Symbol:
Itpr3
Name:
inositol 1,4,5-trisphosphate receptor, type 3
RGD ID:
2934
Description:
Enables several functions, including alcohol binding activity; identical protein binding activity; and inositol 1,4,5-trisphosphate-gated calcium channel activity. Involved in G protein-coupled receptor signaling pathway; cellular response to cAMP; and positive regulation of cytosolic calcium ion concentration. Located in several cellular components, including apical plasma membrane; brush border; and nuclear outer membrane. Is active in endoplasmic reticulum membrane and presynapse. Human ortholog(s) of this gene implicated in Charcot-Marie-Tooth disease and type 1 diabetes mellitus. Orthologous to human ITPR3 (inositol 1,4,5-trisphosphate receptor type 3); PARTICIPATES IN calcium transport pathway; calcium/calcium-mediated signaling pathway; Alzheimer's disease pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3,3',4,4',5-pentachlorobiphenyl; 3-chloropropane-1,2-diol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
inositol 1, 4, 5-triphosphate receptor 3; inositol 1,4,5-triphosphate receptor 3; inositol 1,4,5-triphosphate receptor, type 3; inositol 1,4,5-trisphosphate receptor type 3; inositol 1,4,5-trisphosphate-gated calcium channel ITPR3; insP3R3; IP3 receptor; IP3R 3; IP3R-3; IP3R3; IP3R3X; type 3 inositol 1,4,5-trisphosphate receptor; type 3 InsP3 receptor
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ITPR3 (inositol 1,4,5-trisphosphate receptor type 3) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, Panther
Mus musculus (house mouse):
Itpr3 (inositol 1,4,5-triphosphate receptor 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Itpr3 (inositol 1,4,5-trisphosphate receptor type 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ITPR3 (inositol 1,4,5-trisphosphate receptor type 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ITPR3 (inositol 1,4,5-trisphosphate receptor type 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Itpr3 (inositol 1,4,5-trisphosphate receptor type 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ITPR3 (inositol 1,4,5-trisphosphate receptor type 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ITPR3 (inositol 1,4,5-trisphosphate receptor type 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Itpr3 (inositol 1,4,5-trisphosphate receptor type 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Itpr3 (inositol 1,4,5-triphosphate receptor 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
ITPR3 (inositol 1,4,5-trisphosphate receptor type 3)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
itpr3 (inositol 1,4,5-trisphosphate receptor, type 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
itr-1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Itp-r83A
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
itpr3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 5,138,553 - 5,204,189 (+) NCBI GRCr8 mRatBN7.2 20 5,136,968 - 5,202,339 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 5,136,441 - 5,202,337 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 5,862,755 - 5,927,561 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 5,224,499 - 5,289,310 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 5,702,534 - 5,768,607 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 5,645,894 - 5,711,702 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 5,646,097 - 5,711,702 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 7,711,508 - 7,775,357 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 5,292,430 - 5,357,502 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 5,292,656 - 5,357,727 (+) NCBI Celera 20 6,717,488 - 6,781,775 (+) NCBI Celera Cytogenetic Map 20 p12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Itpr3 Rat (1->4)-beta-D-glucan multiple interactions ISO RGD:10822 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of ITPR3 mRNA CTD PMID:36331819 Itpr3 Rat 1,1-dichloroethene increases expression ISO RGD:10822 6480464 vinylidene chloride results in increased expression of ITPR3 mRNA CTD PMID:26682919 Itpr3 Rat 17beta-estradiol decreases expression ISO RGD:10822 6480464 Estradiol results in decreased expression of ITPR3 mRNA CTD PMID:39298647 Itpr3 Rat 2,3',4,4',5-Pentachlorobiphenyl decreases expression ISO RGD:10822 6480464 2,3',4,4',5-pentachlorobiphenyl results in decreased expression of ITPR3 mRNA CTD PMID:31388691 Itpr3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:10822 6480464 Tetrachlorodibenzodioxin affects the expression of ITPR3 mRNA CTD PMID:21570461 Itpr3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of ITPR3 mRNA CTD PMID:34747641 Itpr3 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether increases expression ISO RGD:733997 6480464 2,2',4,4',5-brominated diphenyl ether results in increased expression of ITPR3 mRNA CTD PMID:26705709 Itpr3 Rat 2,6-dimethoxyphenol multiple interactions ISO RGD:733997 6480464 [pyrogallol 1,3-dimethyl ether co-treated with Furaldehyde] results in decreased expression of and affects the localization more ... CTD PMID:38598786 Itpr3 Rat 2-butoxyethanol decreases expression ISO RGD:10822 6480464 n-butoxyethanol results in decreased expression of ITPR3 mRNA CTD PMID:19812364 Itpr3 Rat 2-palmitoylglycerol increases expression ISO RGD:733997 6480464 2-palmitoylglycerol results in increased expression of ITPR3 mRNA CTD PMID:37199045 Itpr3 Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3,4,5,3',4'-pentachlorobiphenyl results in decreased expression of ITPR3 mRNA CTD PMID:23196670 Itpr3 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of ITPR3 protein CTD PMID:34915118 Itpr3 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RGD:733997 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Itpr3 Rat 4,4'-sulfonyldiphenol multiple interactions ISO RGD:733997 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 Itpr3 Rat 4,4'-sulfonyldiphenol affects methylation ISO RGD:10822 6480464 bisphenol S affects the methylation of ITPR3 gene CTD PMID:31683443 Itpr3 Rat 4,4'-sulfonyldiphenol decreases expression ISO RGD:10822 6480464 bisphenol S results in decreased expression of ITPR3 mRNA CTD PMID:39298647 Itpr3 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:10822 6480464 bisphenol S results in increased expression of ITPR3 mRNA CTD PMID:30951980|PMID:38908815 Itpr3 Rat 4-hydroxyphenyl retinamide increases expression ISO RGD:10822 6480464 Fenretinide results in increased expression of ITPR3 mRNA CTD PMID:28973697 Itpr3 Rat 5-aza-2'-deoxycytidine affects expression ISO RGD:733997 6480464 Decitabine affects the expression of ITPR3 mRNA CTD PMID:23300844 Itpr3 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of ITPR3 mRNA CTD PMID:31881176 Itpr3 Rat acetylleucyl-leucyl-norleucinal multiple interactions ISO RGD:10822 6480464 acetylleucyl-leucyl-norleucinal inhibits the reaction [Acrylamide results in decreased expression of ITPR3 protein] CTD PMID:37353096 Itpr3 Rat acrylamide multiple interactions ISO RGD:10822 6480464 acetylleucyl-leucyl-norleucinal inhibits the reaction [Acrylamide results in decreased expression of ITPR3 protein]; benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits more ... CTD PMID:37353096 Itpr3 Rat acrylamide multiple interactions EXP 6480464 Acrylamide results in increased ubiquitination of and results in increased degradation of ITPR3 protein; benzyloxycarbonylleucyl-leucyl-leucine more ... CTD PMID:37353096 Itpr3 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of ITPR3 protein CTD PMID:37353096 Itpr3 Rat acrylamide decreases expression ISO RGD:10822 6480464 Acrylamide results in decreased expression of ITPR3 protein CTD PMID:37353096 Itpr3 Rat Adenophostin A multiple interactions EXP 6480464 adenophostin A analog binds to and results in increased activity of ITPR3 protein; adenophostin A more ... CTD PMID:18247493 Itpr3 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of ITPR3 mRNA CTD PMID:25378103 Itpr3 Rat aflatoxin B1 multiple interactions ISO RGD:10822 6480464 [ITPR3 protein mutant form results in increased susceptibility to Aflatoxin B1] which results in increased more ... CTD PMID:38679149 Itpr3 Rat aflatoxin B1 increases response to substance ISO RGD:10822 6480464 ITPR3 protein mutant form results in increased susceptibility to Aflatoxin B1 CTD PMID:38679149 Itpr3 Rat aflatoxin B1 increases methylation ISO RGD:733997 6480464 Aflatoxin B1 results in increased methylation of ITPR3 intron CTD PMID:30157460 Itpr3 Rat Aflatoxin B2 alpha increases methylation ISO RGD:733997 6480464 aflatoxin B2 results in increased methylation of ITPR3 intron CTD PMID:30157460 Itpr3 Rat agomelatine multiple interactions EXP 6480464 agomelatine inhibits the reaction [Galactose results in increased expression of ITPR3 protein] CTD PMID:34673010 Itpr3 Rat all-trans-retinoic acid decreases expression ISO RGD:733997 6480464 Tretinoin results in decreased expression of ITPR3 mRNA CTD PMID:15498508|PMID:21934132|PMID:33167477 Itpr3 Rat all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of ITPR3 mRNA CTD PMID:20488242 Itpr3 Rat alpha-D-galactose multiple interactions EXP 6480464 agomelatine inhibits the reaction [Galactose results in increased expression of ITPR3 protein]; Melatonin inhibits the more ... CTD PMID:34673010 Itpr3 Rat alpha-D-galactose increases expression EXP 6480464 Galactose results in increased expression of ITPR3 protein CTD PMID:34673010 Itpr3 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of ITPR3 mRNA CTD PMID:16483693 Itpr3 Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of ITPR3 mRNA CTD PMID:30779732 Itpr3 Rat antirheumatic drug decreases expression ISO RGD:733997 6480464 Antirheumatic Agents results in decreased expression of ITPR3 mRNA CTD PMID:24449571 Itpr3 Rat Aroclor 1254 increases expression ISO RGD:10822 6480464 Chlorodiphenyl (54% Chlorine) results in increased expression of ITPR3 mRNA CTD PMID:25270620 Itpr3 Rat arsane multiple interactions ISO RGD:733997 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Itpr3 Rat arsenic atom multiple interactions ISO RGD:733997 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Itpr3 Rat arsenite(3-) decreases expression ISO RGD:10822 6480464 arsenite results in decreased expression of ITPR3 mRNA CTD PMID:33053406 Itpr3 Rat arsenite(3-) multiple interactions ISO RGD:733997 6480464 arsenite inhibits the reaction [G3BP1 protein binds to ITPR3 mRNA] CTD PMID:32406909 Itpr3 Rat atrazine increases expression ISO RGD:733997 6480464 Atrazine results in increased expression of ITPR3 mRNA CTD PMID:22378314 Itpr3 Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of ITPR3 gene CTD PMID:35440735 Itpr3 Rat Azoxymethane multiple interactions ISO RGD:10822 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of ITPR3 more ... CTD PMID:29950665 Itpr3 Rat benzo[a]pyrene increases expression ISO RGD:733997 6480464 Benzo(a)pyrene results in increased expression of ITPR3 mRNA CTD PMID:22316170|PMID:32234424 Itpr3 Rat benzo[a]pyrene affects methylation ISO RGD:733997 6480464 Benzo(a)pyrene affects the methylation of ITPR3 intron CTD PMID:30157460 Itpr3 Rat benzo[a]pyrene decreases methylation ISO RGD:733997 6480464 Benzo(a)pyrene results in decreased methylation of ITPR3 promoter CTD PMID:27901495 Itpr3 Rat bis(2-ethylhexyl) phthalate increases expression ISO RGD:733997 6480464 Diethylhexyl Phthalate results in increased expression of ITPR3 mRNA CTD PMID:31163220 Itpr3 Rat bis(2-ethylhexyl) phthalate decreases expression ISO RGD:10822 6480464 Diethylhexyl Phthalate results in decreased expression of ITPR3 mRNA CTD PMID:34319233 Itpr3 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of ITPR3 mRNA CTD PMID:25181051 Itpr3 Rat bisphenol A increases expression ISO RGD:10822 6480464 bisphenol A results in increased expression of ITPR3 mRNA CTD PMID:32156529 Itpr3 Rat bisphenol A decreases methylation ISO RGD:733997 6480464 bisphenol A results in decreased methylation of ITPR3 gene CTD PMID:31601247 Itpr3 Rat bisphenol A multiple interactions ISO RGD:733997 6480464 [bisphenol A co-treated with Fulvestrant] affects the methylation of ITPR3 gene CTD PMID:31601247 Itpr3 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ITPR3 mRNA CTD PMID:33296240 Itpr3 Rat bisphenol A multiple interactions ISO RGD:10822 6480464 [bisphenol A co-treated with Streptozocin] results in increased expression of ITPR3 mRNA CTD PMID:29935216 Itpr3 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ITPR3 protein CTD PMID:24552547 Itpr3 Rat bisphenol F multiple interactions ISO RGD:733997 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Itpr3 Rat bisphenol F increases expression ISO RGD:10822 6480464 bisphenol F results in increased expression of ITPR3 mRNA CTD PMID:30951980 Itpr3 Rat C60 fullerene increases expression EXP 6480464 fullerene C60 results in increased expression of ITPR3 mRNA CTD PMID:19167457 Itpr3 Rat cadmium atom increases response to substance ISO RGD:10822 6480464 ITPR3 mutant form results in increased susceptibility to Cadmium CTD PMID:37047547 Itpr3 Rat cadmium atom multiple interactions ISO RGD:10822 6480464 [ITPR3 mutant form results in increased susceptibility to Cadmium] which results in increased expression of more ... CTD PMID:37047547 Itpr3 Rat cadmium dichloride increases expression ISO RGD:10822 6480464 Cadmium Chloride results in increased expression of ITPR3 mRNA CTD PMID:24982889 Itpr3 Rat caffeine increases phosphorylation ISO RGD:733997 6480464 Caffeine results in increased phosphorylation of ITPR3 protein CTD PMID:35688186 Itpr3 Rat calcium atom affects expression EXP 6480464 Calcium affects the expression of ITPR3 protein CTD PMID:10963052 Itpr3 Rat calcium oxalate increases expression EXP 6480464 Calcium Oxalate results in increased expression of ITPR3 protein CTD PMID:37454925 Itpr3 Rat calcium(0) affects expression EXP 6480464 Calcium affects the expression of ITPR3 protein CTD PMID:10963052 Itpr3 Rat choline multiple interactions ISO RGD:10822 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ... CTD PMID:20938992 Itpr3 Rat chromium(6+) multiple interactions ISO RGD:733997 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in decreased expression more ... CTD PMID:38479592 Itpr3 Rat cisplatin increases expression ISO RGD:10822 6480464 Cisplatin results in increased expression of ITPR3 mRNA CTD PMID:21151649 Itpr3 Rat cisplatin affects expression ISO RGD:733997 6480464 Cisplatin affects the expression of ITPR3 mRNA CTD PMID:23300844 Itpr3 Rat clofibrate increases expression ISO RGD:10822 6480464 Clofibrate results in increased expression of ITPR3 mRNA CTD PMID:25270620 Itpr3 Rat cobalt dichloride decreases expression ISO RGD:733997 6480464 cobaltous chloride results in decreased expression of ITPR3 mRNA CTD PMID:19376846 Itpr3 Rat copper atom multiple interactions ISO RGD:733997 6480464 [Chelating Agents binds to Copper] which results in increased expression of ITPR3 mRNA CTD PMID:30911355 Itpr3 Rat copper(0) multiple interactions ISO RGD:733997 6480464 [Chelating Agents binds to Copper] which results in increased expression of ITPR3 mRNA CTD PMID:30911355 Itpr3 Rat copper(II) sulfate increases expression ISO RGD:733997 6480464 Copper Sulfate results in increased expression of ITPR3 mRNA CTD PMID:19549813 Itpr3 Rat coumarin decreases phosphorylation ISO RGD:733997 6480464 coumarin results in decreased phosphorylation of ITPR3 protein CTD PMID:35688186 Itpr3 Rat cyclosporin A increases expression ISO RGD:733997 6480464 Cyclosporine results in increased expression of ITPR3 mRNA CTD PMID:20106945|PMID:21632981|PMID:25562108 Itpr3 Rat D-aspartic acid affects metabolic processing ISO RGD:10822 6480464 ITPR3 mutant form affects the metabolism of D-Aspartic Acid CTD PMID:32853769 Itpr3 Rat dexamethasone multiple interactions ISO RGD:733997 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Itpr3 Rat dextran sulfate multiple interactions ISO RGD:10822 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of ITPR3 more ... CTD PMID:29950665 Itpr3 Rat Dibutyl phosphate affects expression ISO RGD:733997 6480464 di-n-butylphosphoric acid affects the expression of ITPR3 mRNA CTD PMID:37042841 Itpr3 Rat dibutyl phthalate decreases expression ISO RGD:10822 6480464 Dibutyl Phthalate results in decreased expression of ITPR3 mRNA CTD PMID:21266533 Itpr3 Rat dichlorine multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in increased expression of ITPR3 mRNA CTD PMID:18636392 Itpr3 Rat dorsomorphin multiple interactions ISO RGD:733997 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Itpr3 Rat doxorubicin decreases expression ISO RGD:733997 6480464 Doxorubicin results in decreased expression of ITPR3 mRNA CTD PMID:29803840 Itpr3 Rat entinostat multiple interactions ISO RGD:733997 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Itpr3 Rat entinostat increases expression ISO RGD:733997 6480464 entinostat results in increased expression of ITPR3 mRNA CTD PMID:26272509|PMID:27188386 Itpr3 Rat ethanol increases expression ISO RGD:10822 6480464 Ethanol results in increased expression of ITPR3 mRNA CTD PMID:30319688 Itpr3 Rat fenvalerate increases expression ISO RGD:10822 6480464 fenvalerate results in increased expression of ITPR3 mRNA CTD PMID:19428952 Itpr3 Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of ITPR3 mRNA CTD PMID:30307764 Itpr3 Rat fipronil increases expression EXP 6480464 fipronil results in increased expression of ITPR3 mRNA CTD PMID:31881178 Itpr3 Rat flavonoids increases expression EXP 6480464 Flavonoids results in increased expression of ITPR3 mRNA CTD PMID:18035473 Itpr3 Rat folic acid multiple interactions ISO RGD:10822 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ... CTD PMID:20938992 Itpr3 Rat FR900359 increases phosphorylation ISO RGD:733997 6480464 FR900359 results in increased phosphorylation of ITPR3 protein CTD PMID:37730182 Itpr3 Rat fulvestrant multiple interactions ISO RGD:733997 6480464 [bisphenol A co-treated with Fulvestrant] affects the methylation of ITPR3 gene CTD PMID:31601247 Itpr3 Rat furfural multiple interactions ISO RGD:733997 6480464 [pyrogallol 1,3-dimethyl ether co-treated with Furaldehyde] results in decreased expression of and affects the localization more ... CTD PMID:38598786 Itpr3 Rat galactose multiple interactions EXP 6480464 agomelatine inhibits the reaction [Galactose results in increased expression of ITPR3 protein]; Melatonin inhibits the more ... CTD PMID:34673010 Itpr3 Rat galactose increases expression EXP 6480464 Galactose results in increased expression of ITPR3 protein CTD PMID:34673010 Itpr3 Rat genistein multiple interactions EXP 6480464 [Genistein co-treated with Methoxychlor] results in decreased expression of ITPR3 mRNA CTD PMID:21782745 Itpr3 Rat glyoxylic acid increases expression EXP 6480464 glyoxylic acid results in increased expression of ITPR3 protein CTD PMID:37454925 Itpr3 Rat glyphosate affects expression ISO RGD:733997 6480464 Glyphosate affects the expression of ITPR3 mRNA CTD PMID:31295307 Itpr3 Rat halothane increases expression ISO RGD:10822 6480464 Halothane results in increased expression of ITPR3 mRNA CTD PMID:32795494 Itpr3 Rat Heptachlor epoxide increases expression ISO RGD:10822 6480464 Heptachlor Epoxide results in increased expression of ITPR3 mRNA CTD PMID:25270620 Itpr3 Rat hydrogen peroxide affects expression ISO RGD:733997 6480464 Hydrogen Peroxide affects the expression of ITPR3 mRNA CTD PMID:20044591|PMID:23410634 Itpr3 Rat indometacin multiple interactions ISO RGD:733997 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Itpr3 Rat ivermectin decreases expression ISO RGD:733997 6480464 Ivermectin results in decreased expression of ITPR3 protein CTD PMID:32959892 Itpr3 Rat L-glutamic acid affects metabolic processing ISO RGD:10822 6480464 ITPR3 mutant form affects the metabolism of Glutamic Acid CTD PMID:32853769 Itpr3 Rat L-methionine multiple interactions ISO RGD:10822 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ... CTD PMID:20938992 Itpr3 Rat leflunomide increases expression ISO RGD:733997 6480464 leflunomide results in increased expression of ITPR3 mRNA CTD PMID:28988120 Itpr3 Rat linsidomine increases oxidation EXP 6480464 linsidomine results in increased oxidation of ITPR3 protein CTD PMID:28086193 Itpr3 Rat manganese atom multiple interactions ISO RGD:733997 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Itpr3 Rat manganese(0) multiple interactions ISO RGD:733997 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Itpr3 Rat manganese(II) chloride multiple interactions ISO RGD:733997 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Itpr3 Rat melatonin multiple interactions EXP 6480464 Melatonin inhibits the reaction [Galactose results in increased expression of ITPR3 protein] CTD PMID:34673010 Itpr3 Rat menadione affects expression ISO RGD:733997 6480464 Vitamin K 3 affects the expression of ITPR3 mRNA CTD PMID:20044591|PMID:23410634 Itpr3 Rat methotrexate increases expression ISO RGD:733997 6480464 Methotrexate results in increased expression of ITPR3 mRNA CTD PMID:21678067 Itpr3 Rat methoxychlor multiple interactions EXP 6480464 [Genistein co-treated with Methoxychlor] results in decreased expression of ITPR3 mRNA CTD PMID:21782745 Itpr3 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of ITPR3 gene CTD PMID:35440735 Itpr3 Rat methylmercury chloride affects response to substance ISO RGD:10822 6480464 ITPR3 protein affects the susceptibility to methylmercuric chloride CTD PMID:33166615 Itpr3 Rat methylmercury chloride multiple interactions ISO RGD:10822 6480464 methylmercuric chloride affects the reaction [ITPR3 protein affects the expression of CSF2 mRNA]; methylmercuric chloride more ... CTD PMID:33166615 Itpr3 Rat mono(2-ethylhexyl) phthalate increases expression ISO RGD:10822 6480464 mono-(2-ethylhexyl)phthalate results in increased expression of ITPR3 protein CTD PMID:39307383 Itpr3 Rat monosodium L-glutamate increases expression ISO RGD:10822 6480464 Sodium Glutamate results in increased expression of ITPR3 mRNA CTD PMID:19001666|PMID:20111022 Itpr3 Rat monosodium L-glutamate multiple interactions ISO RGD:10822 6480464 [Sodium Glutamate co-treated with High Fructose Corn Syrup] results in increased expression of ITPR3 mRNA CTD PMID:20111022 Itpr3 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions EXP 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [Acrylamide results in decreased expression of ITPR3 protein] CTD PMID:37353096 Itpr3 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions ISO RGD:10822 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [Acrylamide results in decreased expression of ITPR3 protein] CTD PMID:37353096 Itpr3 Rat nickel sulfate increases expression ISO RGD:733997 6480464 nickel sulfate results in increased expression of ITPR3 mRNA CTD PMID:22714537 Itpr3 Rat nitrates multiple interactions ISO RGD:10822 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of ITPR3 more ... CTD PMID:35964746 Itpr3 Rat O-methyleugenol increases expression ISO RGD:733997 6480464 methyleugenol results in increased expression of ITPR3 mRNA CTD PMID:32234424 Itpr3 Rat ozone multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in increased expression of ITPR3 mRNA CTD PMID:18636392 Itpr3 Rat paracetamol affects expression ISO RGD:10822 6480464 Acetaminophen affects the expression of ITPR3 mRNA CTD PMID:17562736 Itpr3 Rat paracetamol increases expression ISO RGD:733997 6480464 Acetaminophen results in increased expression of ITPR3 mRNA CTD PMID:26690555 Itpr3 Rat perfluorohexanesulfonic acid increases expression ISO RGD:10822 6480464 perfluorohexanesulfonic acid results in increased expression of ITPR3 mRNA CTD PMID:37995155 Itpr3 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:10822 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of ITPR3 mRNA CTD PMID:36331819 Itpr3 Rat perfluorooctanoic acid increases expression ISO RGD:733997 6480464 perfluorooctanoic acid results in increased expression of ITPR3 protein CTD PMID:35123991 Itpr3 Rat phenobarbital increases expression ISO RGD:10822 6480464 Phenobarbital results in increased expression of ITPR3 mRNA CTD PMID:19482888 Itpr3 Rat phenobarbital multiple interactions ISO RGD:10822 6480464 NR1I3 protein affects the reaction [Phenobarbital results in increased expression of ITPR3 mRNA] CTD PMID:19482888 Itpr3 Rat pirinixic acid multiple interactions ISO RGD:10822 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ... CTD PMID:19710929 Itpr3 Rat pirinixic acid decreases expression ISO RGD:10822 6480464 pirinixic acid results in decreased expression of ITPR3 mRNA CTD PMID:17426115 Itpr3 Rat quercetin increases expression ISO RGD:733997 6480464 Quercetin results in increased expression of ITPR3 mRNA CTD PMID:21632981 Itpr3 Rat raloxifene affects expression ISO RGD:733997 6480464 Raloxifene Hydrochloride affects the expression of ITPR3 mRNA CTD PMID:14699072 Itpr3 Rat resveratrol increases phosphorylation ISO RGD:733997 6480464 resveratrol results in increased phosphorylation of ITPR3 protein CTD PMID:25311616 Itpr3 Rat SB 431542 multiple interactions ISO RGD:733997 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Itpr3 Rat sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of ITPR3 protein CTD PMID:19072884 Itpr3 Rat sodium arsenite decreases expression ISO RGD:10822 6480464 sodium arsenite results in decreased expression of ITPR3 mRNA CTD PMID:37682722 Itpr3 Rat sodium arsenite multiple interactions ISO RGD:733997 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Itpr3 Rat sodium chloride multiple interactions ISO RGD:733997 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of ITPR3 protein; [Sodium Chloride co-treated more ... CTD PMID:38598786 Itpr3 Rat streptozocin multiple interactions ISO RGD:10822 6480464 [bisphenol A co-treated with Streptozocin] results in increased expression of ITPR3 mRNA; [octylphenol co-treated with more ... CTD PMID:29935216 Itpr3 Rat streptozocin increases expression ISO RGD:10822 6480464 Streptozocin results in increased expression of ITPR3 mRNA CTD PMID:29935216 Itpr3 Rat tamibarotene decreases expression ISO RGD:733997 6480464 tamibarotene results in decreased expression of ITPR3 mRNA CTD PMID:15498508 Itpr3 Rat tamoxifen affects expression ISO RGD:733997 6480464 Tamoxifen affects the expression of ITPR3 mRNA CTD PMID:14699072 Itpr3 Rat temozolomide decreases expression ISO RGD:733997 6480464 Temozolomide results in decreased expression of ITPR3 mRNA CTD PMID:31758290 Itpr3 Rat tert-butyl hydroperoxide affects expression ISO RGD:733997 6480464 tert-Butylhydroperoxide affects the expression of ITPR3 mRNA CTD PMID:23410634 Itpr3 Rat thapsigargin decreases expression ISO RGD:733997 6480464 Thapsigargin results in decreased expression of ITPR3 mRNA CTD PMID:22378314 Itpr3 Rat thimerosal decreases expression ISO RGD:733997 6480464 Thimerosal results in decreased expression of ITPR3 mRNA CTD PMID:27188386 Itpr3 Rat titanium dioxide multiple interactions ISO RGD:10822 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of ITPR3 more ... CTD PMID:29950665 Itpr3 Rat tributylstannane increases expression ISO RGD:10822 6480464 tributyltin results in increased expression of ITPR3 mRNA CTD PMID:31939706 Itpr3 Rat trichostatin A increases expression ISO RGD:733997 6480464 trichostatin A results in increased expression of ITPR3 mRNA CTD PMID:24935251 Itpr3 Rat triphenyl phosphate affects expression ISO RGD:733997 6480464 triphenyl phosphate affects the expression of ITPR3 mRNA CTD PMID:37042841 Itpr3 Rat Triptolide increases expression EXP 6480464 triptolide results in increased expression of ITPR3 protein CTD PMID:32519852 Itpr3 Rat tris(2-butoxyethyl) phosphate affects expression ISO RGD:733997 6480464 tris(2-butoxyethyl) phosphate affects the expression of ITPR3 mRNA CTD PMID:29024780 Itpr3 Rat tungsten decreases expression ISO RGD:10822 6480464 Tungsten results in decreased expression of ITPR3 mRNA CTD PMID:30912803 Itpr3 Rat undecane decreases expression EXP 6480464 undecane results in decreased expression of ITPR3 protein CTD PMID:17337753 Itpr3 Rat valproic acid affects expression ISO RGD:733997 6480464 Valproic Acid affects the expression of ITPR3 mRNA CTD PMID:25979313 Itpr3 Rat valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of ITPR3 mRNA CTD PMID:32428529 Itpr3 Rat valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of ITPR3 mRNA CTD PMID:29427782 Itpr3 Rat valproic acid multiple interactions ISO RGD:733997 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Itpr3 Rat valproic acid increases expression ISO RGD:733997 6480464 Valproic Acid results in increased expression of ITPR3 mRNA CTD PMID:19101580|PMID:23179753|PMID:26272509|PMID:28001369 Itpr3 Rat vanadyl sulfate increases expression ISO RGD:733997 6480464 vanadyl sulfate results in increased expression of ITPR3 mRNA CTD PMID:16330358 Itpr3 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of ITPR3 mRNA CTD PMID:23034163 Itpr3 Rat XL147 multiple interactions ISO RGD:10822 6480464 XL147 inhibits the reaction [N-nitroso-tris-chloroethylurea results in increased expression of ITPR3 mRNA] CTD PMID:29891994
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
Itpr3 Rat ATP binding enables ISS UniProtKB:Q14573 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Itpr3 Rat ATP binding enables IEA UniProtKB-KW:KW-0067 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Itpr3 Rat ATP binding enables ISO RGD:733997 1624291 PMID:37898605 RGD PMID:37898605 Itpr3 Rat calcium channel activity enables IEA UniProtKB-KW:KW-0107 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Itpr3 Rat calcium channel activity enables IEA InterPro:IPR000699 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Itpr3 Rat calcium ion binding IDA 7175265 RGD Itpr3 Rat calcium ion binding enables IBA PANTHER:PTN001010185|RGD:2934|RGD:69649 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Itpr3 Rat calcium ion binding enables ISO RGD:733997 1624291 PMID:37898605 RGD PMID:37898605 Itpr3 Rat calcium ion binding IDA 7175268 RGD Itpr3 Rat calcium ion transmembrane transporter activity TAS 619539 RGD Itpr3 Rat identical protein binding IPI RGD:2934 2290285 homooligomerization RGD Itpr3 Rat inositol 1,3,4,5 tetrakisphosphate binding IDA 729040 RGD Itpr3 Rat inositol 1,4,5 trisphosphate binding IDA 7175265 RGD Itpr3 Rat inositol 1,4,5 trisphosphate binding enables IEA InterPro:IPR000493 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Itpr3 Rat inositol 1,4,5 trisphosphate binding enables IBA MGI:96623|PANTHER:PTN001010185|RGD:2934|RGD:69649|UniProtKB:Q14573 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Itpr3 Rat inositol 1,4,5 trisphosphate binding enables ISO RGD:733997 1624291 PMID:8288584 RGD PMID:8288584 Itpr3 Rat inositol 1,4,5 trisphosphate binding enables IEA UniRule:UR001527769 1600115 GO_REF:0000104 UniProt GO_REF:0000104 Itpr3 Rat inositol 1,4,5 trisphosphate binding IDA 7175268 RGD Itpr3 Rat inositol 1,4,5-trisphosphate-gated calcium channel activity IDA 7175265 RGD Itpr3 Rat inositol 1,4,5-trisphosphate-gated calcium channel activity TAS 619539 RGD Itpr3 Rat inositol 1,4,5-trisphosphate-gated calcium channel activity enables IEA UniRule:UR001527769 1600115 GO_REF:0000104 UniProt GO_REF:0000104 Itpr3 Rat inositol 1,4,5-trisphosphate-gated calcium channel activity enables IEA InterPro:IPR000493 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Itpr3 Rat inositol 1,4,5-trisphosphate-gated calcium channel activity enables ISO RGD:10822 1624291 PMID:15890645, PMID:17327232, PMID:20813840, PMID:9065779 RGD PMID:15890645|PMID:17327232|PMID:20813840|PMID:9065779 Itpr3 Rat inositol 1,4,5-trisphosphate-gated calcium channel activity enables IBA FB:FBgn0010051|MGI:96623|MGI:96624|MGI:99418|PANTHER:PTN001010185|RGD:2933|RGD:2934|RGD:69649|UniProtKB:Q14571|UniProtKB:Q14573|UniProtKB:Q14643 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Itpr3 Rat inositol 1,4,5-trisphosphate-gated calcium channel activity enables IEA ARBA:ARBA00026498 1600115 GO_REF:0000117 UniProt GO_REF:0000117 Itpr3 Rat inositol 1,4,5-trisphosphate-gated calcium channel activity enables ISS UniProtKB:P70227 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Itpr3 Rat inositol 1,4,5-trisphosphate-gated calcium channel activity enables ISO RGD:733997 1624291 PMID:10828023, PMID:30013099, PMID:37898605 RGD PMID:10828023|PMID:30013099|PMID:37898605 Itpr3 Rat inositol 1,4,5-trisphosphate-gated calcium channel activity IDA 7175271 RGD Itpr3 Rat inositol 1,4,5-trisphosphate-gated calcium channel activity IDA 2290285 RGD Itpr3 Rat inositol 1,4,5-trisphosphate-gated calcium channel activity IDA 7175268 RGD Itpr3 Rat inositol hexakisphosphate binding IDA 729040 RGD Itpr3 Rat intracellularly gated calcium channel activity enables ISS UniProtKB:P70227 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Itpr3 Rat intracellularly gated calcium channel activity enables ISO RGD:10822 1624291 PMID:20813840 RGD PMID:20813840 Itpr3 Rat metal ion binding enables IEA UniProtKB-KW:KW-0479 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Itpr3 Rat monoatomic ion channel activity enables IEA InterPro:IPR005821 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Itpr3 Rat nucleotide binding enables IEA UniProtKB-KW:KW-0547 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Itpr3 Rat phosphatidylinositol binding enables ISO RGD:10822 1624291 PMID:17327232 RGD PMID:17327232 Itpr3 Rat phosphatidylinositol binding enables IBA MGI:96623|MGI:96624|MGI:99418|PANTHER:PTN001010185 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Itpr3 Rat protein binding enables ISO RGD:10822 1624291 PR:A2A863|PR:G5E829|UniProtKB:O35425|UniProtKB:P11881|UniProtKB:P31750|UniProtKB:P61264|UniProtKB:Q60664|UniProtKB:Q60953 PMID:16352659, PMID:20071408, PMID:21030605, PMID:21424589, PMID:23884412, PMID:29315582 RGD PMID:16352659|PMID:20071408|PMID:21030605|PMID:21424589|PMID:23884412|PMID:29315582 Itpr3 Rat protein binding enables ISO RGD:733997 1624291 UniProtKB:P48995|UniProtKB:Q03135|UniProtKB:Q12797-2|UniProtKB:Q13507|UniProtKB:Q92560|UniProtKB:Q969S6|UniProtKB:Q9HC24 PMID:10611319, PMID:19052258, PMID:19553469, PMID:21062895, PMID:25996873, PMID:28614305 RGD PMID:10611319|PMID:19052258|PMID:19553469|PMID:21062895|PMID:25996873|PMID:28614305 Itpr3 Rat protein binding enables IPI UniProtKB:P61265 11535091 PMID:21424589 ParkinsonsUK-UCL Itpr3 Rat protein binding enables IPI UniProtKB:O35425 11535097 PMID:23884412 UniProt Itpr3 Rat protein-containing complex binding IDA 2290285 heterooligomerization RGD Itpr3 Rat zinc ion binding enables ISS UniProtKB:Q14573 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Itpr3 Rat zinc ion binding enables ISO RGD:733997 1624291 PMID:37898605 RGD PMID:37898605
Imported Annotations - KEGG (archival)
(1->4)-beta-D-glucan (ISO) 1,1-dichloroethene (ISO) 17beta-estradiol (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,6-dimethoxyphenol (ISO) 2-butoxyethanol (ISO) 2-palmitoylglycerol (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3-chloropropane-1,2-diol (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) acetamide (EXP) acetylleucyl-leucyl-norleucinal (ISO) acrylamide (EXP,ISO) Adenophostin A (EXP) aflatoxin B1 (EXP,ISO) Aflatoxin B2 alpha (ISO) agomelatine (EXP) all-trans-retinoic acid (EXP,ISO) alpha-D-galactose (EXP) ammonium chloride (EXP) amphetamine (EXP) antirheumatic drug (ISO) Aroclor 1254 (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) atrazine (EXP,ISO) Azoxymethane (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) C60 fullerene (EXP) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) calcium atom (EXP) calcium oxalate (EXP) calcium(0) (EXP) choline (ISO) chromium(6+) (ISO) cisplatin (ISO) clofibrate (ISO) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) coumarin (ISO) cyclosporin A (ISO) D-aspartic acid (ISO) dexamethasone (ISO) dextran sulfate (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) dichlorine (EXP) dorsomorphin (ISO) doxorubicin (ISO) entinostat (ISO) ethanol (ISO) fenvalerate (EXP,ISO) fipronil (EXP) flavonoids (EXP) folic acid (ISO) FR900359 (ISO) fulvestrant (ISO) furfural (ISO) galactose (EXP) genistein (EXP) glyoxylic acid (EXP) glyphosate (ISO) halothane (ISO) Heptachlor epoxide (ISO) hydrogen peroxide (ISO) indometacin (ISO) ivermectin (ISO) L-glutamic acid (ISO) L-methionine (ISO) leflunomide (ISO) linsidomine (EXP) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) melatonin (EXP) menadione (ISO) methotrexate (ISO) methoxychlor (EXP) methylmercury chloride (ISO) mono(2-ethylhexyl) phthalate (ISO) monosodium L-glutamate (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (EXP,ISO) nickel sulfate (ISO) nitrates (ISO) O-methyleugenol (ISO) ozone (EXP) paracetamol (ISO) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenobarbital (ISO) pirinixic acid (ISO) quercetin (ISO) raloxifene (ISO) resveratrol (ISO) SB 431542 (ISO) sodium arsenite (EXP,ISO) sodium chloride (ISO) streptozocin (ISO) tamibarotene (ISO) tamoxifen (ISO) temozolomide (ISO) tert-butyl hydroperoxide (ISO) thapsigargin (ISO) thimerosal (ISO) titanium dioxide (ISO) tributylstannane (ISO) trichostatin A (ISO) triphenyl phosphate (ISO) Triptolide (EXP) tris(2-butoxyethyl) phosphate (ISO) tungsten (ISO) undecane (EXP) valproic acid (EXP,ISO) vanadyl sulfate (ISO) vinclozolin (EXP) XL147 (ISO)
Molecular Function
ATP binding (IEA,ISO,ISS) calcium channel activity (IEA) calcium ion binding (IBA,IDA,ISO) calcium ion transmembrane transporter activity (TAS) identical protein binding (IPI) inositol 1,3,4,5 tetrakisphosphate binding (IDA) inositol 1,4,5 trisphosphate binding (IBA,IDA,IEA,ISO) inositol 1,4,5-trisphosphate-gated calcium channel activity (IBA,IDA,IEA,ISO,ISS,TAS) inositol hexakisphosphate binding (IDA) intracellularly gated calcium channel activity (ISO,ISS) metal ion binding (IEA) monoatomic ion channel activity (IEA) nucleotide binding (IEA) phosphatidylinositol binding (IBA,ISO) protein binding (IPI,ISO) protein-containing complex binding (IDA) zinc ion binding (ISO,ISS)
1.
Sequence and functional characterization of a third inositol trisphosphate receptor subtype, IP3R-3, expressed in pancreatic islets, kidney, gastrointestinal tract, and other tissues.
Blondel O, etal., J Biol Chem 1993 May 25;268(15):11356-63.
2.
Protein kinase C decreases the apparent affinity of the inositol 1,4,5-trisphosphate receptor type 3 in RINm5F cells.
Caron AZ, etal., Cell Calcium. 2007 Sep;42(3):323-31. Epub 2007 Feb 23.
3.
Protein kinase A increases the binding affinity and the Ca2+ release activity of the inositol 1,4,5-trisphosphate receptor type 3 in RINm5F cells.
Chaloux B, etal., Biol Cell. 2007 Jul;99(7):379-88.
4.
Translational mobility of the type 3 inositol 1,4,5-trisphosphate receptor Ca2+ release channel in endoplasmic reticulum membrane.
Ferreri-Jacobia M, etal., J Biol Chem. 2005 Feb 4;280(5):3824-31. Epub 2004 Nov 10.
5.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
7.
Regulation of Ca(2+) signaling in rat bile duct epithelia by inositol 1,4,5-trisphosphate receptor isoforms.
Hirata K, etal., Hepatology 2002 Aug;36(2):284-96.
8.
Proteasomal activation mediates down-regulation of inositol 1,4,5-trisphosphate receptor and calcium mobilization in rat pancreatic islets.
Lee B, etal., Endocrinology 2001 May;142(5):1744-51.
9.
Characterization of inositol 1,4,5-trisphosphate receptor isoform mRNA expression and regulation in rat pancreatic islets, RINm5F cells and betaHC9 cells.
Lee B, etal., J Mol Endocrinol 1998 Aug;21(1):31-9.
10.
Single-channel properties in endoplasmic reticulum membrane of recombinant type 3 inositol trisphosphate receptor.
Mak DO, etal., J Gen Physiol. 2000 Mar;115(3):241-56.
11.
Primary structure, ligand binding, and localization of the human type 3 inositol 1,4,5-trisphosphate receptor expressed in intestinal epithelium.
Maranto AR J Biol Chem. 1994 Jan 14;269(2):1222-30.
12.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
13.
Selective phosphorylation of the IP3R-I in vivo by cGMP-dependent protein kinase in smooth muscle.
Murthy KS and Zhou H, Am J Physiol Gastrointest Liver Physiol 2003 Feb;284(2):G221-30.
14.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
15.
Selective recognition of inositol phosphates by subtypes of the inositol trisphosphate receptor.
Nerou EP, etal., Biochem J 2001 Apr 1;355(Pt 1):59-69.
16.
Inositol 1,4,5 trisphosphate receptor and chromogranin B are concentrated in different regions of the hippocampus.
Nicolay NH, etal., J Neurosci Res. 2007 Jul;85(9):2026-36.
17.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
18.
Differential distribution, clustering, and lateral diffusion of subtypes of the inositol 1,4,5-trisphosphate receptor.
Pantazaka E and Taylor CW, J Biol Chem. 2011 Jul 1;286(26):23378-87. doi: 10.1074/jbc.M111.236372. Epub 2011 May 5.
19.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
20.
Characterization of ryanodine receptors in rat colonic epithelium.
Prinz G and Diener M, Acta Physiol (Oxf). 2008 Jun;193(2):151-62. doi: 10.1111/j.1748-1716.2007.01802.x. Epub 2007 Nov 15.
21.
GOA pipeline
RGD automated data pipeline
22.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
23.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
24.
Functional ryanodine receptors in the plasma membrane of RINm5F pancreatic beta-cells.
Rosker C, etal., J Biol Chem. 2009 Feb 20;284(8):5186-94. doi: 10.1074/jbc.M805587200. Epub 2008 Dec 30.
25.
The Bcl-2 protein family member Bok binds to the coupling domain of inositol 1,4,5-trisphosphate receptors and protects them from proteolytic cleavage.
Schulman JJ, etal., J Biol Chem. 2013 Aug 30;288(35):25340-9. doi: 10.1074/jbc.M113.496570. Epub 2013 Jul 24.
26.
Differential cellular expression of isoforms of inositol 1,4,5-triphosphate receptors in neurons and glia in brain.
Sharp AH, etal., J Comp Neurol. 1999 Apr 5;406(2):207-20.
27.
Inositol 1, 4, 5-trisphosphate receptor interacts with the SNARE domain of syntaxin 1B.
Tanaka S, etal., J Physiol Sci. 2011 May;61(3):221-9. doi: 10.1007/s12576-011-0140-4. Epub 2011 Mar 20.
28.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
29.
Signaling proteins in the axoglial apparatus of sciatic nerve nodes of Ranvier.
Toews JC, etal., Glia. 2007 Jan 15;55(2):202-13.
30.
Regulation of inositol 1,4,5-trisphosphate receptors by cAMP independent of cAMP-dependent protein kinase.
Tovey SC, etal., J Biol Chem. 2010 Apr 23;285(17):12979-89. doi: 10.1074/jbc.M109.096016. Epub 2010 Feb 26.
31.
Functional characterization of mammalian inositol 1,4,5-trisphosphate receptor isoforms.
Tu H, etal., Biophys J. 2005 Feb;88(2):1046-55. Epub 2004 Nov 8.
32.
Regulation of inositol 1,4,5-trisphosphate-induced Ca2+ release by reversible phosphorylation and dephosphorylation.
Vanderheyden V, etal., Biochim Biophys Acta. 2009 Jun;1793(6):959-70. doi: 10.1016/j.bbamcr.2008.12.003. Epub 2008 Dec 16.
33.
Disrupted placental vitamin D metabolism and calcium signaling in gestational diabetes and pre-eclampsia patients.
Varshney S, etal., Endocrine. 2023 Apr;80(1):191-200. doi: 10.1007/s12020-022-03272-9. Epub 2022 Dec 8.
34.
An inositol 1,4,5-trisphosphate receptor-dependent cation entry pathway in DT40 B lymphocytes.
Vazquez G, etal., EMBO J 2002 Sep 2;21(17):4531-8.
35.
Microtubule-dependent redistribution of the type-1 inositol 1,4,5-trisphosphate receptor in A7r5 smooth muscle cells.
Vermassen E, etal., J Cell Sci. 2003 Apr 1;116(Pt 7):1269-77.
36.
Intracellular signal transduction during gastrin-induced histamine secretion in rat gastric ECL cells.
Zanner R, etal., Am J Physiol Cell Physiol 2002 Feb;282(2):C374-82.
Itpr3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 5,138,553 - 5,204,189 (+) NCBI GRCr8 mRatBN7.2 20 5,136,968 - 5,202,339 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 5,136,441 - 5,202,337 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 5,862,755 - 5,927,561 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 5,224,499 - 5,289,310 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 5,702,534 - 5,768,607 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 5,645,894 - 5,711,702 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 5,646,097 - 5,711,702 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 7,711,508 - 7,775,357 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 5,292,430 - 5,357,502 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 5,292,656 - 5,357,727 (+) NCBI Celera 20 6,717,488 - 6,781,775 (+) NCBI Celera Cytogenetic Map 20 p12 NCBI
ITPR3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 33,621,322 - 33,696,562 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 33,620,365 - 33,696,574 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 33,589,099 - 33,664,339 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 33,697,139 - 33,772,329 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 33,697,321 - 33,772,317 NCBI Celera 6 35,143,559 - 35,218,741 (+) NCBI Celera Cytogenetic Map 6 p21.31 NCBI HuRef 6 33,330,927 - 33,406,007 (+) NCBI HuRef CHM1_1 6 33,591,516 - 33,666,641 (+) NCBI CHM1_1 T2T-CHM13v2.0 6 33,442,464 - 33,517,747 (+) NCBI T2T-CHM13v2.0
Itpr3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 27,275,976 - 27,341,197 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 27,276,278 - 27,341,197 (+) Ensembl GRCm39 Ensembl GRCm38 17 27,057,002 - 27,122,223 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 27,057,304 - 27,122,223 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 27,194,249 - 27,259,168 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 26,785,125 - 26,849,812 (+) NCBI MGSCv36 mm8 Celera 17 27,593,736 - 27,658,505 (+) NCBI Celera Cytogenetic Map 17 A3.3 NCBI cM Map 17 13.68 NCBI
Itpr3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955437 2,055,805 - 2,106,076 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955437 2,055,782 - 2,106,709 (+) NCBI ChiLan1.0 ChiLan1.0
ITPR3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 48,100,235 - 48,175,494 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 43,967,322 - 44,042,624 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 33,194,531 - 33,269,788 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 34,303,454 - 34,378,220 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 34,303,454 - 34,378,215 (+) Ensembl panpan1.1 panPan2
ITPR3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 12 2,970,613 - 3,050,254 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 12 2,805,187 - 3,048,938 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 12 2,997,254 - 3,066,455 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 12 3,313,122 - 3,382,514 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 12 3,313,138 - 3,381,269 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 12 2,980,128 - 3,049,212 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 12 3,061,183 - 3,130,533 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 12 3,159,323 - 3,228,541 (+) NCBI UU_Cfam_GSD_1.0
Itpr3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404946 38,641,843 - 38,705,335 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936476 25,254,932 - 25,318,491 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936476 25,254,937 - 25,318,316 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ITPR3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 29,835,922 - 29,901,309 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 29,835,922 - 29,901,305 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 34,443,858 - 34,509,094 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ITPR3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 17 38,381,862 - 38,456,505 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 17 38,381,743 - 38,456,499 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666044 33,459,448 - 33,535,324 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Itpr3
.
Predicted Target Of
Count of predictions: 60 Count of miRNA genes: 56 Interacting mature miRNAs: 59 Transcripts: ENSRNOT00000011516 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
2306850 Pia40 Pristane induced arthritis QTL 40 0.0001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 20 1527959 5304575 Rat 1641915 Colcr9 Colorectal carcinoma resistance QTL 9 2.97 0.0024 intestine integrity trait (VT:0010554) benign colorectal tumor number (CMO:0001795) 20 1530655 46530655 Rat 2317057 Aia27 Adjuvant induced arthritis QTL 27 2.83 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 20 2892597 26381954 Rat 61474 Eae1 Experimental allergic encephalomyelitis QTL 1 3 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis severity score (CMO:0001419) 20 4606607 6691706 Rat 7387283 Uae44 Urinary albumin excretion QTL 44 0.1712 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 20 1 26123605 Rat 7411668 Foco32 Food consumption QTL 32 8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 1 36600972 Rat 2305926 Iddm37 Insulin dependent diabetes mellitus QTL 37 6 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 20 1527842 46527842 Rat 1354642 Despr15 Despair related QTL 15 0.0027 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 20 1 24159021 Rat 1600382 Edcs3 Endometrial carcinoma susceptibility QTL3 3.5 0.003 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 20 1 25159026 Rat 1558640 Prcs2 Prostate cancer susceptibility QTL 2 3.3 prostate integrity trait (VT:0010571) percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943) 20 4606607 17617956 Rat 1331772 Cdexp2 CD45RC expression in CD8 T cells QTL 2 5.7 CD8-positive T cell quantity (VT:0008077) blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990) 20 3621649 10078919 Rat 8694189 Bw153 Body weight QTL 153 3.13 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 20 1 29191651 Rat 1300152 Bp195 Blood pressure QTL 195 3.46 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 20 3621649 9243559 Rat 4889857 Pur27 Proteinuria QTL 27 12.2 0.001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 20 4606607 17617956 Rat 9590109 Sffal8 Serum free fatty acids level QTL 8 5.32 0.01 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 20 1 29191651 Rat 9590275 Scort15 Serum corticosterone level QTL 15 3.48 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 20 1 29191651 Rat 9589155 Insul32 Insulin level QTL 32 6.38 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 20 1 29191651 Rat 7411650 Foco23 Food consumption QTL 23 20.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 1 29191651 Rat 2317851 Alcrsp22 Alcohol response QTL 22 3.2 0.05 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 20 1 27339237 Rat 1598816 Memor12 Memory QTL 12 2.4 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 20 2606836 47606836 Rat 61432 Cia1 Collagen induced arthritis QTL 1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 20 3621656 14101050 Rat 1641893 Alcrsp7 Alcohol response QTL 7 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 20 1 27339237 Rat 6893685 Bw111 Body weight QTL 111 2.7 0.004 body mass (VT:0001259) body weight (CMO:0000012) 20 1 32578807 Rat 9590252 Scort12 Serum corticosterone level QTL 12 20.46 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 20 1 36600972 Rat
RH129560
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 20 5,202,073 - 5,202,262 (+) MAPPER mRatBN7.2 Rnor_6.0 20 5,711,437 - 5,711,625 NCBI Rnor6.0 Rnor_5.0 20 7,775,092 - 7,775,280 UniSTS Rnor5.0 RGSC_v3.4 20 5,357,237 - 5,357,425 UniSTS RGSC3.4 Celera 20 6,781,510 - 6,781,698 UniSTS RH 3.4 Map 20 56.24 UniSTS Cytogenetic Map 20 p12 UniSTS
RH129567
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 20 5,201,999 - 5,202,211 (+) MAPPER mRatBN7.2 Rnor_6.0 20 5,711,363 - 5,711,574 NCBI Rnor6.0 Rnor_5.0 20 7,775,018 - 7,775,229 UniSTS Rnor5.0 RGSC_v3.4 20 5,357,163 - 5,357,374 UniSTS RGSC3.4 Celera 20 6,781,436 - 6,781,647 UniSTS RH 3.4 Map 20 56.24 UniSTS Cytogenetic Map 20 p12 UniSTS
PMC275467P4
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 20 5,201,193 - 5,201,672 (+) MAPPER mRatBN7.2 Rnor_6.0 20 5,710,557 - 5,711,035 NCBI Rnor6.0 Rnor_5.0 20 7,774,212 - 7,774,690 UniSTS Rnor5.0 RGSC_v3.4 20 5,356,357 - 5,356,835 UniSTS RGSC3.4 Celera 20 6,780,630 - 6,781,108 UniSTS Cytogenetic Map 20 p12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000090925 ⟹ ENSRNOP00000075066
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 5,136,441 - 5,202,337 (+) Ensembl Rnor_6.0 Ensembl 20 5,646,097 - 5,711,702 (+) Ensembl
RefSeq Acc Id:
NM_013138 ⟹ NP_037270
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 5,138,812 - 5,204,184 (+) NCBI mRatBN7.2 20 5,136,968 - 5,202,339 (+) NCBI Rnor_6.0 20 5,646,097 - 5,711,702 (+) NCBI Rnor_5.0 20 7,711,508 - 7,775,357 (+) NCBI RGSC_v3.4 20 5,292,430 - 5,357,502 (+) RGD Celera 20 6,717,488 - 6,781,775 (+) RGD
Sequence:
CCGGATCGTCCAAGTCGCCGGGCTGCGAGGTGGCACTGCGCTCCTTTCCGCCCAGCGCGCCTCAGTCCTCTGCACCGAGCCTGGCAGCTCGCTTCTGGGCGACTTTGCCGCCTCGAGCCCCGGAGGCC
hide sequence
RefSeq Acc Id:
XM_063278985 ⟹ XP_063135055
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 5,138,553 - 5,204,189 (+) NCBI
RefSeq Acc Id:
NP_037270 ⟸ NM_013138
- UniProtKB:
Q63269 (UniProtKB/Swiss-Prot), C7E1V1 (UniProtKB/TrEMBL)
- Sequence:
MNEMSSFLHIGDIVSLYAEGSVNGFISTLGLVDDRCVVEPAAGDLDNPPKKFRDCLFKVCPMNRYSAQKQYWKAKQTKQDKEKIADVVLLQKLQHAAQMEQKQNDTENKKVHGDVVKYGSVIQLLHMK
hide sequence
Ensembl Acc Id:
ENSRNOP00000075066 ⟸ ENSRNOT00000090925
RefSeq Acc Id:
XP_063135055 ⟸ XM_063278985
- Peptide Label:
isoform X1
- UniProtKB:
Q63269 (UniProtKB/Swiss-Prot), C7E1V1 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2011-08-02
Itpr3
inositol 1,4,5-trisphosphate receptor, type 3
Itpr3
inositol 1,4,5-triphosphate receptor, type 3
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-11-17
Itpr3
inositol 1,4,5-triphosphate receptor, type 3
Itpr3
inositol 1,4,5-triphosphate receptor 3
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Itpr3
inositol 1, 4, 5-triphosphate receptor 3
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_cellular_localization
localized to the endoplasmic reticulum
729040
gene_function
ligand activated calcium ion selective channel
68695
gene_function
ligand activated calcium ion selective channel
69501
gene_physical_interaction
binds inositol 1,3,4,5-tetrakisphosphate and inositol hexakisphosphate
729040
gene_process
responsible for initiating and propagating cytosolic Ca++ signals evoked by receptors linked to IP3 formation
68695
