7.
15.
Mutational analysis of KRAS, BRAF, and TP53 genes of ovarian serous carcinomas in Korean women.
Cho YH, etal., Yonsei Med J. 2009 Apr 30;50(2):266-72.
16.
Proto-oncogene expression in proliferating and differentiating cardiac and skeletal muscle.
Claycomb WC and Lanson NA, Biochem J. 1987 Nov 1;247(3):701-6. doi: 10.1042/bj2470701.
17.
Myocardial KRAS(G12D) expression does not cause cardiomyopathy in mice.
Dalin MG, etal., Cardiovasc Res. 2014 Feb 1;101(2):229-35. doi: 10.1093/cvr/cvt260. Epub 2013 Nov 20.
18.
Wild type Kirsten rat sarcoma is a novel microRNA-622-regulated therapeutic target for hepatocellular carcinoma and contributes to sorafenib resistance.
Dietrich P, etal., Gut. 2018 Jul;67(7):1328-1341. doi: 10.1136/gutjnl-2017-315402. Epub 2017 Dec 23.
19.
Mutations of the KRAS oncogene in endometrial hyperplasia and carcinoma.
Dobrzycka B, etal., Folia Histochem Cytobiol. 2009;47(1):65-8.
20.
Circulating free DNA, p53 antibody and mutations of KRAS gene in endometrial cancer.
Dobrzycka B, etal., Int J Cancer. 2009 Dec 3.
21.
MiR-193a-3p is an Important Tumour Suppressor in Lung Cancer and Directly Targets KRAS.
Fan Q, etal., Cell Physiol Biochem. 2017;44(4):1311-1324. doi: 10.1159/000485491. Epub 2017 Nov 29.
22.
Comprehensive analysis of genomic alterations of Chinese hilar cholangiocarcinoma patients.
Feng F, etal., Int J Clin Oncol. 2021 Apr;26(4):717-727. doi: 10.1007/s10147-020-01846-z. Epub 2021 Jan 2.
23.
Involvement of Gpr125 in the myeloid sarcoma formation induced by cooperating MLL/AF10(OM-LZ) and oncogenic KRAS in a mouse bone marrow transplantation model.
Fu JF, etal., Int J Cancer. 2013 Oct 15;133(8):1792-802. doi: 10.1002/ijc.28195. Epub 2013 May 7.
24.
Mucinous cystic neoplasms of the liver and pancreas: relationship between KRAS driver mutations and disease progression.
Fujikura K, etal., Histopathology. 2017 Oct;71(4):591-600. doi: 10.1111/his.13271. Epub 2017 Aug 2.
25.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
26.
Pathogenetic pathways in ovarian endometrioid adenocarcinoma: a molecular study of 29 cases.
Geyer JT, etal., Am J Surg Pathol. 2009 Aug;33(8):1157-63.
27.
TP53 and KRAS2 mutations in plasma DNA of healthy subjects and subsequent cancer occurrence: a prospective study.
Gormally E, etal., Cancer Res. 2006 Jul 1;66(13):6871-6.
28.
Detection of a rare point mutation in Ki-ras of a human bladder cancer xenograft by polymerase chain reaction and direct sequencing.
Grimmond SM, etal., Urol Res. 1992;20(2):121-6.
29.
The inv(3)(q21q26)/t(3;3)(q21;q26) is frequently accompanied by alterations of the RUNX1, KRAS and NRAS and NF1 genes and mediates adverse prognosis both in MDS and in AML: a study in 39 cases of MDS or AML.
Haferlach C, etal., Leukemia. 2011 May;25(5):874-7. doi: 10.1038/leu.2011.5. Epub 2011 Feb 1.
30.
K-RasV14I recapitulates Noonan syndrome in mice.
Hernandez-Porras I, etal., Proc Natl Acad Sci U S A. 2014 Nov 18;111(46):16395-400. doi: 10.1073/pnas.1418126111. Epub 2014 Oct 30.
31.
Activation of the K-ras gene by insertion mutations in chemically induced rat renal mesenchymal tumors.
Higinbotham KG, etal., Oncogene 1994 Sep;9(9):2455-9.
32.
Essential role for Ras signaling in glioblastoma maintenance.
Holmen SL and Williams BO, Cancer Res. 2005 Sep 15;65(18):8250-5. doi: 10.1158/0008-5472.CAN-05-1173.
33.
Kras, Egfr, and Tp53 Mutations in B6C3F1/N Mouse and F344/NTac Rat Alveolar/Bronchiolar Carcinomas Resulting from Chronic Inhalation Exposure to Cobalt Metal.
Hong HH, etal., Toxicol Pathol. 2015 Aug;43(6):872-82. doi: 10.1177/0192623315581192. Epub 2015 Jun 9.
34.
Opposite regulation of hepatic lipase and lecithin: cholesterol acyltransferase by glucocorticoids in rats.
Jansen H, etal., Biochim Biophys Acta. 1992 Oct 30;1128(2-3):181-5.
35.
Core signaling pathways in human pancreatic cancers revealed by global genomic analyses.
Jones S, etal., Science. 2008 Sep 26;321(5897):1801-6. Epub 2008 Sep 4.
36.
Higher expression of K-ras is associated with parathyroid hormone-related protein-induced hypercalcaemia in renal cell carcinoma.
Kamai T, etal., BJU Int. 2001 Dec;88(9):960-6.
37.
Notch1 gene mutations target KRAS G12D-expressing CD8+ cells and contribute to their leukemogenic transformation.
Kong G, etal., J Biol Chem. 2013 Jun 21;288(25):18219-27. doi: 10.1074/jbc.M113.475376. Epub 2013 May 14.
38.
The human c-Kirsten ras gene is activated by a novel mutation in codon 13 in the breast carcinoma cell line MDA-MB231.
Kozma SC, etal., Nucleic Acids Res. 1987 Aug 11;15(15):5963-71.
39.
KRAS Status as an Independent Prognostic Factor for Survival after Yttrium-90 Radioembolization Therapy for Unresectable Colorectal Cancer Liver Metastases.
Lahti SJ, etal., J Vasc Interv Radiol. 2015 Aug;26(8):1102-11. doi: 10.1016/j.jvir.2015.05.032.
40.
Clinicopathologic significance of the K-ras gene codon 12 point mutation in stomach cancer. An analysis of 140 cases.
Lee KH, etal., Cancer. 1995 Jun 15;75(12):2794-801.
41.
Differential expression of protooncogenes related to transformation and cancer progression in rat myoblasts.
Leibovitch SA, etal., Cancer Res. 1986 Aug;46(8):4097-103.
42.
Detection of KRAS mutations and their associations with clinicopathological features and survival in Chinese colorectal cancer patients.
Li Z, etal., J Int Med Res. 2012;40(4):1589-98. doi: 10.1177/147323001204000439.
43.
TSC1 loss synergizes with KRAS activation in lung cancer development in the mouse and confers rapamycin sensitivity.
Liang MC, etal., Oncogene. 2010 Mar 18;29(11):1588-97. doi: 10.1038/onc.2009.452. Epub 2009 Dec 7.
44.
Down-regulation of K-ras and H-ras in human brain gliomas.
Lymbouridou R, etal., Eur J Cancer. 2009 May;45(7):1294-303. doi: 10.1016/j.ejca.2008.12.028. Epub 2009 Jan 27.
45.
A MEK inhibitor abrogates myeloproliferative disease in Kras mutant mice.
Lyubynska N, etal., Sci Transl Med. 2011 Mar 30;3(76):76ra27. doi: 10.1126/scitranslmed.3001069.
46.
Frameshift mutational target gene analysis identifies similarities and differences in constitutional mismatch repair-deficiency and Lynch syndrome.
Maletzki C, etal., Mol Carcinog. 2017 Jul;56(7):1753-1764. doi: 10.1002/mc.22632. Epub 2017 Mar 30.
47.
KRAS and CREBBP mutations: a relapse-linked malicious liaison in childhood high hyperdiploid acute lymphoblastic leukemia.
Malinowska-Ozdowy K, etal., Leukemia. 2015 Aug;29(8):1656-67. doi: 10.1038/leu.2015.107. Epub 2015 Apr 28.
48.
Transcriptional activation of H- and N-ras oncogenes in human cervical cancer.
Mammas IN, etal., Gynecol Oncol. 2004 Mar;92(3):941-8.
49.
Activating KRAS mutation is prognostic only among patients who receive preoperative chemotherapy before resection of colorectal liver metastases.
Margonis GA, etal., J Surg Oncol. 2016 Sep;114(3):361-7. doi: 10.1002/jso.24319. Epub 2016 Jun 6.
50.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
51.
Cross-talk between aldosterone and angiotensin II in vascular smooth muscle cell senescence.
Min LJ, etal., Cardiovasc Res. 2007 Dec 1;76(3):506-16. Epub 2007 Jul 24.
52.
Loss of p53 cooperates with K-ras activation to induce glioma formation in a region-independent manner.
Muñoz DM, etal., Glia. 2013 Nov;61(11):1862-72. doi: 10.1002/glia.22563. Epub 2013 Aug 30.
53.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
54.
Germline KRAS and BRAF mutations in cardio-facio-cutaneous syndrome.
Niihori T, etal., Nat Genet. 2006 Mar;38(3):294-6. Epub 2006 Feb 12.
55.
K-ras point mutation in the nerve plexuses around the superior mesenteric artery in resectable adenocarcinoma of the pancreatic head: distribution pattern and related factors.
Ohigashi H, etal., Arch Surg. 2000 Dec;135(12):1450-5.
56.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
57.
N-RAS and K-RAS gene mutations in Brazilian patients with multiple myeloma.
Ortega MM, etal., Leuk Lymphoma. 2006 Feb;47(2):285-9.
58.
The prevalence and prognostic significance of KRAS mutation in bladder cancer, chronic myeloid leukemia and colorectal cancer.
Ouerhani S, etal., Mol Biol Rep. 2013 Jun;40(6):4109-14. doi: 10.1007/s11033-013-2512-8. Epub 2013 May 3.
59.
Ovarian expression of cellular Ki-ras p21 varies with physiological status.
Palejwala S and Goldsmith LT, Proc Natl Acad Sci U S A. 1992 May 1;89(9):4202-6.
60.
Mutations of FLT3, NRAS, KRAS, and PTPN11 are frequent and possibly mutually exclusive in high hyperdiploid childhood acute lymphoblastic leukemia.
Paulsson K, etal., Genes Chromosomes Cancer. 2008 Jan;47(1):26-33.
61.
K-ras and Wnt signaling synergize to accelerate prostate tumorigenesis in the mouse.
Pearson HB, etal., Cancer Res. 2009 Jan 1;69(1):94-101.
62.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
63.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
64.
Replacement of K-Ras with H-Ras supports normal embryonic development despite inducing cardiovascular pathology in adult mice.
Potenza N, etal., EMBO Rep. 2005 May;6(5):432-7.
65.
Primary mediastinal and testicular seminomas: a comparison of K-ras-2 gene sequence and p53 immunoperoxidase analysis of 26 cases.
Przygodzki RM, etal., Hum Pathol. 1996 Sep;27(9):975-9.
66.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
67.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
68.
The frequency of KRAS and BRAF mutations in intrahepatic cholangiocarcinomas and their correlation with clinical outcome.
Robertson S, etal., Hum Pathol. 2013 Dec;44(12):2768-73. doi: 10.1016/j.humpath.2013.07.026. Epub 2013 Oct 15.
69.
MEK1/2 dual-specificity protein kinases: Structure and regulation.
Roskoski R Jr Biochem Biophys Res Commun. 2012 Jan 6;417(1):5-10. Epub 2011 Dec 8.
70.
Somatic mutations of signaling genes in non-small-cell lung cancer.
Sanders HR and Albitar M, Cancer Genet Cytogenet. 2010 Nov;203(1):7-15.
71.
Increases in Ki-ras and ornithine decarboxylase gene expression in rat pancreas after caerulein-induced pancreatitis.
Sarfati P, etal., Digestion. 1996 Nov-Dec;57(6):453-63.
72.
Resveratrol prevents tumorigenesis in mouse model of Kras activated sporadic colorectal cancer by suppressing oncogenic Kras expression.
Saud SM, etal., Carcinogenesis. 2014 Dec;35(12):2778-86. doi: 10.1093/carcin/bgu209. Epub 2014 Oct 3.
73.
Germline KRAS mutations cause Noonan syndrome.
Schubbert S, etal., Nat Genet. 2006 Mar;38(3):331-6. Epub 2006 Feb 12.
74.
The ALPPS Approach for Colorectal Liver Metastases: Impact of KRAS Mutation Status in Survival.
Serenari M, etal., Dig Surg. 2018;35(4):303-310. doi: 10.1159/000471930. Epub 2017 Oct 14.
75.
RAS pathway activation and an oncogenic RAS mutation in sporadic pilocytic astrocytoma.
Sharma MK, etal., Neurology. 2005 Oct 25;65(8):1335-6.
76.
Suprachiasmatic nucleus circadian oscillatory protein, a novel binding partner of K-Ras in the membrane rafts, negatively regulates MAPK pathway.
Shimizu K, etal., J Biol Chem. 2003 Apr 25;278(17):14920-5. Epub 2003 Feb 19.
77.
Activation of the c-Ki-ras oncogene in aflatoxin B1-induced hepatocellular carcinoma and adenoma in the rat: detection by denaturing gradient gel electrophoresis.
Soman NR and Wogan GN, Proc Natl Acad Sci U S A. 1993 Mar 1;90(5):2045-9.
78.
Aldosterone stimulates proliferation of cardiac fibroblasts by activating Ki-RasA and MAPK1/2 signaling.
Stockand JD and Meszaros JG, Am J Physiol Heart Circ Physiol 2003 Jan;284(1):H176-84.
79.
Transfection of K-rasAsp12 cDNA markedly elevates IL-1beta- and lipopolysaccharide-mediated inducible nitric oxide synthase expression in rat intestinal epithelial cells.
Takahashi M, etal., Oncogene. 2003 Oct 23;22(48):7667-76.
80.
K-ras point mutations in spontaneously occurring endometrial adenocarcinomas in the Donryu rat.
Tanoguchi K, etal., Tohoku J Exp Med. 1999 Oct;189(2):87-93.
81.
Alteration of gene expression profiles in skeletal muscle of rats exposed to microgravity during a spaceflight.
Taylor WE, etal., J Gravit Physiol. 2002 Dec;9(2):61-70.
82.
Monitoring of endometrial K-ras mutation in tamoxifen-treated patients with breast cancer.
Tsujioka H, etal., Int J Gynecol Cancer. 2009 Aug;19(6):1052-6.
83.
ACAT inhibition reverses LCAT deficiency and improves plasma HDL in chronic renal failure.
Vaziri ND and Liang K, Am J Physiol Renal Physiol. 2004 Nov;287(5):F1038-43. Epub 2004 Jul 27.
84.
Ras gene mutations in 7,12-dimethylbenzanthracene (DMBA)-induced rat sarcomas.
Walentinsson A and Levan G, Cancer Lett. 2001 May 10;166(1):47-53.
85.
Antisense knockdown of Kras inhibits fibrosis in a rat model of unilateral ureteric obstruction.
Wang JH, etal., Am J Pathol. 2012 Jan;180(1):82-90. doi: 10.1016/j.ajpath.2011.09.036. Epub 2011 Nov 7.
86.
MiR-181d acts as a tumor suppressor in glioma by targeting K-ras and Bcl-2.
Wang XF, etal., J Cancer Res Clin Oncol. 2012 Apr;138(4):573-84. doi: 10.1007/s00432-011-1114-x. Epub 2011 Dec 30.
87.
Regulator of G-protein signaling 14 (RGS14) is a selective H-Ras effector.
Willard FS, etal., PLoS One. 2009;4(3):e4884. doi: 10.1371/journal.pone.0004884. Epub 2009 Mar 25.
88.
Pancreatic cancer: molecular pathogenesis and new therapeutic targets.
Wong HH and Lemoine NR, Nat Rev Gastroenterol Hepatol. 2009 Jul;6(7):412-22. Epub 2009 Jun 9.
89.
Elevated Orai1 and STIM1 expressions upregulate MACC1 expression to promote tumor cell proliferation, metabolism, migration, and invasion in human gastric cancer.
Xia J, etal., Cancer Lett. 2016 Oct 10;381(1):31-40. doi: 10.1016/j.canlet.2016.07.014. Epub 2016 Jul 16.
90.
Expansion of the genotypic and phenotypic spectrum in patients with KRAS germline mutations.
Zenker M, etal., J Med Genet. 2007 Feb;44(2):131-5. Epub 2006 Oct 20.
91.
Social isolation in rats inhibits oxidative metabolism, decreases the content of mitochondrial K-Ras and activates mitochondrial hexokinase.
Zhuravliova E, etal., Behav Brain Res. 2009 Dec 28;205(2):377-83. Epub 2009 Jul 16.
Kras Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 179,916,255 - 179,949,613 (-) NCBI GRCr8 mRatBN7.2 4 178,185,418 - 178,218,484 (-) NCBI mRatBN7.2 mRatBN7.2 UTH_Rnor_SHR_Utx 4 184,490,327 - 184,516,219 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 180,274,827 - 180,300,720 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 178,895,248 - 178,921,140 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 179,482,562 - 179,515,483 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 179,486,105 - 179,515,558 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 243,667,912 - 243,696,325 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 182,869,242 - 182,895,106 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 183,114,365 - 183,140,230 (-) NCBI Celera 4 166,708,846 - 166,734,692 (-) NCBI Celera Cytogenetic Map 4 q44 NCBI
KRAS Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 25,205,246 - 25,250,929 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 25,205,246 - 25,250,936 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 25,358,180 - 25,403,863 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 25,249,447 - 25,295,121 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 25,249,446 - 25,295,121 NCBI Celera 12 30,505,144 - 30,550,804 (-) NCBI Celera Cytogenetic Map 12 p12.1 NCBI HuRef 12 25,128,895 - 25,174,493 (-) NCBI HuRef CHM1_1 12 25,323,336 - 25,368,979 (-) NCBI CHM1_1 T2T-CHM13v2.0 12 25,076,496 - 25,122,152 (-) NCBI T2T-CHM13v2.0
Kras Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 145,162,425 - 145,197,631 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 145,162,425 - 145,195,965 (-) Ensembl GRCm39 Ensembl GRCm38 6 145,216,699 - 145,250,420 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 145,216,699 - 145,250,239 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 145,165,219 - 145,198,751 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 145,173,866 - 145,207,390 (-) NCBI MGSCv36 mm8 Celera 6 148,290,985 - 148,324,546 (-) NCBI Celera Cytogenetic Map 6 G3 NCBI cM Map 6 77.37 NCBI
Kras Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955413 20,298,824 - 20,328,758 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955413 20,298,852 - 20,328,756 (-) NCBI ChiLan1.0 ChiLan1.0
KRAS Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 71,565,722 - 71,611,563 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 71,562,118 - 71,607,959 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 61,062,689 - 61,108,524 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 63,679,293 - 63,724,335 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 63,679,293 - 63,724,335 (+) Ensembl panpan1.1 panPan2
KRAS Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 27 22,261,753 - 22,296,704 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 27 22,257,941 - 22,293,369 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 27 24,078,345 - 24,117,288 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 27 22,456,489 - 22,495,435 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 27 22,456,012 - 22,495,428 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 27 22,271,689 - 22,310,648 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 27 22,290,777 - 22,329,504 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 27 24,245,249 - 24,284,170 (-) NCBI UU_Cfam_GSD_1.0
Kras Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 84,156,600 - 84,190,995 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936548 2,079,036 - 2,110,523 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936548 2,078,568 - 2,113,877 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
KRAS Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 48,508,811 - 48,549,358 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 48,508,774 - 48,546,260 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 52,229,592 - 52,270,153 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
KRAS Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 11 24,963,396 - 25,010,747 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 11 24,973,619 - 25,005,191 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666069 10,116,447 - 10,163,816 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Kras
.
Predicted Target Of
Count of predictions: 167 Count of miRNA genes: 128 Interacting mature miRNAs: 144 Transcripts: ENSRNOT00000012588, ENSRNOT00000012887 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
6478754 Anxrr43 Anxiety related response QTL 43 0.14035 locomotor behavior trait (VT:0001392) distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493) 4 144639524 182687754 Rat 2303623 Vencon2 Ventilatory control QTL 2 3.8 respiration trait (VT:0001943) minute ventilation (CMO:0000132) 4 135204660 180204660 Rat 6478693 Anxrr32 Anxiety related response QTL 32 0.00092 locomotor behavior trait (VT:0001392) measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957) 4 144639524 182687754 Rat 1578674 Bmd12 Bone mineral density QTL 12 3.8 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 4 135699135 180699135 Rat 1331738 Bp209 Blood pressure QTL 209 2.979 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 138503169 179293946 Rat 6478700 Anxrr33 Anxiety related response QTL 33 0.00896 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 144639524 182687754 Rat 10053718 Scort25 Serum corticosterone level QTL 25 2.15 0.0097 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 155561574 182687754 Rat 2293659 Bmd35 Bone mineral density QTL 35 4.5 0.0001 femur strength trait (VT:0010010) femoral neck ultimate force (CMO:0001703) 4 137755016 181392681 Rat 10401796 Kidm48 Kidney mass QTL 48 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 4 145568712 182687754 Rat 6478718 Anxrr34 Anxiety related response QTL 34 0.00896 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 144639524 182687754 Rat 2316958 Gluco58 Glucose level QTL 58 10 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 11320076 180699135 Rat 6478748 Anxrr42 Anxiety related response QTL 42 0.28008 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 144639524 182687754 Rat 1300109 Rf13 Renal function QTL 13 3.91 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 4 157710145 182687754 Rat
RH140818
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 178,189,101 - 178,189,222 (+) MAPPER mRatBN7.2 Rnor_6.0 4 179,486,242 - 179,486,362 NCBI Rnor6.0 Rnor_5.0 4 243,667,546 - 243,667,666 UniSTS Rnor5.0 RGSC_v3.4 4 182,868,876 - 182,868,996 UniSTS RGSC3.4 Celera 4 166,708,480 - 166,708,600 UniSTS RH 3.4 Map 4 1066.7 UniSTS Cytogenetic Map 4 q44 UniSTS
AI598753
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 178,189,200 - 178,189,387 (+) MAPPER mRatBN7.2 Rnor_6.0 4 179,486,341 - 179,486,527 NCBI Rnor6.0 Rnor_5.0 4 243,667,645 - 243,667,831 UniSTS Rnor5.0 RGSC_v3.4 4 182,868,975 - 182,869,161 UniSTS RGSC3.4 Celera 4 166,708,579 - 166,708,765 UniSTS RH 3.4 Map 4 1064.2 UniSTS Cytogenetic Map 4 q44 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000012588 ⟹ ENSRNOP00000012588
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 4 179,491,129 - 179,512,471 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000012887 ⟹ ENSRNOP00000012887
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 4 179,486,105 - 179,515,558 (-) Ensembl
RefSeq Acc Id:
NM_031515 ⟹ NP_113703
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 179,920,305 - 179,946,170 (-) NCBI mRatBN7.2 4 178,189,468 - 178,215,334 (-) NCBI Rnor_6.0 4 179,486,608 - 179,512,471 (-) NCBI Rnor_5.0 4 243,667,912 - 243,696,325 (-) NCBI RGSC_v3.4 4 182,869,242 - 182,895,106 (-) RGD Celera 4 166,708,846 - 166,734,692 (-) RGD
Sequence:
ATGACTGAGTATAAACTTGTGGTAGTTGGAGCTGGTGGCGTAGGCAAGAGTGCCTTGACGATACAGCTAATTCAGAATCACTTTGTGGATGAATATGATCCTACGATAGAGGACTCCTACAGGAAACA
hide sequence
RefSeq Acc Id:
XM_017592443 ⟹ XP_017447932
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 179,920,327 - 179,948,731 (-) NCBI mRatBN7.2 4 178,189,541 - 178,217,881 (-) NCBI Rnor_6.0 4 179,486,739 - 179,515,064 (-) NCBI
Sequence:
GTCGCCGCCGAGTTCGCGACCGCTCCCCTCCCCCACGCCTGTAAGGGCTGTGACATTGCCGCGG
hide sequence
RefSeq Acc Id:
XM_039107022 ⟹ XP_038962950
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 179,920,327 - 179,949,613 (-) NCBI mRatBN7.2 4 178,189,541 - 178,218,455 (-) NCBI
RefSeq Acc Id:
XM_039107023 ⟹ XP_038962951
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 179,916,255 - 179,949,592 (-) NCBI mRatBN7.2 4 178,185,418 - 178,218,484 (-) NCBI
RefSeq Acc Id:
XM_063285523 ⟹ XP_063141593
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 179,916,255 - 179,948,663 (-) NCBI
RefSeq Acc Id:
NP_113703 ⟸ NM_031515
- UniProtKB:
A0JN17 (UniProtKB/TrEMBL), A0A8L2QIP9 (UniProtKB/TrEMBL)
- Sequence:
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTK
hide sequence
RefSeq Acc Id:
XP_017447932 ⟸ XM_017592443
- Peptide Label:
isoform X1
- UniProtKB:
P46203 (UniProtKB/Swiss-Prot), P97914 (UniProtKB/Swiss-Prot), P08644 (UniProtKB/Swiss-Prot), A0A8L2QIP9 (UniProtKB/TrEMBL)
- Sequence:
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEY
hide sequence
Ensembl Acc Id:
ENSRNOP00000012588 ⟸ ENSRNOT00000012588
Ensembl Acc Id:
ENSRNOP00000012887 ⟸ ENSRNOT00000012887
RefSeq Acc Id:
XP_038962951 ⟸ XM_039107023
- Peptide Label:
isoform X2
- UniProtKB:
A0JN17 (UniProtKB/TrEMBL), A0A8L2QIP9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038962950 ⟸ XM_039107022
- Peptide Label:
isoform X1
- UniProtKB:
P46203 (UniProtKB/Swiss-Prot), P08644 (UniProtKB/Swiss-Prot), P97914 (UniProtKB/Swiss-Prot), A0A8L2QIP9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063141593 ⟸ XM_063285523
- Peptide Label:
isoform X2
- UniProtKB:
A0JN17 (UniProtKB/TrEMBL), A0A8L2QIP9 (UniProtKB/TrEMBL)
RGD ID: 13693497 Promoter ID: EPDNEW_R4022 Type: multiple initiation site Name: Kras_1 Description: KRAS proto-oncogene, GTPase SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 4 179,515,609 - 179,515,669 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-08-25
Kras
KRAS proto-oncogene, GTPase
Kras
Kirsten rat sarcoma viral oncogene
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2016-04-20
Kras
Kirsten rat sarcoma viral oncogene
Kras
Kirsten rat sarcoma viral oncogene homolog
Name changed
629549 APPROVED
2016-04-20
Kras
Kirsten rat sarcoma viral oncogene homolog
Kras
Kirsten rat sarcoma viral oncogene
Name changed
629549 APPROVED
2013-07-18
Kras
Kirsten rat sarcoma viral oncogene
Kras
v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-30
Kras
v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog
Kras2
Kirsten rat sarcoma viral oncogene homologue 2 (active)
Symbol and Name updated
1299863 APPROVED
2002-06-10
Kras2
Kirsten rat sarcoma viral oncogene homologue 2 (active)
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_drugs
expression suppressed by sprionolactone, inhibitor of mineralocorticoid receptor (MR)
628557
gene_function
GTPase
628557
gene_pathway
active in a signalling cascade involving MAPK1/2
628557
gene_process
widely known activator of MAPK1/2 signalling cascade
628557
gene_regulation
expression significantly increased by aldosterone
628557
