Symbol:
Itpr1
Name:
inositol 1,4,5-trisphosphate receptor, type 1
RGD ID:
2933
Description:
Enables several functions, including anion binding activity; inositol 1,4,5-trisphosphate-gated calcium channel activity; and transmembrane transporter binding activity. Involved in several processes, including calcium ion transmembrane transport; cellular response to cAMP; and regulation of apoptotic process. Located in several cellular components, including endoplasmic reticulum; neuronal cell body; and synaptic membrane. Part of protein-containing complex. Is active in several cellular components, including GABA-ergic synapse; postsynapse; and smooth endoplasmic reticulum membrane. Used to study asthma. Biomarker of Huntington's disease; cardiac arrest; and transient cerebral ischemia. Human ortholog(s) of this gene implicated in Gillespie syndrome; spinocerebellar ataxia type 15; and spinocerebellar ataxia type 29. Orthologous to human ITPR1 (inositol 1,4,5-trisphosphate receptor type 1); PARTICIPATES IN acebutolol pharmacodynamics pathway; adrenergic beta receptor agonist and beta-blocker pharmacodynamics pathway; amiodarone pharmacodynamics pathway; INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
I145TR; inositol 1,4,5-triphosphate receptor 1; inositol 1,4,5-triphosphate receptor type 1; inositol 1,4,5-triphosphate receptor, type 1; inositol 1,4,5-trisphosphate receptor type 1; inositol 1,4,5-trisphosphate-gated calcium channel ITPR1; inositol 145-triphosphate receptor type 1; InsP3R; InsP3R1; IP-3-R; IP3 receptor; IP3R 1; IP3R1; P400; type 1 inositol 1,4,5-trisphosphate receptor; type 1 InsP3 receptor
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ITPR1 (inositol 1,4,5-trisphosphate receptor type 1) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):
Itpr1 (inositol 1,4,5-trisphosphate receptor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ITPR1 (inositol 1,4,5-trisphosphate receptor type 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ITPR1 (inositol 1,4,5-trisphosphate receptor type 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Itpr1 (inositol 1,4,5-trisphosphate receptor type 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ITPR1 (inositol 1,4,5-trisphosphate receptor type 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ITPR1 (inositol 1,4,5-trisphosphate receptor type 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Itpr1 (inositol 1,4,5-trisphosphate receptor type 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
ITPR2 (inositol 1,4,5-trisphosphate receptor type 2) HGNC
OrthoDB
Alliance orthologs 3
Mus musculus (house mouse):
Itpr1 (inositol 1,4,5-trisphosphate receptor 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
ITPR1 (inositol 1,4,5-trisphosphate receptor type 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
itpr1a (inositol 1,4,5-trisphosphate receptor, type 1a)
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PhylomeDB)
Danio rerio (zebrafish):
itpr1b (inositol 1,4,5-trisphosphate receptor, type 1b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
itr-1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Itp-r83A
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
itpr1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Candidate Gene For:
Bp116
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 142,743,401 - 143,066,505 (+) NCBI GRCr8 mRatBN7.2 4 141,187,377 - 141,554,240 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 141,187,418 - 141,510,491 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 146,609,417 - 146,932,882 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 142,390,143 - 142,713,600 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 141,034,101 - 141,357,581 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 140,247,297 - 140,580,749 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 140,247,313 - 140,580,748 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 204,714,729 - 205,047,901 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 143,705,360 - 144,030,051 NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 4 129,839,611 - 130,162,657 (+) NCBI Celera RH 3.4 Map 4 RGD Cytogenetic Map 4 q41 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Itpr1 Rat (-)-demecolcine increases expression ISO ITPR1 (Homo sapiens) 6480464 Demecolcine results in increased expression of ITPR1 mRNA CTD PMID:23649840 Itpr1 Rat (1->4)-beta-D-glucan multiple interactions ISO Itpr1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of ITPR1 mRNA CTD PMID:36331819 Itpr1 Rat (E)-thiamethoxam decreases expression ISO Itpr1 (Mus musculus) 6480464 Thiamethoxam results in decreased expression of ITPR1 mRNA CTD PMID:33533595 Itpr1 Rat 1,2-dimethylhydrazine decreases expression ISO Itpr1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of ITPR1 mRNA CTD PMID:22206623 Itpr1 Rat 1,2-dimethylhydrazine multiple interactions ISO Itpr1 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in decreased expression of ITPR1 mRNA] CTD PMID:22206623 Itpr1 Rat 17alpha-ethynylestradiol affects expression ISO Itpr1 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of ITPR1 mRNA CTD PMID:17555576 Itpr1 Rat 17alpha-ethynylestradiol multiple interactions ISO Itpr1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of ITPR1 mRNA CTD PMID:17942748 Itpr1 Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of ITPR1 mRNA CTD PMID:17557909 Itpr1 Rat 17beta-estradiol multiple interactions ISO ITPR1 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of ITPR1 mRNA more ... CTD PMID:19426747 more ... Itpr1 Rat 17beta-estradiol increases expression ISO ITPR1 (Homo sapiens) 6480464 Estradiol results in increased expression of ITPR1 mRNA CTD PMID:31614463 Itpr1 Rat 17beta-estradiol decreases expression ISO Itpr1 (Mus musculus) 6480464 Estradiol results in decreased expression of ITPR1 mRNA CTD PMID:39298647 Itpr1 Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of ITPR1 mRNA CTD PMID:26496021 Itpr1 Rat 17beta-estradiol affects expression ISO ITPR1 (Homo sapiens) 6480464 Estradiol affects the expression of ITPR1 mRNA CTD PMID:22574217 Itpr1 Rat 17beta-estradiol decreases expression ISO ITPR1 (Homo sapiens) 6480464 Estradiol results in decreased expression of ITPR1 mRNA CTD PMID:19167446 more ... Itpr1 Rat 1D-myo-inositol 1,4,5-trisphosphate multiple interactions ISO ITPR1 (Homo sapiens) 6480464 Inositol 1 more ... CTD PMID:33408296 Itpr1 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Itpr1 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Itpr1 Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Itpr1 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Itpr1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO ITPR1 (Homo sapiens) 6480464 [Tetrachlorodibenzodioxin co-treated with 2-methyl-2H-pyrazole-3-carboxylic acid (2-methyl-4-o-tolylazophenyl)amide] results in decreased expression of ITPR1 mRNA more ... CTD PMID:11007951 more ... Itpr1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of ITPR1 mRNA CTD PMID:34747641 Itpr1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Itpr1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of ITPR1 mRNA CTD PMID:33956508 Itpr1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO ITPR1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of ITPR1 mRNA CTD PMID:11007951 more ... Itpr1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of ITPR1 mRNA CTD PMID:20959002 more ... Itpr1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Itpr1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ITPR1 mRNA CTD PMID:21570461 Itpr1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of ITPR1 mRNA CTD PMID:22298810 Itpr1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Itpr1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of ITPR1 mRNA CTD PMID:17942748 Itpr1 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Itpr1 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of ITPR1 mRNA CTD PMID:21346803 Itpr1 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of ITPR1 mRNA CTD PMID:21346803 Itpr1 Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:20959002 Itpr1 Rat 3,3',5-triiodo-L-thyronine increases expression EXP 6480464 Triiodothyronine results in increased expression of ITPR1 mRNA CTD PMID:15953391 Itpr1 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Itpr1 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of ITPR1 mRNA CTD PMID:26251327 Itpr1 Rat 3-methylcholanthrene multiple interactions ISO ITPR1 (Homo sapiens) 6480464 Methylcholanthrene promotes the reaction [AHR protein binds to ITPR1 promoter] CTD PMID:20348232 Itpr1 Rat 3-methylcholanthrene increases expression ISO ITPR1 (Homo sapiens) 6480464 Methylcholanthrene results in increased expression of ITPR1 mRNA CTD PMID:20348232 Itpr1 Rat 3-nitropropanoic acid decreases expression EXP 6480464 3-nitropropionic acid results in decreased expression of ITPR1 protein CTD PMID:37116597 Itpr1 Rat 3H-1,2-dithiole-3-thione decreases expression EXP 6480464 1 and 2-dithiol-3-thione results in decreased expression of ITPR1 mRNA CTD PMID:19162173 Itpr1 Rat 4,4'-diisothiocyano-trans-stilbene-2,2'-disulfonic acid multiple interactions ISO Itpr1 (Mus musculus) 6480464 4 more ... CTD PMID:27638049 Itpr1 Rat 4,4'-sulfonyldiphenol increases expression ISO Itpr1 (Mus musculus) 6480464 bisphenol S results in increased expression of ITPR1 mRNA CTD PMID:30951980 Itpr1 Rat 4,4'-sulfonyldiphenol decreases methylation ISO ITPR1 (Homo sapiens) 6480464 bisphenol S results in decreased methylation of ITPR1 gene CTD PMID:31601247 Itpr1 Rat 4,4'-sulfonyldiphenol decreases expression ISO Itpr1 (Mus musculus) 6480464 bisphenol S results in decreased expression of ITPR1 mRNA CTD PMID:39298647 Itpr1 Rat 4-amino-2,6-dinitrotoluene affects expression EXP 6480464 4-amino-2 and 6-dinitrotoluene affects the expression of ITPR1 mRNA CTD PMID:21346803 Itpr1 Rat 4-hydroxyphenyl retinamide increases expression ISO Itpr1 (Mus musculus) 6480464 Fenretinide results in increased expression of ITPR1 mRNA CTD PMID:28973697 Itpr1 Rat 5-fluorouracil multiple interactions ISO ITPR1 (Homo sapiens) 6480464 TP53 protein affects the reaction [Fluorouracil results in decreased expression of ITPR1 mRNA] CTD PMID:15016801 Itpr1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of ITPR1 mRNA CTD PMID:24780913 Itpr1 Rat 7,12-dimethyltetraphene decreases expression ISO Itpr1 (Mus musculus) 6480464 9 more ... CTD PMID:32553695 Itpr1 Rat 7,9-dihydro-1H-purine-2,6,8(3H)-trione multiple interactions ISO ITPR1 (Homo sapiens) 6480464 Uric Acid inhibits the reaction [Ethanol results in increased expression of and affects the localization of ITPR1 protein] CTD PMID:17241155 Itpr1 Rat acetaldehyde multiple interactions ISO ITPR1 (Homo sapiens) 6480464 Acetaldehyde results in increased expression of and affects the localization of ITPR1 protein and ITPR1 protein promotes the reaction [Acetaldehyde metabolite results in increased abundance of Calcium] CTD PMID:17241155 Itpr1 Rat acrolein multiple interactions ISO ITPR1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with Ozone] results in increased expression of ITPR1 mRNA CTD PMID:32845096 Itpr1 Rat acrylamide multiple interactions EXP 6480464 Acrylamide promotes the reaction [elaidic acid promotes the reaction [ITPR1 protein binds to HSPA9 protein]] more ... CTD PMID:38740238 Itpr1 Rat actinomycin D multiple interactions ISO ITPR1 (Homo sapiens) 6480464 Dactinomycin inhibits the reaction [Ethanol results in increased expression of ITPR1 mRNA] and Dactinomycin inhibits the reaction [linsidomine results in increased expression of ITPR1 mRNA] CTD PMID:17241155 Itpr1 Rat aflatoxin B1 affects expression ISO ITPR1 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of ITPR1 protein CTD PMID:20106945 Itpr1 Rat aflatoxin B1 decreases expression EXP 6480464 Aflatoxin B1 results in decreased expression of ITPR1 mRNA CTD PMID:33354967 Itpr1 Rat aflatoxin B1 decreases methylation ISO ITPR1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of ITPR1 intron CTD PMID:30157460 Itpr1 Rat aflatoxin B1 decreases expression ISO ITPR1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of ITPR1 mRNA CTD PMID:21632981 more ... Itpr1 Rat aflatoxin B1 decreases expression ISO Itpr1 (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of ITPR1 mRNA CTD PMID:19770486 Itpr1 Rat all-trans-retinoic acid decreases expression ISO ITPR1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of ITPR1 mRNA CTD PMID:23724009 Itpr1 Rat all-trans-retinoic acid increases expression ISO ITPR1 (Homo sapiens) 6480464 Tretinoin results in increased expression of ITPR1 mRNA CTD PMID:33167477 Itpr1 Rat ammonium acetate decreases expression EXP 6480464 ammonium acetate results in decreased expression of ITPR1 CTD PMID:33404927 Itpr1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of ITPR1 mRNA CTD PMID:16483693 Itpr1 Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of ITPR1 mRNA CTD PMID:30779732 Itpr1 Rat Anemoside B4 decreases phosphorylation ISO ITPR1 (Homo sapiens) 6480464 anemoside B4 results in decreased phosphorylation of ITPR1 protein CTD PMID:36084722 Itpr1 Rat aristolochic acid A decreases expression ISO ITPR1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of ITPR1 mRNA CTD PMID:33212167 Itpr1 Rat arsane affects methylation ISO ITPR1 (Homo sapiens) 6480464 Arsenic affects the methylation of ITPR1 gene CTD PMID:25304211 Itpr1 Rat arsenic atom affects methylation ISO ITPR1 (Homo sapiens) 6480464 Arsenic affects the methylation of ITPR1 gene CTD PMID:25304211 Itpr1 Rat arsenite(3-) affects expression ISO Itpr1 (Mus musculus) 6480464 arsenite affects the expression of ITPR1 mRNA CTD PMID:33053406 Itpr1 Rat arsenite(3-) multiple interactions ISO ITPR1 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to ITPR1 mRNA] CTD PMID:32406909 Itpr1 Rat arsenite(3-) increases expression ISO Itpr1 (Mus musculus) 6480464 arsenite results in increased expression of ITPR1 protein CTD PMID:37955338 Itpr1 Rat arsenite(3-) increases methylation ISO ITPR1 (Homo sapiens) 6480464 arsenite results in increased methylation of ITPR1 promoter CTD PMID:23974009 Itpr1 Rat arsenous acid increases expression ISO Itpr1 (Mus musculus) 6480464 Arsenic Trioxide results in increased expression of ITPR1 protein modified form CTD PMID:27638049 Itpr1 Rat arsenous acid increases expression ISO ITPR1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of ITPR1 mRNA CTD PMID:27829220 Itpr1 Rat arsenous acid decreases expression ISO Itpr1 (Mus musculus) 6480464 Arsenic Trioxide results in decreased expression of ITPR1 mRNA CTD PMID:24831965 Itpr1 Rat arsenous acid increases phosphorylation ISO Itpr1 (Mus musculus) 6480464 Arsenic Trioxide results in increased phosphorylation of ITPR1 protein CTD PMID:27461142 Itpr1 Rat arsenous acid multiple interactions ISO Itpr1 (Mus musculus) 6480464 2-aminoethyl diphenylborinate inhibits the reaction [Arsenic Trioxide results in increased expression of ITPR1 protein modified form] more ... CTD PMID:27638049 Itpr1 Rat atrazine increases expression ISO ITPR1 (Homo sapiens) 6480464 Atrazine results in increased expression of ITPR1 mRNA CTD PMID:22378314 Itpr1 Rat benzo[a]pyrene increases expression ISO Itpr1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of ITPR1 mRNA CTD PMID:20127859 and PMID:22228805 Itpr1 Rat benzo[a]pyrene decreases methylation ISO Itpr1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased methylation of ITPR1 intron CTD PMID:27901495 Itpr1 Rat benzo[a]pyrene decreases expression ISO Itpr1 (Mus musculus) 6480464 Benzo(a)pyrene metabolite results in decreased expression of ITPR1 mRNA CTD PMID:32553695 Itpr1 Rat benzo[a]pyrene affects methylation ISO ITPR1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of ITPR1 intron CTD PMID:30157460 Itpr1 Rat benzo[a]pyrene increases expression ISO ITPR1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of ITPR1 mRNA CTD PMID:22316170 and PMID:26238291 Itpr1 Rat benzo[a]pyrene affects expression ISO ITPR1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the expression of ITPR1 mRNA CTD PMID:21714911 Itpr1 Rat benzo[a]pyrene decreases expression ISO ITPR1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of ITPR1 mRNA CTD PMID:20064835 more ... Itpr1 Rat benzo[a]pyrene diol epoxide I decreases expression ISO ITPR1 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 and PMID:20018196 Itpr1 Rat bexarotene increases expression ISO ITPR1 (Homo sapiens) 6480464 bexarotene results in increased expression of ITPR1 mRNA CTD PMID:17178900 Itpr1 Rat bisphenol A increases expression ISO Itpr1 (Mus musculus) 6480464 bisphenol A results in increased expression of ITPR1 mRNA CTD PMID:21932408 and PMID:22687993 Itpr1 Rat bisphenol A decreases expression ISO Itpr1 (Mus musculus) 6480464 bisphenol A results in decreased expression of ITPR1 protein CTD PMID:36656826 Itpr1 Rat bisphenol A decreases methylation ISO ITPR1 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of ITPR1 gene CTD PMID:31601247 Itpr1 Rat bisphenol A increases expression ISO ITPR1 (Homo sapiens) 6480464 bisphenol A results in increased expression of ITPR1 mRNA CTD PMID:29275510 Itpr1 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of ITPR1 gene CTD PMID:28505145 Itpr1 Rat bisphenol A multiple interactions ISO ITPR1 (Homo sapiens) 6480464 Inositol 1 more ... CTD PMID:33408296 Itpr1 Rat bisphenol A affects binding ISO ITPR1 (Homo sapiens) 6480464 bisphenol A binds to ITPR1 protein CTD PMID:33408296 Itpr1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of ITPR1 mRNA CTD PMID:25181051 Itpr1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of ITPR1 mRNA CTD PMID:26496021 Itpr1 Rat bisphenol AF increases expression ISO Itpr1 (Mus musculus) 6480464 bisphenol AF results in increased expression of ITPR1 mRNA and bisphenol AF results in increased expression of ITPR1 protein CTD PMID:31981723 Itpr1 Rat bisphenol F increases expression ISO Itpr1 (Mus musculus) 6480464 bisphenol F results in increased expression of ITPR1 mRNA CTD PMID:30951980 Itpr1 Rat bleomycin A5 increases expression ISO ITPR1 (Homo sapiens) 6480464 bleomycetin results in increased expression of ITPR1 mRNA CTD PMID:21040473 Itpr1 Rat cadmium atom increases expression ISO ITPR1 (Homo sapiens) 6480464 Cadmium results in increased expression of ITPR1 protein CTD PMID:10970901 Itpr1 Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of ITPR1 mRNA CTD PMID:33453195 Itpr1 Rat cadmium dichloride decreases expression ISO Itpr1 (Mus musculus) 6480464 Cadmium Chloride results in decreased expression of ITPR1 mRNA CTD PMID:34666113 Itpr1 Rat cadmium dichloride multiple interactions ISO Itpr1 (Mus musculus) 6480464 1 more ... CTD PMID:36731763 Itpr1 Rat cadmium dichloride increases phosphorylation ISO Itpr1 (Mus musculus) 6480464 Cadmium Chloride results in increased phosphorylation of ITPR1 protein CTD PMID:36731763 Itpr1 Rat cadmium dichloride decreases expression ISO ITPR1 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of ITPR1 mRNA CTD PMID:38568856 Itpr1 Rat caffeine decreases expression ISO ITPR1 (Homo sapiens) 6480464 Caffeine results in decreased expression of ITPR1 mRNA CTD PMID:18444173 Itpr1 Rat calcitriol multiple interactions ISO ITPR1 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of ITPR1 mRNA and Testosterone promotes the reaction [Calcitriol results in increased expression of ITPR1 mRNA] CTD PMID:21592394 Itpr1 Rat calcitriol increases expression ISO ITPR1 (Homo sapiens) 6480464 Calcitriol results in increased expression of ITPR1 mRNA CTD PMID:21592394 and PMID:26485663 Itpr1 Rat calcium atom multiple interactions ISO ITPR1 (Homo sapiens) 6480464 ITPR1 protein promotes the reaction [Acetaldehyde metabolite results in increased abundance of Calcium] and ITPR1 protein promotes the reaction [Ethanol metabolite results in increased abundance of Calcium] CTD PMID:17241155 Itpr1 Rat calcium oxalate increases expression EXP 6480464 Calcium Oxalate results in increased expression of ITPR1 protein CTD PMID:37454925 Itpr1 Rat calcium oxalate multiple interactions EXP 6480464 Losartan inhibits the reaction [Calcium Oxalate results in increased expression of ITPR1 protein] CTD PMID:37454925 Itpr1 Rat calcium(0) multiple interactions ISO ITPR1 (Homo sapiens) 6480464 ITPR1 protein promotes the reaction [Acetaldehyde metabolite results in increased abundance of Calcium] and ITPR1 protein promotes the reaction [Ethanol metabolite results in increased abundance of Calcium] CTD PMID:17241155 Itpr1 Rat carbon nanotube increases expression ISO ITPR1 (Homo sapiens) 6480464 Nanotubes and Carbon results in increased expression of ITPR1 mRNA CTD PMID:32493873 Itpr1 Rat carbon nanotube decreases expression ISO Itpr1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Itpr1 Rat CGP 52608 multiple interactions ISO ITPR1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to ITPR1 gene] CTD PMID:28238834 Itpr1 Rat clofibrate decreases expression ISO Itpr1 (Mus musculus) 6480464 Clofibrate results in decreased expression of ITPR1 mRNA CTD PMID:17585979 Itpr1 Rat cobalt dichloride increases expression ISO ITPR1 (Homo sapiens) 6480464 cobaltous chloride results in increased expression of ITPR1 mRNA CTD PMID:22941251 Itpr1 Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of ITPR1 mRNA CTD PMID:24386269 Itpr1 Rat cocaine multiple interactions ISO Itpr1 (Mus musculus) 6480464 [Cocaine co-treated with FOS protein mutant form] results in decreased expression of ITPR1 mRNA CTD PMID:18355967 Itpr1 Rat cocaine increases expression EXP 6480464 Cocaine results in increased expression of ITPR1 protein CTD PMID:25100957 Itpr1 Rat copper atom multiple interactions ISO ITPR1 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in decreased expression of ITPR1 mRNA CTD PMID:30911355 Itpr1 Rat copper(0) multiple interactions ISO ITPR1 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in decreased expression of ITPR1 mRNA CTD PMID:30911355 Itpr1 Rat copper(II) sulfate decreases expression ISO ITPR1 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of ITPR1 mRNA CTD PMID:19549813 Itpr1 Rat coumestrol multiple interactions ISO ITPR1 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 more ... CTD PMID:19167446 Itpr1 Rat coumestrol decreases expression ISO ITPR1 (Homo sapiens) 6480464 Coumestrol results in decreased expression of ITPR1 mRNA CTD PMID:19167446 Itpr1 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of ITPR1 mRNA CTD PMID:26577399 Itpr1 Rat cycloheximide multiple interactions ISO ITPR1 (Homo sapiens) 6480464 Cycloheximide inhibits the reaction [Ethanol results in increased expression of ITPR1 mRNA] more ... CTD PMID:11007951 and PMID:17241155 Itpr1 Rat cypermethrin decreases expression EXP 6480464 cypermethrin results in decreased expression of ITPR1 mRNA CTD PMID:22528246 Itpr1 Rat cypermethrin increases expression ISO ITPR1 (Homo sapiens) 6480464 cypermethrin results in increased expression of ITPR1 protein CTD PMID:36063984 Itpr1 Rat dexamethasone increases expression ISO ITPR1 (Homo sapiens) 6480464 Dexamethasone results in increased expression of ITPR1 mRNA CTD PMID:23137833 Itpr1 Rat diarsenic trioxide decreases expression ISO Itpr1 (Mus musculus) 6480464 Arsenic Trioxide results in decreased expression of ITPR1 mRNA CTD PMID:24831965 Itpr1 Rat diarsenic trioxide increases phosphorylation ISO Itpr1 (Mus musculus) 6480464 Arsenic Trioxide results in increased phosphorylation of ITPR1 protein CTD PMID:27461142 Itpr1 Rat diarsenic trioxide increases expression ISO ITPR1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of ITPR1 mRNA CTD PMID:27829220 Itpr1 Rat diarsenic trioxide increases expression ISO Itpr1 (Mus musculus) 6480464 Arsenic Trioxide results in increased expression of ITPR1 protein modified form CTD PMID:27638049 Itpr1 Rat diarsenic trioxide multiple interactions ISO Itpr1 (Mus musculus) 6480464 2-aminoethyl diphenylborinate inhibits the reaction [Arsenic Trioxide results in increased expression of ITPR1 protein modified form] more ... CTD PMID:27638049 Itpr1 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of ITPR1 mRNA and Dibutyl Phthalate results in increased expression of ITPR1 protein CTD PMID:21266533 and PMID:32028152 Itpr1 Rat dibutyl phthalate multiple interactions EXP 6480464 Ascorbic Acid inhibits the reaction [Dibutyl Phthalate results in increased expression of ITPR1 mRNA] CTD PMID:32028152 Itpr1 Rat dicrotophos increases expression ISO ITPR1 (Homo sapiens) 6480464 dicrotophos results in increased expression of ITPR1 mRNA CTD PMID:28302478 Itpr1 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of ITPR1 mRNA CTD PMID:21551480 Itpr1 Rat Doramectin decreases expression EXP 6480464 doramectin results in decreased expression of ITPR1 mRNA CTD PMID:35137919 Itpr1 Rat dorsomorphin multiple interactions ISO ITPR1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Itpr1 Rat doxorubicin decreases expression EXP 6480464 Doxorubicin results in decreased expression of ITPR1 mRNA CTD PMID:39218162 Itpr1 Rat elaidic acid multiple interactions EXP 6480464 Acrylamide promotes the reaction [elaidic acid promotes the reaction [ITPR1 protein binds to HSPA9 protein]] more ... CTD PMID:38740238 Itpr1 Rat emodin decreases expression ISO ITPR1 (Homo sapiens) 6480464 Emodin results in decreased expression of ITPR1 mRNA CTD PMID:16045814 Itpr1 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of ITPR1 mRNA CTD PMID:29391264 Itpr1 Rat endosulfan affects expression EXP 6480464 Endosulfan affects the expression of ITPR1 mRNA CTD PMID:31464424 Itpr1 Rat Enterolactone multiple interactions ISO ITPR1 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of ITPR1 mRNA CTD PMID:19167446 Itpr1 Rat entinostat multiple interactions ISO ITPR1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ITPR1 mRNA CTD PMID:27188386 Itpr1 Rat entinostat increases expression ISO ITPR1 (Homo sapiens) 6480464 entinostat results in increased expression of ITPR1 mRNA CTD PMID:26272509 and PMID:27188386 Itpr1 Rat epoxiconazole decreases expression ISO Itpr1 (Mus musculus) 6480464 epoxiconazole results in decreased expression of ITPR1 mRNA CTD PMID:35436446 Itpr1 Rat ethanol multiple interactions ISO ITPR1 (Homo sapiens) 6480464 Cycloheximide inhibits the reaction [Ethanol results in increased expression of ITPR1 mRNA] more ... CTD PMID:17241155 Itpr1 Rat ethanol affects splicing ISO Itpr1 (Mus musculus) 6480464 Ethanol affects the splicing of ITPR1 mRNA CTD PMID:30319688 Itpr1 Rat ethanol increases expression ISO Itpr1 (Mus musculus) 6480464 Ethanol results in increased expression of ITPR1 mRNA and Ethanol results in increased expression of ITPR1 protein CTD PMID:29800586 and PMID:30319688 Itpr1 Rat ethanol increases expression ISO ITPR1 (Homo sapiens) 6480464 Ethanol results in increased expression of ITPR1 mRNA CTD PMID:17241155 Itpr1 Rat etoposide affects response to substance ISO ITPR1 (Homo sapiens) 6480464 ITPR1 protein affects the susceptibility to Etoposide CTD PMID:16217747 Itpr1 Rat fenthion decreases expression ISO Itpr1 (Mus musculus) 6480464 Fenthion results in decreased expression of ITPR1 mRNA CTD PMID:34813904 Itpr1 Rat fenvalerate increases expression ISO Itpr1 (Mus musculus) 6480464 fenvalerate results in increased expression of ITPR1 mRNA CTD PMID:19428952 Itpr1 Rat flavonoids increases expression EXP 6480464 Flavonoids results in increased expression of ITPR1 mRNA CTD PMID:18035473 Itpr1 Rat folic acid multiple interactions ISO Itpr1 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in decreased expression of ITPR1 mRNA] CTD PMID:22206623 Itpr1 Rat fomepizole multiple interactions ISO ITPR1 (Homo sapiens) 6480464 fomepizole inhibits the reaction [Ethanol results in increased expression of and affects the localization of ITPR1 protein] CTD PMID:17241155 Itpr1 Rat formaldehyde increases expression ISO ITPR1 (Homo sapiens) 6480464 Formaldehyde results in increased expression of ITPR1 mRNA CTD PMID:23649840 Itpr1 Rat FR900359 increases phosphorylation ISO ITPR1 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of ITPR1 protein CTD PMID:37730182 Itpr1 Rat genistein increases expression ISO ITPR1 (Homo sapiens) 6480464 Genistein results in increased expression of ITPR1 mRNA CTD PMID:18444173 and PMID:18847459 Itpr1 Rat glyoxylic acid increases expression EXP 6480464 glyoxylic acid results in increased expression of ITPR1 protein CTD PMID:37454925 Itpr1 Rat glyphosate decreases expression ISO ITPR1 (Homo sapiens) 6480464 Glyphosate results in decreased expression of ITPR1 mRNA and Glyphosate results in decreased expression of ITPR1 protein alternative form CTD PMID:24073338 and PMID:31295307 Itpr1 Rat glyphosate increases expression ISO ITPR1 (Homo sapiens) 6480464 Glyphosate results in increased expression of ITPR1 mRNA CTD PMID:31295307 Itpr1 Rat GW 4064 multiple interactions ISO Itpr1 (Mus musculus) 6480464 GW 4064 inhibits the reaction [[caffeic acid phenethyl ester co-treated with Dietary Fats] results in decreased expression of ITPR1 mRNA] CTD PMID:28223344 Itpr1 Rat halothane increases expression ISO Itpr1 (Mus musculus) 6480464 Halothane results in increased expression of ITPR1 mRNA CTD PMID:32795494 Itpr1 Rat homocysteine increases expression ISO ITPR1 (Homo sapiens) 6480464 Homocysteine results in increased expression of ITPR1 protein CTD PMID:33751715 Itpr1 Rat homocysteine multiple interactions ISO ITPR1 (Homo sapiens) 6480464 Homocysteine promotes the reaction [HSPA9 protein binds to ITPR1 protein] CTD PMID:33751715 Itpr1 Rat hydrogen peroxide increases expression ISO ITPR1 (Homo sapiens) 6480464 Hydrogen Peroxide results in increased expression of ITPR1 mRNA CTD PMID:18951874 Itpr1 Rat ketoconazole increases expression EXP 6480464 Ketoconazole results in increased expression of ITPR1 mRNA CTD PMID:37077353 Itpr1 Rat L-ascorbic acid multiple interactions EXP 6480464 Ascorbic Acid inhibits the reaction [Dibutyl Phthalate results in increased expression of ITPR1 mRNA] CTD PMID:32028152 Itpr1 Rat lead diacetate increases expression ISO Itpr1 (Mus musculus) 6480464 lead acetate results in increased expression of ITPR1 mRNA CTD PMID:21829687 Itpr1 Rat lead(0) decreases expression EXP 6480464 Lead results in decreased expression of ITPR1 mRNA and Lead results in decreased expression of ITPR1 protein CTD PMID:24960059 Itpr1 Rat lead(0) increases expression EXP 6480464 Lead results in increased expression of ITPR1 mRNA and Lead results in increased expression of ITPR1 protein CTD PMID:25921245 Itpr1 Rat linsidomine multiple interactions ISO ITPR1 (Homo sapiens) 6480464 Cycloheximide inhibits the reaction [linsidomine results in increased expression of ITPR1 mRNA] and Dactinomycin inhibits the reaction [linsidomine results in increased expression of ITPR1 mRNA] CTD PMID:17241155 Itpr1 Rat linsidomine increases expression ISO ITPR1 (Homo sapiens) 6480464 linsidomine results in increased expression of ITPR1 mRNA CTD PMID:17241155 Itpr1 Rat losartan multiple interactions EXP 6480464 Losartan inhibits the reaction [Calcium Oxalate results in increased expression of ITPR1 protein] CTD PMID:37454925 Itpr1 Rat maneb multiple interactions ISO Itpr1 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of ITPR1 mRNA and Melatonin inhibits the reaction [[Maneb co-treated with Paraquat] results in decreased expression of ITPR1 mRNA] CTD PMID:23963992 Itpr1 Rat melatonin multiple interactions ISO Itpr1 (Mus musculus) 6480464 Melatonin inhibits the reaction [[Maneb co-treated with Paraquat] results in decreased expression of ITPR1 mRNA] CTD PMID:23963992 Itpr1 Rat metformin multiple interactions ISO ITPR1 (Homo sapiens) 6480464 Metformin inhibits the reaction [INS protein results in increased expression of ITPR1 protein] CTD PMID:36764371 Itpr1 Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of ITPR1 mRNA CTD PMID:30467583 Itpr1 Rat methidathion decreases expression ISO Itpr1 (Mus musculus) 6480464 methidathion results in decreased expression of ITPR1 mRNA CTD PMID:34813904 Itpr1 Rat methotrexate affects response to substance ISO ITPR1 (Homo sapiens) 6480464 ITPR1 protein affects the susceptibility to Methotrexate CTD PMID:16217747 Itpr1 Rat methotrexate increases expression ISO ITPR1 (Homo sapiens) 6480464 Methotrexate results in increased expression of ITPR1 mRNA CTD PMID:21678067 Itpr1 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of ITPR1 gene CTD PMID:35440735 Itpr1 Rat methylmercury chloride increases expression ISO ITPR1 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of ITPR1 mRNA CTD PMID:28001369 Itpr1 Rat methylmercury chloride increases expression EXP 6480464 methylmercuric chloride results in increased expression of ITPR1 mRNA and methylmercuric chloride results in increased expression of ITPR1 protein CTD PMID:35678294 Itpr1 Rat methylseleninic acid increases expression ISO ITPR1 (Homo sapiens) 6480464 methylselenic acid results in increased expression of ITPR1 mRNA CTD PMID:18548127 Itpr1 Rat N-hexadecanoylsphingosine multiple interactions ISO Itpr1 (Mus musculus) 6480464 [N-palmitoylsphingosine co-treated with Dietary Fats] results in increased expression of ITPR1 mRNA more ... CTD PMID:28223344 Itpr1 Rat N-hexadecanoylsphingosine increases expression ISO Itpr1 (Mus musculus) 6480464 N-palmitoylsphingosine results in increased expression of ITPR1 mRNA CTD PMID:28223344 Itpr1 Rat nevirapine increases expression EXP 6480464 Nevirapine results in increased expression of ITPR1 mRNA CTD PMID:23947594 Itpr1 Rat nickel atom decreases expression ISO ITPR1 (Homo sapiens) 6480464 Nickel results in decreased expression of ITPR1 mRNA CTD PMID:25583101 Itpr1 Rat O-methyleugenol decreases expression ISO ITPR1 (Homo sapiens) 6480464 methyleugenol results in decreased expression of ITPR1 mRNA CTD PMID:32234424 Itpr1 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of ITPR1 mRNA CTD PMID:25729387 Itpr1 Rat oxycodone increases expression EXP 6480464 Oxycodone results in increased expression of ITPR1 mRNA CTD PMID:23439660 Itpr1 Rat ozone increases expression EXP 6480464 Ozone results in increased expression of ITPR1 mRNA CTD PMID:35737395 Itpr1 Rat ozone multiple interactions ISO ITPR1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with Ozone] results in increased expression of ITPR1 mRNA CTD PMID:32845096 Itpr1 Rat paracetamol affects expression ISO Itpr1 (Mus musculus) 6480464 Acetaminophen affects the expression of ITPR1 mRNA CTD PMID:17562736 Itpr1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of ITPR1 mRNA CTD PMID:33387578 Itpr1 Rat paracetamol increases expression ISO ITPR1 (Homo sapiens) 6480464 Acetaminophen results in increased expression of ITPR1 mRNA CTD PMID:22230336 and PMID:29067470 Itpr1 Rat paraquat multiple interactions ISO Itpr1 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of ITPR1 mRNA and Melatonin inhibits the reaction [[Maneb co-treated with Paraquat] results in decreased expression of ITPR1 mRNA] CTD PMID:23963992 Itpr1 Rat PCB138 multiple interactions ISO Itpr1 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Itpr1 Rat PCB138 increases expression EXP 6480464 2 more ... CTD PMID:21673325 Itpr1 Rat perfluorohexanesulfonic acid decreases expression ISO Itpr1 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in decreased expression of ITPR1 mRNA CTD PMID:37995155 Itpr1 Rat perfluorononanoic acid increases expression ISO ITPR1 (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in increased expression of ITPR1 mRNA CTD PMID:32588087 Itpr1 Rat perfluorooctane-1-sulfonic acid increases expression EXP 6480464 perfluorooctane sulfonic acid results in increased expression of ITPR1 mRNA CTD PMID:20136073 Itpr1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Itpr1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of ITPR1 mRNA more ... CTD PMID:28288859 and PMID:36331819 Itpr1 Rat perfluorooctanoic acid increases expression ISO ITPR1 (Homo sapiens) 6480464 perfluorooctanoic acid results in increased expression of ITPR1 mRNA CTD PMID:36326898 Itpr1 Rat phenethyl caffeate multiple interactions ISO Itpr1 (Mus musculus) 6480464 [caffeic acid phenethyl ester co-treated with Dietary Fats] results in decreased expression of ITPR1 mRNA more ... CTD PMID:28223344 Itpr1 Rat phenobarbital affects expression ISO ITPR1 (Homo sapiens) 6480464 Phenobarbital affects the expression of ITPR1 mRNA CTD PMID:19084549 Itpr1 Rat phorbol 13-acetate 12-myristate decreases expression ISO ITPR1 (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate results in decreased expression of ITPR1 protein alternative form CTD PMID:24073338 Itpr1 Rat pirinixic acid decreases expression ISO Itpr1 (Mus musculus) 6480464 pirinixic acid results in decreased expression of ITPR1 mRNA CTD PMID:17426115 Itpr1 Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of ITPR1 mRNA CTD PMID:12832660 Itpr1 Rat potassium chloride increases expression EXP 6480464 Potassium Chloride results in increased expression of ITPR1 mRNA CTD PMID:16412482 Itpr1 Rat procaine multiple interactions ISO ITPR1 (Homo sapiens) 6480464 HRH1 protein affects the reaction [Procaine results in increased phosphorylation of ITPR1 protein] CTD PMID:32061592 Itpr1 Rat procaine increases phosphorylation ISO ITPR1 (Homo sapiens) 6480464 Procaine results in increased phosphorylation of ITPR1 protein CTD PMID:32061592 Itpr1 Rat progesterone multiple interactions ISO ITPR1 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of ITPR1 mRNA CTD PMID:20660070 Itpr1 Rat propanal increases expression ISO ITPR1 (Homo sapiens) 6480464 propionaldehyde results in increased expression of ITPR1 mRNA CTD PMID:26079696 Itpr1 Rat propiconazole increases expression ISO Itpr1 (Mus musculus) 6480464 propiconazole results in increased expression of ITPR1 mRNA CTD PMID:19363144 and PMID:21278054 Itpr1 Rat pyrazinecarboxamide decreases expression EXP 6480464 Pyrazinamide results in decreased expression of ITPR1 mRNA CTD PMID:22431067 Itpr1 Rat quercetin decreases expression ISO ITPR1 (Homo sapiens) 6480464 Quercetin results in decreased expression of ITPR1 mRNA CTD PMID:21632981 Itpr1 Rat quercetin multiple interactions ISO ITPR1 (Homo sapiens) 6480464 [Quercetin co-treated with dinitrophenyl-human serum albumin conjugate] results in decreased phosphorylation of ITPR1 protein CTD PMID:31672514 Itpr1 Rat resveratrol multiple interactions ISO ITPR1 (Homo sapiens) 6480464 [Coumestrol co-treated with Resveratrol] results in decreased expression of ITPR1 mRNA and [Plant Extracts co-treated with Resveratrol] results in increased expression of ITPR1 mRNA CTD PMID:19167446 and PMID:23557933 Itpr1 Rat resveratrol increases expression ISO ITPR1 (Homo sapiens) 6480464 resveratrol results in increased expression of ITPR1 mRNA CTD PMID:23137833 Itpr1 Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of ITPR1 mRNA CTD PMID:28374803 Itpr1 Rat sarin decreases expression ISO ITPR1 (Homo sapiens) 6480464 Sarin results in decreased expression of ITPR1 mRNA CTD PMID:19522546 Itpr1 Rat SB 431542 multiple interactions ISO ITPR1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Itpr1 Rat scopolamine increases expression EXP 6480464 Scopolamine results in increased expression of ITPR1 mRNA CTD PMID:12818353 Itpr1 Rat silicon dioxide increases expression ISO ITPR1 (Homo sapiens) 6480464 Silicon Dioxide results in increased expression of ITPR1 mRNA CTD PMID:25351596 Itpr1 Rat sodium arsenite multiple interactions ISO ITPR1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of and affects the splicing of ITPR1 mRNA CTD PMID:25879800 Itpr1 Rat sodium arsenite increases expression ISO Itpr1 (Mus musculus) 6480464 sodium arsenite results in increased expression of ITPR1 mRNA CTD PMID:36209798 Itpr1 Rat sodium arsenite increases expression ISO ITPR1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of ITPR1 mRNA CTD PMID:38568856 Itpr1 Rat sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of ITPR1 mRNA and sodium arsenite results in decreased expression of ITPR1 protein CTD PMID:29459688 and PMID:35314868 Itpr1 Rat sodium dichromate affects expression EXP 6480464 sodium bichromate affects the expression of ITPR1 mRNA CTD PMID:22110744 Itpr1 Rat sodium dichromate decreases expression ISO Itpr1 (Mus musculus) 6480464 sodium bichromate results in decreased expression of ITPR1 mRNA CTD PMID:22561333 Itpr1 Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of ITPR1 mRNA CTD PMID:22561333 Itpr1 Rat sodium dodecyl sulfate increases expression ISO ITPR1 (Homo sapiens) 6480464 Sodium Dodecyl Sulfate results in increased expression of ITPR1 mRNA CTD PMID:31734321 Itpr1 Rat Soman decreases expression EXP 6480464 Soman results in decreased expression of ITPR1 mRNA CTD PMID:19281266 Itpr1 Rat succimer multiple interactions ISO ITPR1 (Homo sapiens) 6480464 [Succimer co-treated with Magnetite Nanoparticles] results in increased expression of ITPR1 mRNA CTD PMID:26378955 Itpr1 Rat sulindac sulfide decreases expression ISO ITPR1 (Homo sapiens) 6480464 sulindac sulfide results in decreased expression of ITPR1 mRNA CTD PMID:15767558 Itpr1 Rat sunitinib increases expression ISO ITPR1 (Homo sapiens) 6480464 Sunitinib results in increased expression of ITPR1 mRNA CTD PMID:31533062 Itpr1 Rat tamoxifen multiple interactions ISO ITPR1 (Homo sapiens) 6480464 Tamoxifen inhibits the reaction [Estradiol results in decreased expression of ITPR1 mRNA] CTD PMID:19426747 Itpr1 Rat tamoxifen affects expression ISO Itpr1 (Mus musculus) 6480464 Tamoxifen affects the expression of ITPR1 mRNA CTD PMID:17555576 Itpr1 Rat tamoxifen increases expression ISO ITPR1 (Homo sapiens) 6480464 Tamoxifen results in increased expression of ITPR1 mRNA CTD PMID:19426747 Itpr1 Rat tauroursodeoxycholic acid multiple interactions ISO Itpr1 (Mus musculus) 6480464 ursodoxicoltaurine inhibits the reaction [[N-palmitoylsphingosine co-treated with Dietary Fats] results in increased expression of ITPR1 mRNA] and ursodoxicoltaurine inhibits the reaction [N-palmitoylsphingosine results in increased expression of ITPR1 mRNA] CTD PMID:28223344 Itpr1 Rat testosterone affects expression ISO ITPR1 (Homo sapiens) 6480464 Testosterone affects the expression of ITPR1 mRNA CTD PMID:21592394 Itpr1 Rat testosterone decreases expression ISO ITPR1 (Homo sapiens) 6480464 Testosterone results in decreased expression of ITPR1 mRNA CTD PMID:21592394 Itpr1 Rat testosterone multiple interactions ISO ITPR1 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of ITPR1 mRNA and Testosterone promotes the reaction [Calcitriol results in increased expression of ITPR1 mRNA] CTD PMID:21592394 Itpr1 Rat thapsigargin increases expression ISO Itpr1 (Mus musculus) 6480464 Thapsigargin results in increased expression of ITPR1 mRNA CTD PMID:28223344 Itpr1 Rat thapsigargin decreases expression EXP 6480464 Thapsigargin results in decreased expression of ITPR1 protein CTD PMID:35544339 Itpr1 Rat thiamethoxam decreases expression ISO Itpr1 (Mus musculus) 6480464 Thiamethoxam results in decreased expression of ITPR1 mRNA CTD PMID:33533595 Itpr1 Rat thifluzamide increases expression ISO ITPR1 (Homo sapiens) 6480464 thifluzamide results in increased expression of ITPR1 mRNA CTD PMID:33512557 Itpr1 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of ITPR1 mRNA CTD PMID:23411599 Itpr1 Rat toluene affects expression EXP 6480464 Toluene affects the expression of ITPR1 mRNA CTD PMID:21827849 Itpr1 Rat topiramate increases expression EXP 6480464 topiramate results in increased expression of ITPR1 mRNA CTD PMID:16979414 Itpr1 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of ITPR1 mRNA CTD PMID:25729387 Itpr1 Rat trichostatin A increases expression ISO ITPR1 (Homo sapiens) 6480464 trichostatin A results in increased expression of ITPR1 mRNA CTD PMID:24935251 and PMID:26272509 Itpr1 Rat trichostatin A affects expression ISO ITPR1 (Homo sapiens) 6480464 trichostatin A affects the expression of ITPR1 mRNA CTD PMID:28542535 Itpr1 Rat trichostatin A multiple interactions ISO ITPR1 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ITPR1 mRNA CTD PMID:27188386 Itpr1 Rat triphenyl phosphate affects expression ISO ITPR1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of ITPR1 mRNA CTD PMID:37042841 Itpr1 Rat trovafloxacin decreases expression ISO Itpr1 (Mus musculus) 6480464 trovafloxacin results in decreased expression of ITPR1 mRNA CTD PMID:35537566 Itpr1 Rat urethane increases expression ISO ITPR1 (Homo sapiens) 6480464 Urethane results in increased expression of ITPR1 mRNA CTD PMID:28818685 Itpr1 Rat valproic acid increases methylation ISO ITPR1 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of ITPR1 gene CTD PMID:29154799 Itpr1 Rat valproic acid affects splicing EXP 6480464 Valproic Acid affects the splicing of ITPR1 mRNA CTD PMID:29427782 Itpr1 Rat valproic acid multiple interactions ISO ITPR1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ITPR1 mRNA CTD PMID:27188386 Itpr1 Rat valproic acid increases expression ISO ITPR1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of ITPR1 mRNA CTD PMID:23179753 more ... Itpr1 Rat valproic acid affects expression ISO ITPR1 (Homo sapiens) 6480464 Valproic Acid affects the expression of ITPR1 mRNA CTD PMID:25979313 Itpr1 Rat vanillic acid multiple interactions ISO ITPR1 (Homo sapiens) 6480464 Vanillic Acid inhibits the reaction [INS protein results in increased expression of ITPR1 protein] CTD PMID:36764371 Itpr1 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of ITPR1 mRNA CTD PMID:15686871 Itpr1 Rat vincristine increases expression ISO ITPR1 (Homo sapiens) 6480464 Vincristine results in increased expression of ITPR1 mRNA CTD PMID:23649840 Itpr1 Rat vorinostat increases expression ISO ITPR1 (Homo sapiens) 6480464 vorinostat results in increased expression of ITPR1 mRNA CTD PMID:27188386 Itpr1 Rat xestospongin C multiple interactions ISO ITPR1 (Homo sapiens) 6480464 xestospongin C inhibits the reaction [Ethanol results in increased expression of and affects the localization of ITPR1 protein] CTD PMID:17241155 Itpr1 Rat XL147 multiple interactions ISO Itpr1 (Mus musculus) 6480464 XL147 inhibits the reaction [N-nitroso-tris-chloroethylurea results in increased expression of ITPR1 mRNA] CTD PMID:29891994
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
Itpr1 Rat ATP binding enables IDA 405650379 PMID:36376291 UniProt Itpr1 Rat calcium channel activity enables IEA InterPro:IPR000699 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Itpr1 Rat calcium channel activity enables IEA UniProtKB-KW:KW-0107 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Itpr1 Rat calcium channel inhibitor activity enables IEA UniProtKB:Q14643 and ensembl:ENSP000004976051600115 GO_REF:0000107 Ensembl GO_REF:0000107 Itpr1 Rat calcium channel inhibitor activity enables ISO ITPR1 (Homo sapiens) 1624291 PMID:16793548 RGD PMID:16793548 Itpr1 Rat calcium ion binding enables IBA PANTHER:PTN001010185 more ... 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Itpr1 Rat identical protein binding IPI Itpr1 (Rattus norvegicus) 13793385 homotetramerization RGD Itpr1 Rat identical protein binding enables IPI UniProtKB:P29994-1 13432250 PMID:26458101 IntAct Itpr1 Rat identical protein binding enables IPI UniProtKB:P29994-1 13432241 PMID:21827954 IntAct Itpr1 Rat inositol 1,4,5 trisphosphate binding enables ISS UniProtKB:P11881 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Itpr1 Rat inositol 1,4,5 trisphosphate binding enables IEA UniProtKB:P11881 and ensembl:ENSMUSP00000032192 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Itpr1 Rat inositol 1,4,5 trisphosphate binding enables IEA InterPro:IPR000493 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Itpr1 Rat inositol 1,4,5 trisphosphate binding enables IDA 405650379 PMID:36376291 UniProt Itpr1 Rat inositol 1,4,5 trisphosphate binding enables IBA MGI:96623 more ... 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Itpr1 Rat inositol 1,4,5 trisphosphate binding enables ISO Itpr1 (Mus musculus) 1624291 PMID:12442173 more ... RGD PMID:12442173 more ... Itpr1 Rat inositol 1,4,5 trisphosphate binding enables IEA UniRule:UR001527769 1600115 GO_REF:0000104 UniProt GO_REF:0000104 Itpr1 Rat inositol 1,4,5-trisphosphate receptor activity involved in regulation of postsynaptic cytosolic calcium levels enables IEA UniProtKB:P11881 and ensembl:ENSMUSP00000032192 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Itpr1 Rat inositol 1,4,5-trisphosphate receptor activity involved in regulation of postsynaptic cytosolic calcium levels enables ISO Itpr1 (Mus musculus) 1624291 PMID:11117745 RGD PMID:11117745 Itpr1 Rat inositol 1,4,5-trisphosphate-gated calcium channel activity IDA 6480876 RGD Itpr1 Rat inositol 1,4,5-trisphosphate-gated calcium channel activity enables IEA UniProtKB:P11881 and ensembl:ENSMUSP00000032192 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Itpr1 Rat inositol 1,4,5-trisphosphate-gated calcium channel activity enables ISO ITPR1 (Homo sapiens) 1624291 PMID:10620513 more ... RGD PMID:10620513 more ... Itpr1 Rat inositol 1,4,5-trisphosphate-gated calcium channel activity enables IEA InterPro:IPR000493 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Itpr1 Rat inositol 1,4,5-trisphosphate-gated calcium channel activity enables IEA UniProtKB:Q14643 and ensembl:ENSP000004976051600115 GO_REF:0000107 Ensembl GO_REF:0000107 Itpr1 Rat inositol 1,4,5-trisphosphate-gated calcium channel activity enables ISO Itpr1 (Mus musculus) 1624291 MGI:88031 PMID:10570150 more ... RGD PMID:10570150 more ... Itpr1 Rat inositol 1,4,5-trisphosphate-gated calcium channel activity enables IEA UniRule:UR001527769 1600115 GO_REF:0000104 UniProt GO_REF:0000104 Itpr1 Rat inositol 1,4,5-trisphosphate-gated calcium channel activity enables IEA ARBA:ARBA00026498 1600115 GO_REF:0000117 UniProt GO_REF:0000117 Itpr1 Rat inositol 1,4,5-trisphosphate-gated calcium channel activity enables IBA FB:FBgn0010051 more ... 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Itpr1 Rat inositol 1,4,5-trisphosphate-gated calcium channel activity enables ISS UniProtKB:P11881 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Itpr1 Rat inositol 1,4,5-trisphosphate-gated calcium channel activity enables IDA 405650256 PMID:22547632 UniProt Itpr1 Rat inositol 1,4,5-trisphosphate-gated calcium channel activity IDA 7175271 RGD Itpr1 Rat intracellularly gated calcium channel activity enables ISO Itpr1 (Mus musculus) 1624291 PMID:20813840 RGD PMID:20813840 Itpr1 Rat intracellularly gated calcium channel activity enables IEA UniProtKB:P11881 and ensembl:ENSMUSP00000032192 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Itpr1 Rat intracellularly gated calcium channel activity enables ISS UniProtKB:P11881 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Itpr1 Rat metal ion binding enables IEA UniProtKB-KW:KW-0479 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Itpr1 Rat monoatomic ion channel activity enables IEA InterPro:IPR005821 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Itpr1 Rat phosphatidylinositol binding enables ISS UniProtKB:P11881 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Itpr1 Rat phosphatidylinositol binding enables IBA MGI:96623 more ... 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Itpr1 Rat phosphatidylinositol binding enables ISO Itpr1 (Mus musculus) 1624291 PMID:17327232 more ... RGD PMID:17327232 more ... Itpr1 Rat phosphatidylinositol binding enables IEA UniProtKB:P11881 and ensembl:ENSMUSP00000032192 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Itpr1 Rat protein binding IPI ATXN3 (Homo sapiens) 6480876 RGD Itpr1 Rat protein binding enables IPI UniProtKB:P54256-1 6482800 PMID:12873381 IntAct Itpr1 Rat protein binding enables IPI UniProtKB:Q3U182 13432287 PMID:22495310 IntAct Itpr1 Rat protein binding enables ISO ITPR1 (Homo sapiens) 1624291 UniProtKB:O43865 more ... RGD PMID:16793548 more ... Itpr1 Rat protein binding enables IPI UniProtKB:P54256-2 6482800 PMID:12873381 IntAct Itpr1 Rat protein binding enables IPI UniProtKB:P61265 11535091 PMID:21424589 ParkinsonsUK-UCL Itpr1 Rat protein binding enables ISO Itpr1 (Mus musculus) 1624291 PR:P10417 more ... RGD PMID:10051594 more ... Itpr1 Rat protein binding enables IPI UniProtKB:P51111 6482800 PMID:12873381 IntAct Itpr1 Rat protein binding enables IPI UniProtKB:P42858 6482800 PMID:12873381 IntAct Itpr1 Rat protein binding enables IPI UniProtKB:P48721 and UniProtKB:Q9Z2L0 405650386 PMID:17178908 UniProt Itpr1 Rat protein binding IPI Epb41l1 (Rattus norvegicus) 7175275 protein C-terminus binding RGD Itpr1 Rat protein binding IPI Htt (Rattus norvegicus) 6482800 RGD Itpr1 Rat protein binding IPI Hap1 (Rattus norvegicus) 6482800 RGD Itpr1 Rat protein binding IPI EPB41L1 (Homo sapiens) 7175275 protein C-terminus binding RGD Itpr1 Rat protein binding IPI Vcp (Rattus norvegicus) 1599730 Ufd1 and Ufd2 RGD Itpr1 Rat protein binding IPI Akap9 (Rattus norvegicus) 1582340 RGD Itpr1 Rat protein binding IPI Epb41l1 (Rattus norvegicus) 6482800 RGD Itpr1 Rat protein domain specific binding enables IEA UniProtKB:P11881 and ensembl:ENSMUSP00000032192 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Itpr1 Rat protein domain specific binding enables ISO Itpr1 (Mus musculus) 1624291 UniProtKB:Q9CPW0 and PMID:32675284 RGD PMID:32675284 Itpr1 Rat protein homodimerization activity enables IEA UniProtKB:P11881 and ensembl:ENSMUSP00000032192 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Itpr1 Rat protein homodimerization activity enables ISO Itpr1 (Mus musculus) 1624291 PMID:28416699 RGD PMID:28416699 Itpr1 Rat protein phosphatase binding IDA 6482804 calcineurin RGD Itpr1 Rat protein-containing complex binding IDA 6482804 Bcl-2 and calcineurin RGD Itpr1 Rat transmembrane transporter binding IPI Ano1 (Rattus norvegicus) 14696826 RGD
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(-)-demecolcine (ISO) (1->4)-beta-D-glucan (ISO) (E)-thiamethoxam (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP,ISO) 1D-myo-inositol 1,4,5-trisphosphate (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3,3',5-triiodo-L-thyronine (EXP) 3,4-methylenedioxymethamphetamine (ISO) 3-methylcholanthrene (ISO) 3-nitropropanoic acid (EXP) 3H-1,2-dithiole-3-thione (EXP) 4,4'-diisothiocyano-trans-stilbene-2,2'-disulfonic acid (ISO) 4,4'-sulfonyldiphenol (ISO) 4-amino-2,6-dinitrotoluene (EXP) 4-hydroxyphenyl retinamide (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) 7,12-dimethyltetraphene (ISO) 7,9-dihydro-1H-purine-2,6,8(3H)-trione (ISO) acetaldehyde (ISO) acrolein (ISO) acrylamide (EXP) actinomycin D (ISO) aflatoxin B1 (EXP,ISO) all-trans-retinoic acid (ISO) ammonium acetate (EXP) ammonium chloride (EXP) amphetamine (EXP) Anemoside B4 (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) atrazine (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bexarotene (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) bisphenol F (ISO) bleomycin A5 (ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) caffeine (ISO) calcitriol (ISO) calcium atom (ISO) calcium oxalate (EXP) calcium(0) (ISO) carbon nanotube (ISO) CGP 52608 (ISO) clofibrate (ISO) cobalt dichloride (EXP,ISO) cocaine (EXP,ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) coumestrol (ISO) Cuprizon (EXP) cycloheximide (ISO) cypermethrin (EXP,ISO) dexamethasone (ISO) diarsenic trioxide (ISO) dibutyl phthalate (EXP) dicrotophos (ISO) diuron (EXP) Doramectin (EXP) dorsomorphin (ISO) doxorubicin (EXP) elaidic acid (EXP) emodin (ISO) endosulfan (EXP) Enterolactone (ISO) entinostat (ISO) epoxiconazole (ISO) ethanol (ISO) etoposide (ISO) fenthion (ISO) fenvalerate (ISO) flavonoids (EXP) folic acid (ISO) fomepizole (ISO) formaldehyde (ISO) FR900359 (ISO) genistein (ISO) glyoxylic acid (EXP) glyphosate (ISO) GW 4064 (ISO) halothane (ISO) homocysteine (ISO) hydrogen peroxide (ISO) ketoconazole (EXP) L-ascorbic acid (EXP) lead diacetate (ISO) lead(0) (EXP) linsidomine (ISO) losartan (EXP) maneb (ISO) melatonin (ISO) metformin (ISO) methapyrilene (EXP) methidathion (ISO) methotrexate (ISO) methoxychlor (EXP) methylmercury chloride (EXP,ISO) methylseleninic acid (ISO) N-hexadecanoylsphingosine (ISO) nevirapine (EXP) nickel atom (ISO) O-methyleugenol (ISO) oxaliplatin (EXP) oxycodone (EXP) ozone (EXP,ISO) paracetamol (EXP,ISO) paraquat (ISO) PCB138 (EXP,ISO) perfluorohexanesulfonic acid (ISO) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (EXP,ISO) perfluorooctanoic acid (ISO) phenethyl caffeate (ISO) phenobarbital (ISO) phorbol 13-acetate 12-myristate (ISO) pirinixic acid (EXP,ISO) potassium chloride (EXP) procaine (ISO) progesterone (ISO) propanal (ISO) propiconazole (ISO) pyrazinecarboxamide (EXP) quercetin (ISO) resveratrol (ISO) rotenone (EXP) sarin (ISO) SB 431542 (ISO) scopolamine (EXP) silicon dioxide (ISO) sodium arsenite (EXP,ISO) sodium dichromate (EXP,ISO) sodium dodecyl sulfate (ISO) Soman (EXP) succimer (ISO) sulindac sulfide (ISO) sunitinib (ISO) tamoxifen (ISO) tauroursodeoxycholic acid (ISO) testosterone (ISO) thapsigargin (EXP,ISO) thiamethoxam (ISO) thifluzamide (ISO) thioacetamide (EXP) toluene (EXP) topiramate (EXP) topotecan (EXP) trichostatin A (ISO) triphenyl phosphate (ISO) trovafloxacin (ISO) urethane (ISO) valproic acid (EXP,ISO) vanillic acid (ISO) vinclozolin (EXP) vincristine (ISO) vorinostat (ISO) xestospongin C (ISO) XL147 (ISO)
Biological Process
apoptotic process (IEA) calcium import into the mitochondrion (IMP) calcium ion transmembrane transport (IEA) calcium ion transport (IEA,ISO) calcium-mediated signaling (IEA) cell morphogenesis (IEA,ISO) cellular response to cAMP (IDA) cellular response to hypoxia (IEP) dendrite development (IEP) endoplasmic reticulum calcium ion homeostasis (IEA,ISO) epithelial fluid transport (IEA,ISO) intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress (IEA,ISO,ISS) ligand-gated ion channel signaling pathway (IEA,ISO) liver regeneration (IMP) monoatomic ion transmembrane transport (IEA) monoatomic ion transport (IEA) negative regulation of apoptotic process (IMP) negative regulation of calcium-mediated signaling (IEA,ISO) phospholipase C-activating G protein-coupled acetylcholine receptor signaling pathway (IEA,ISO) phospholipase C-activating G protein-coupled receptor signaling pathway (IDA,IEA,ISO) positive regulation of apoptotic process (IEA,IMP,ISO) positive regulation of calcium ion transport (IDA) positive regulation of cytosolic calcium ion concentration (IMP) positive regulation of hepatocyte proliferation (IMP) positive regulation of insulin secretion (IEA,ISO) positive regulation of neuron projection development (IMP) post-embryonic development (IEA,ISO) protein homotetramerization (IDA,IEA,ISO,ISS) regulation of cytosolic calcium ion concentration (IEA,ISO,ISS) regulation of postsynaptic cytosolic calcium ion concentration (IEA) release of sequestered calcium ion into cytosol (IBA,IEA,IMP,ISO) release of sequestered calcium ion into cytosol by endoplasmic reticulum (IEA,ISO,ISS) response to hypoxia (IEA,ISO) single fertilization (IEA,ISO,ISS) transmembrane transport (IEA) voluntary musculoskeletal movement (IEA,ISO)
Cellular Component
calcineurin complex (IEA,ISO) cytoplasm (IEA,ISO) cytoplasmic vesicle (IEA) dendrite (IDA) endoplasmic reticulum (IEA,ISO) endoplasmic reticulum membrane (IBA,IDA,IEA,ISO,TAS) GABA-ergic synapse (IDA) membrane (IDA,IEA) neuronal cell body (IDA) nuclear envelope (IDA,IEA,ISO) nuclear inner membrane (IEA,ISO) nucleolus (IEA,ISO) perinuclear region of cytoplasm (IDA,IEA) plasma membrane (IBA) platelet dense granule membrane (IEA,ISO) platelet dense tubular network (IEA,ISO) postsynapse (IDA) postsynaptic density (IEA,ISO) presynapse (IDA) protein-containing complex (IDA,IEA,ISO) sarcoplasmic reticulum (IBA,IDA,IEA,ISO) Schaffer collateral - CA1 synapse (IEA,ISO) secretory granule membrane (IBA) smooth endoplasmic reticulum membrane (IDA) synapse (IEA,ISO) synaptic membrane (IDA) transport vesicle membrane (IEA)
Molecular Function
ATP binding (IDA) calcium channel activity (IEA) calcium channel inhibitor activity (IEA,ISO) calcium ion binding (IBA) identical protein binding (IPI) inositol 1,4,5 trisphosphate binding (IBA,IDA,IEA,ISO,ISS) inositol 1,4,5-trisphosphate receptor activity involved in regulation of postsynaptic cytosolic calcium levels (IEA,ISO) inositol 1,4,5-trisphosphate-gated calcium channel activity (IBA,IDA,IEA,ISO,ISS) intracellularly gated calcium channel activity (IEA,ISO,ISS) metal ion binding (IEA) monoatomic ion channel activity (IEA) phosphatidylinositol binding (IBA,IEA,ISO,ISS) protein binding (IPI,ISO) protein domain specific binding (IEA,ISO) protein homodimerization activity (IEA,ISO) protein phosphatase binding (IDA) protein-containing complex binding (IDA) transmembrane transporter binding (IPI)
1.
Involvement of the p97-Ufd1-Npl4 complex in the regulated endoplasmic reticulum-associated degradation of inositol 1,4,5-trisphosphate receptors.
Alzayady KJ, etal., J Biol Chem. 2005 Oct 14;280(41):34530-7. Epub 2005 Aug 15.
2.
Fragmented inositol 1,4,5-trisphosphate receptors retain tetrameric architecture and form functional Ca2+ release channels.
Alzayady KJ, etal., J Biol Chem. 2013 Apr 19;288(16):11122-34. doi: 10.1074/jbc.M113.453241. Epub 2013 Mar 11.
3.
The homocysteine-inducible endoplasmic reticulum (ER) stress protein Herp counteracts mutant alpha-synuclein-induced ER stress via the homeostatic regulation of ER-resident calcium release channel proteins.
Belal C, etal., Hum Mol Genet. 2012 Mar 1;21(5):963-77. doi: 10.1093/hmg/ddr502. Epub 2011 Nov 1.
4.
Enhanced hypoxic preconditioning by isoflurane: signaling gene expression and requirement of intracellular Ca2+ and inositol triphosphate receptors.
Bickler PE and Fahlman CS, Brain Res. 2010 Jun 22;1340:86-95. Epub 2010 Apr 29.
5.
Nuclear inositol 1,4,5-trisphosphate receptors regulate local Ca2+ transients and modulate cAMP response element binding protein phosphorylation.
Cardenas C, etal., J Cell Sci. 2005 Jul 15;118(Pt 14):3131-40.
6.
Deranged calcium signaling and neurodegeneration in spinocerebellar ataxia type 3.
Chen X, etal., J Neurosci. 2008 Nov 26;28(48):12713-24.
7.
Ins(1,4,5)P3 receptor type 1 associates with AKAP9 (AKAP450 variant) and protein kinase A type IIbeta in the Golgi apparatus in cerebellar granule cells.
Collado-Hilly M and Coquil JF, Biol Cell. 2009 Jun 4;101(8):469-80. doi: 10.1042/BC20080184.
8.
Inositol 1,4,5-trisphosphate receptors: distinct neuronal and nonneuronal forms derived by alternative splicing differ in phosphorylation.
Danoff SK, etal., Proc Natl Acad Sci U S A 1991 Apr 1;88(7):2951-5.
9.
Two Italian families with ITPR1 gene deletion presenting a broader phenotype of SCA15.
Di Gregorio E, etal., Cerebellum. 2010 Mar;9(1):115-23.
10.
Domoic acid enhances Bcl-2-calcineurin-inositol-1,4,5-trisphosphate receptor interactions and delayed neuronal death in rat brain slices.
Erin N and Billingsley ML, Brain Res. 2004 Jul 16;1014(1-2):45-52.
11.
Conformational motions and ligand-binding underlying gating and regulation in IP3R channel.
Fan G, etal., Nat Commun. 2022 Nov 14;13(1):6942. doi: 10.1038/s41467-022-34574-1.
12.
Gating machinery of InsP3R channels revealed by electron cryomicroscopy.
Fan G, etal., Nature. 2015 Nov 19;527(7578):336-41. doi: 10.1038/nature15249. Epub 2015 Oct 12.
13.
Subunit oligomerization, and topology of the inositol 1,4, 5-trisphosphate receptor.
Galvan DL, etal., J Biol Chem. 1999 Oct 8;274(41):29483-92. doi: 10.1074/jbc.274.41.29483.
14.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
15.
Defective calcium homeostasis in the cerebellum in a mouse model of Niemann-Pick A disease.
Ginzburg L and Futerman AH, J Neurochem. 2005 Dec;95(6):1619-28. Epub 2005 Nov 8.
16.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
17.
Intracerebroventricular administration of quinolinic acid induces a selective decrease of inositol(1,4,5)-trisphosphate receptor in rat brain.
Haug LS, etal., Neurochem Int. 1998 Aug;33(2):109-19.
18.
Decreased inositol (1,4,5)-trisphosphate receptor levels in Alzheimer's disease cerebral cortex: selectivity of changes and possible correlation to pathological severity.
Haug LS, etal., Neurodegeneration. 1996 Jun;5(2):169-76.
19.
Mechanism of ER stress-induced brain damage by IP(3) receptor.
Higo T, etal., Neuron. 2010 Dec 9;68(5):865-78.
20.
Regulation of Ca(2+) signaling in rat bile duct epithelia by inositol 1,4,5-trisphosphate receptor isoforms.
Hirata K, etal., Hepatology 2002 Aug;36(2):284-96.
21.
Junctional membrane inositol 1,4,5-trisphosphate receptor complex coordinates sensitization of the silent EGF-induced Ca2+ signaling.
Hur EM, etal., J Cell Biol. 2005 May 23;169(4):657-67.
22.
Functional Role of Intracellular Calcium Receptor Inositol 1,4,5-Trisphosphate Type 1 in Rat Hippocampus after Neonatal Anoxia.
Ikebara JM, etal., PLoS One. 2017 Jan 10;12(1):e0169861. doi: 10.1371/journal.pone.0169861. eCollection 2017.
23.
Potentiation of NGF-induced neurite outgrowth in PC12 cells by papaverine: role played by PLC-¿, IP3 receptors.
Itoh K, etal., Brain Res. 2011 Mar 4;1377:32-40. doi: 10.1016/j.brainres.2010.12.075. Epub 2011 Jan 4.
24.
Activation of the Cl- channel ANO1 by localized calcium signals in nociceptive sensory neurons requires coupling with the IP3 receptor.
Jin X, etal., Sci Signal. 2013 Aug 27;6(290):ra73. doi: 10.1126/scisignal.2004184.
25.
Hypoxia modulates gene expression of IP3 receptors in rodent cerebellum.
Jurkovicova D, etal., Pflugers Arch. 2007 Jun;454(3):415-25. Epub 2007 Feb 7.
26.
Expression profiles of three isoforms of inositol 1,4,5-trisphosphate receptor in brown adipose tissue of the rat.
Kajimoto K, etal., Biochem Pharmacol 2003 Mar 15;65(6):995-8.
27.
Calpain-cleaved type 1 inositol 1,4,5-trisphosphate receptor (InsP(3)R1) has InsP(3)-independent gating and disrupts intracellular Ca(2+) homeostasis.
Kopil CM, etal., J Biol Chem. 2011 Oct 14;286(41):35998-6010. Epub 2011 Aug 22.
28.
Peripheral gene expression profile of mechanical hyperalgesia induced by repeated cold stress in SHRSP5/Dmcr rats.
Kozaki Y, etal., J Physiol Sci. 2015 Sep;65(5):417-25. doi: 10.1007/s12576-015-0380-9. Epub 2015 May 14.
29.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
30.
Proteasomal activation mediates down-regulation of inositol 1,4,5-trisphosphate receptor and calcium mobilization in rat pancreatic islets.
Lee B, etal., Endocrinology 2001 May;142(5):1744-51.
31.
Altered expression of type 1 inositol 1,4,5-trisphosphate receptor in the Ngsk Prnp deficient mice.
Lee HP, etal., Neuroscience. 2010 May 19;167(3):799-808. Epub 2010 Feb 26.
32.
Immobilization stress elevates IP(3) receptor mRNA in adult rat hearts in a glucocorticoid-dependent manner.
Lencesova L, etal., FEBS Lett 2002 Nov 20;531(3):432-6.
33.
The effect of substance P on asthmatic rat airway smooth muscle cell proliferation, migration, and cytoplasmic calcium concentration in vitro.
Li M, etal., J Inflamm (Lond). 2011 Jul 21;8(1):18.
34.
Polycystin 2 interacts with type I inositol 1,4,5-trisphosphate receptor to modulate intracellular Ca2+ signaling.
Li Y, etal., J Biol Chem. 2005 Dec 16;280(50):41298-306. Epub 2005 Oct 13.
35.
Flexible architecture of IP3R1 by Cryo-EM.
Ludtke SJ, etal., Structure. 2011 Aug 10;19(8):1192-9. doi: 10.1016/j.str.2011.05.003.
36.
SCA15 due to large ITPR1 deletions in a cohort of 333 white families with dominant ataxia.
Marelli C, etal., Arch Neurol. 2011 May;68(5):637-43.
37.
Type 1 inositol 1,4,5-trisphosphate receptor knock-out mice: their phenotypes and their meaning in neuroscience and clinical practice.
Matsumoto M and Nagata E, J Mol Med (Berl). 1999 May;77(5):406-11.
38.
Association of the type 1 inositol (1,4,5)-trisphosphate receptor with 4.1N protein in neurons.
Maximov A, etal., Mol Cell Neurosci. 2003 Feb;22(2):271-83.
39.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
40.
Structure and expression of the rat inositol 1,4,5-trisphosphate receptor.
Mignery GA, etal., J Biol Chem 1990 Jul 25;265(21):12679-85.
41.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
42.
Inositol 1,4,5 trisphosphate receptor and chromogranin B are concentrated in different regions of the hippocampus.
Nicolay NH, etal., J Neurosci Res. 2007 Jul;85(9):2026-36.
43.
Vitamin D and calcium co-therapy mitigates pre-established cadmium nephropathy by regulating renal calcium homeostatic molecules and improving anti-oxidative and anti-inflammatory activities in rat.
Obaid AA, etal., J Trace Elem Med Biol. 2023 May 24;79:127221. doi: 10.1016/j.jtemb.2023.127221.
44.
Calcium signalling from the type I inositol 1,4,5-trisphosphate receptor is required at early phase of liver regeneration.
Oliveira AG, etal., Liver Int. 2015 Apr;35(4):1162-71. doi: 10.1111/liv.12587. Epub 2014 Jun 2.
45.
Mapping a cardiomyopathy locus to chromosome 3p22-p25.
Olson TM and Keating MT, J Clin Invest 1996 Jan 15;97(2):528-32.
46.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
47.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
48.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
49.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
50.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
51.
Inositol 1,4,5-trisphosphate receptor expression in mammalian olfactory tissue.
Smutzer G, etal., Brain Res Mol Brain Res 1997 Mar;44(2):347-54.
52.
P400 protein is one of the major substrates for Ca2+/calmodulin-dependent protein kinase II in the postsynaptic density-enriched fraction isolated from rat cerebral cortex, hippocampus and cerebellum.
Suzuki T, etal., Neurochem Int. 1992 Jan;20(1):61-7.
53.
Chaperone-mediated coupling of endoplasmic reticulum and mitochondrial Ca2+ channels.
Szabadkai G, etal., J Cell Biol. 2006 Dec 18;175(6):901-11. doi: 10.1083/jcb.200608073.
54.
Ca2+ stores in Purkinje neurons: endoplasmic reticulum subcompartments demonstrated by the heterogeneous distribution of the InsP3 receptor, Ca(2+)-ATPase, and calsequestrin.
Takei K, etal., J Neurosci. 1992 Feb;12(2):489-505.
55.
Inositol 1, 4, 5-trisphosphate receptor interacts with the SNARE domain of syntaxin 1B.
Tanaka S, etal., J Physiol Sci. 2011 May;61(3):221-9. doi: 10.1007/s12576-011-0140-4. Epub 2011 Mar 20.
56.
Neuroprotective effects of inositol 1,4,5-trisphosphate receptor C-terminal fragment in a Huntington's disease mouse model.
Tang TS, etal., J Neurosci. 2009 Feb 4;29(5):1257-66.
57.
Huntingtin and huntingtin-associated protein 1 influence neuronal calcium signaling mediated by inositol-(1,4,5) triphosphate receptor type 1.
Tang TS, etal., Neuron. 2003 Jul 17;39(2):227-39.
58.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
59.
Regulation of inositol 1,4,5-trisphosphate receptors by cAMP independent of cAMP-dependent protein kinase.
Tovey SC, etal., J Biol Chem. 2010 Apr 23;285(17):12979-89. doi: 10.1074/jbc.M109.096016. Epub 2010 Feb 26.
60.
Functional characterization of mammalian inositol 1,4,5-trisphosphate receptor isoforms.
Tu H, etal., Biophys J. 2005 Feb;88(2):1046-55. Epub 2004 Nov 8.
61.
Regulation of inositol 1,4,5-trisphosphate-induced Ca2+ release by reversible phosphorylation and dephosphorylation.
Vanderheyden V, etal., Biochim Biophys Acta. 2009 Jun;1793(6):959-70. doi: 10.1016/j.bbamcr.2008.12.003. Epub 2008 Dec 16.
62.
Disrupted placental vitamin D metabolism and calcium signaling in gestational diabetes and pre-eclampsia patients.
Varshney S, etal., Endocrine. 2023 Apr;80(1):191-200. doi: 10.1007/s12020-022-03272-9. Epub 2022 Dec 8.
63.
Microtubule-dependent redistribution of the type-1 inositol 1,4,5-trisphosphate receptor in A7r5 smooth muscle cells.
Vermassen E, etal., J Cell Sci. 2003 Apr 1;116(Pt 7):1269-77.
64.
Differential regulation of the InsP₃ receptor type-1 and -2 single channel properties by InsP₃, Ca²⁺ and ATP.
Wagner LE and Yule DI, J Physiol. 2012 Jul 15;590(14):3245-59. doi: 10.1113/jphysiol.2012.228320. Epub 2012 Apr 30.
65.
Inositol-1,4,5-trisphosphate receptor regulates hepatic gluconeogenesis in fasting and diabetes.
Wang Y, etal., Nature. 2012 Apr 8;485(7396):128-32. doi: 10.1038/nature10988.
66.
Inositol 1,4,5-trisphosphate receptor 1 mutation perturbs glucose homeostasis and enhances susceptibility to diet-induced diabetes.
Ye R, etal., J Endocrinol. 2011 Aug;210(2):209-17. Epub 2011 May 12.
67.
In situ hybridization of mRNA expression for IP3 receptor and IP3-3-kinase in rat brain after transient focal cerebral ischemia.
Zhang SX, etal., Brain Res Mol Brain Res. 1995 Sep;32(2):252-60.
Itpr1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 142,743,401 - 143,066,505 (+) NCBI GRCr8 mRatBN7.2 4 141,187,377 - 141,554,240 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 141,187,418 - 141,510,491 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 146,609,417 - 146,932,882 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 142,390,143 - 142,713,600 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 141,034,101 - 141,357,581 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 140,247,297 - 140,580,749 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 140,247,313 - 140,580,748 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 204,714,729 - 205,047,901 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 143,705,360 - 144,030,051 NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 4 129,839,611 - 130,162,657 (+) NCBI Celera RH 3.4 Map 4 RGD Cytogenetic Map 4 q41 NCBI
ITPR1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 4,493,348 - 4,847,506 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 4,493,345 - 4,847,506 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 4,535,032 - 4,889,190 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 4,510,034 - 4,864,286 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 4,510,135 - 4,864,079 NCBI Celera 3 4,473,120 - 4,827,522 (+) NCBI Celera Cytogenetic Map 3 p26.1 NCBI HuRef 3 4,468,779 - 4,822,934 (+) NCBI HuRef CHM1_1 3 4,485,103 - 4,839,760 (+) NCBI CHM1_1 T2T-CHM13v2.0 3 4,487,354 - 4,841,309 (+) NCBI T2T-CHM13v2.0
Itpr1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 108,190,044 - 108,528,077 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 108,190,057 - 108,528,070 (+) Ensembl GRCm39 Ensembl GRCm38 6 108,213,083 - 108,551,116 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 108,213,096 - 108,551,109 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 108,163,090 - 108,501,108 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 108,178,895 - 108,516,886 (+) NCBI MGSCv36 mm8 Celera 6 110,018,018 - 110,348,287 (+) NCBI Celera Cytogenetic Map 6 E1- E2 NCBI cM Map 6 49.74 NCBI
ITPR1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 4,506,900 - 4,861,017 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 4,511,663 - 4,865,777 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 4,448,574 - 4,802,545 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 4,549,775 - 4,904,811 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 4,572,921 - 4,904,811 (+) Ensembl panpan1.1 panPan2
ITPR1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 12,746,171 - 13,065,256 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 12,747,315 - 13,064,198 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 12,719,920 - 13,038,750 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 12,789,247 - 13,108,309 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 12,789,627 - 13,108,328 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 12,494,231 - 12,813,462 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 12,835,196 - 13,153,754 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 12,821,769 - 13,140,816 (-) NCBI UU_Cfam_GSD_1.0
Itpr1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404942 10,941,137 - 11,243,016 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936577 3,896,390 - 4,198,411 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936577 3,896,455 - 4,198,396 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ITPR1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 61,068,126 - 61,398,912 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 61,068,131 - 61,398,918 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 67,499,295 - 67,702,956 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ITPR1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 22 40,574,569 - 40,925,857 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 22 40,574,374 - 40,926,842 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 125,743,247 - 126,095,217 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Itpr1
.
Predicted Target Of
Count of predictions: 2097 Count of miRNA genes: 288 Interacting mature miRNAs: 363 Transcripts: ENSRNOT00000040255, ENSRNOT00000041130, ENSRNOT00000043646, ENSRNOT00000064025 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
1582232 Gluco25 Glucose level QTL 25 3.6 0.0023 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 85253748 148090731 Rat 1358352 Srcrt3 Stress Responsive Cort QTL 3 2.29 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 38465774 146803430 Rat 1300116 Hrtrt5 Heart rate QTL 5 3.76 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 116179486 151161268 Rat 10755501 Bp390 Blood pressure QTL 390 2.5 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 4 26775591 168368347 Rat 631683 Bp116 Blood pressure QTL 116 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 124303370 169303370 Rat 61451 Ciaa4 CIA Autoantibody QTL 4 3.1 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 4 126395976 167139601 Rat 1331738 Bp209 Blood pressure QTL 209 2.979 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 138503169 179293946 Rat 1549827 Scl46 Serum cholesterol level QTL 46 3.5 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 4 132396220 177396220 Rat 731165 Uae21 Urinary albumin excretion QTL 21 2.4 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 4 106649412 151649412 Rat 737821 Hcar9 Hepatocarcinoma resistance QTL 9 3.7 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 4 109866907 167139601 Rat 7411558 Bw133 Body weight QTL 133 13.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 4 125590636 170590636 Rat 1549832 Bss3 Bone structure and strength QTL 3 11 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 4 109827074 154827074 Rat 70177 Xhs1 X-ray hypersensitivity QTL 1 25.1 intestine integrity trait (VT:0010554) post-insult time to onset of moribundity (CMO:0001896) 4 82798864 152731274 Rat 2303623 Vencon2 Ventilatory control QTL 2 3.8 respiration trait (VT:0001943) minute ventilation (CMO:0000132) 4 135204660 180204660 Rat 1578674 Bmd12 Bone mineral density QTL 12 3.8 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 4 135699135 180699135 Rat 1354660 Salc1 Saline consumption QTL 1 11.26 drinking behavior trait (VT:0001422) saline drink intake rate (CMO:0001627) 4 44463908 148090542 Rat 1298082 Stresp4 Stress response QTL 4 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 50119848 146803430 Rat 737978 Pia23 Pristane induced arthritis QTL 23 5.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 131730738 167139601 Rat 61362 Oia2 Oil induced arthritis QTL 2 0.001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 138503169 173369699 Rat 70201 Gcr1 Gastric cancer resistance QTL 1 2.7 stomach morphology trait (VT:0000470) stomach tumor susceptibility score (CMO:0002043) 4 120260281 147278687 Rat 70200 Alc18 Alcohol consumption QTL 18 9.2 drinking behavior trait (VT:0001422) ethanol intake volume to total fluid intake volume ratio (CMO:0001591) 4 56647873 149491524 Rat 2293659 Bmd35 Bone mineral density QTL 35 4.5 0.0001 femur strength trait (VT:0010010) femoral neck ultimate force (CMO:0001703) 4 137755016 181392681 Rat 1331759 Hrtrt13 Heart rate QTL 13 3.54628 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 110275411 168266883 Rat 724535 Cm18 Cardiac mass QTL 18 2.6 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 4 118856416 163856416 Rat 2316958 Gluco58 Glucose level QTL 58 10 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 11320076 180699135 Rat 2302049 Pia32 Pristane induced arthritis QTL 32 5.1 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112) 4 105789505 150789505 Rat 724558 Plsm2 Polydactyly-luxate syndrome (PLS) morphotypes QTL 2 0.0003 hindlimb integrity trait (VT:0010563) hind foot phalanges count (CMO:0001949) 4 132422778 177422778 Rat 6478763 Anxrr46 Anxiety related response QTL 46 0.07428 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 110870972 155870972 Rat 6478760 Anxrr45 Anxiety related response QTL 45 0.06717 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 110870972 155870972 Rat 1331802 Srn5 Serum renin concentration QTL 5 3.045 renin activity (VT:0005581) plasma renin activity level (CMO:0000116) 4 119428175 157578333 Rat 1298524 Oia8 Oil induced arthritis QTL 8 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 138503169 173369699 Rat 738009 Sach4 Saccharine consumption QTL 4 4.9 0.000016 consumption behavior trait (VT:0002069) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 4 59948935 154902892 Rat 2312567 Glom19 Glomerulus QTL 19 1.9 0.006 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 4 45456990 146803430 Rat 7207480 Bss105 Bone structure and strength QTL 105 8.1 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 4 109827074 154827074 Rat 634335 Anxrr16 Anxiety related response QTL 16 7.22 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 4 93308457 167139447 Rat 6478778 Anxrr51 Anxiety related response QTL 51 0.25384 locomotor behavior trait (VT:0001392) measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957) 4 124778595 169778595 Rat 61406 Scwia1 Streptococcal cell wall induced arthritis QTL 1 2.3 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 4 106805662 151805662 Rat 631511 Pia7 Pristane induced arthritis QTL 7 4.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 131730738 167139601 Rat 1354612 Foco1 Food consumption QTL 1 8.87 eating behavior trait (VT:0001431) food intake rate (CMO:0000427) 4 44463908 148090542 Rat 634347 Hcar8 Hepatocarcinoma resistance QTL 8 5.8 liver integrity trait (VT:0010547) liver tumorous lesion area to total liver area ratio (CMO:0001075) 4 123143783 168143783 Rat 2303168 Bp330 Blood pressure QTL 330 4.25 0.017 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 5214602 146446691 Rat 738031 Alc14 Alcohol consumption QTL 14 7.6 0.00003 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1576316 Ept5 Estrogen-induced pituitary tumorigenesis QTL 5 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 4 83428419 177635233 Rat 1576305 Emca6 Estrogen-induced mammary cancer QTL 6 5.8 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 4 44463720 155883716 Rat 738016 Alc16 Alcohol consumption QTL 16 3.6 0.00015 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1358202 Gluco11 Glucose level QTL 11 2.4 0.02 adipocyte glucose uptake trait (VT:0004185) absolute change in adipocyte glucose uptake (CMO:0000873) 4 85379421 167139601 Rat 61422 Cia13 Collagen induced arthritis QTL 13 4.5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 132642577 167139601 Rat 631674 Iddm14 Insulin dependent diabetes mellitus QTL 14 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 4 64528739 157573521 Rat 2293840 Kiddil9 Kidney dilation QTL 9 2.9 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 4 120926564 148090731 Rat 12798519 Anxrr54 Anxiety related response QTL 54 2.54 0.05 locomotor behavior trait (VT:0001392) distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493) 4 114627026 159627026 Rat 12798523 Anxrr56 Anxiety related response QTL 56 2.83 0.05 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 85253748 150276390 Rat 61434 Cia3 Collagen induced arthritis QTL 3 4.8 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 103194656 148194656 Rat 12798527 Anxrr58 Anxiety related response QTL 58 4.11 0.05 locomotor behavior trait (VT:0001392) distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493) 4 119463257 147278687 Rat
D4Rat195
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 141,356,262 - 141,356,570 (+) MAPPER mRatBN7.2 mRatBN7.2 4 141,356,262 - 141,356,469 (+) MAPPER mRatBN7.2 Rnor_6.0 4 140,425,986 - 140,426,192 NCBI Rnor6.0 Rnor_6.0 4 140,425,986 - 140,426,293 NCBI Rnor6.0 Rnor_5.0 4 204,893,198 - 204,893,404 UniSTS Rnor5.0 Rnor_5.0 4 204,893,198 - 204,893,505 UniSTS Rnor5.0 RGSC_v3.4 4 143,875,116 - 143,875,322 UniSTS RGSC3.4 RGSC_v3.4 4 143,875,116 - 143,875,423 UniSTS RGSC3.4 RGSC_v3.4 4 143,875,115 - 143,875,322 RGD RGSC3.4 RGSC_v3.1 4 144,119,957 - 144,120,163 RGD Celera 4 130,008,518 - 130,008,825 UniSTS Celera 4 130,008,518 - 130,008,724 UniSTS RH 3.4 Map 4 890.8 RGD RH 3.4 Map 4 890.8 UniSTS RH 2.0 Map 4 897.9 RGD SHRSP x BN Map 4 65.6899 RGD Cytogenetic Map 4 q41 UniSTS
D4Rat196
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 141,235,569 - 141,235,720 (+) MAPPER mRatBN7.2 Rnor_6.0 4 140,295,371 - 140,295,521 NCBI Rnor6.0 Rnor_5.0 4 204,762,862 - 204,763,012 UniSTS Rnor5.0 RGSC_v3.4 4 143,753,495 - 143,753,646 RGD RGSC3.4 RGSC_v3.4 4 143,753,496 - 143,753,646 UniSTS RGSC3.4 RGSC_v3.1 4 143,998,336 - 143,998,487 RGD Celera 4 129,887,354 - 129,887,504 UniSTS SHRSP x BN Map 4 65.65 RGD SHRSP x BN Map 4 65.65 UniSTS Cytogenetic Map 4 q41 UniSTS
D4Got259
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 141,480,540 - 141,480,804 (+) MAPPER mRatBN7.2 Rnor_6.0 4 140,550,598 - 140,550,861 NCBI Rnor6.0 Rnor_5.0 4 205,017,750 - 205,018,013 UniSTS Rnor5.0 RGSC_v3.4 4 144,000,102 - 144,000,365 UniSTS RGSC3.4 Celera 4 130,132,792 - 130,133,055 UniSTS Cytogenetic Map 4 q41 UniSTS
RH133754
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 4 142,878,751 - 142,878,932 (+) Marker Load Pipeline mRatBN7.2 4 141,322,729 - 141,322,910 (+) MAPPER mRatBN7.2 Rnor_6.0 4 140,382,763 - 140,382,943 NCBI Rnor6.0 Rnor_5.0 4 204,850,254 - 204,850,434 UniSTS Rnor5.0 RGSC_v3.4 4 143,841,369 - 143,841,549 UniSTS RGSC3.4 Celera 4 129,974,518 - 129,974,698 UniSTS RH 3.4 Map 4 885.6 UniSTS Cytogenetic Map 4 q41 UniSTS
RH94529
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 141,510,212 - 141,510,376 (+) MAPPER mRatBN7.2 Rnor_6.0 4 140,580,470 - 140,580,633 NCBI Rnor6.0 Rnor_5.0 4 205,047,622 - 205,047,785 UniSTS Rnor5.0 RGSC_v3.4 4 144,029,773 - 144,029,936 UniSTS RGSC3.4 Celera 4 130,162,378 - 130,162,541 UniSTS RH 3.4 Map 4 890.9 UniSTS Cytogenetic Map 4 q41 UniSTS
RH140203
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 4 143,065,958 - 143,066,152 (+) Marker Load Pipeline mRatBN7.2 4 141,509,945 - 141,510,139 (+) MAPPER mRatBN7.2 Rnor_6.0 4 140,580,203 - 140,580,396 NCBI Rnor6.0 Rnor_5.0 4 205,047,355 - 205,047,548 UniSTS Rnor5.0 RGSC_v3.4 4 144,029,506 - 144,029,699 UniSTS RGSC3.4 Celera 4 130,162,111 - 130,162,304 UniSTS RH 3.4 Map 4 886.7 UniSTS Cytogenetic Map 4 q41 UniSTS
AU048843
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 141,306,952 - 141,307,250 (+) MAPPER mRatBN7.2 Rnor_6.0 4 140,366,986 - 140,367,283 NCBI Rnor6.0 Rnor_5.0 4 204,834,477 - 204,834,774 UniSTS Rnor5.0 RGSC_v3.4 4 143,825,377 - 143,825,674 UniSTS RGSC3.4 Celera 4 129,958,745 - 129,959,042 UniSTS Cytogenetic Map 4 q41 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000040255 ⟹ ENSRNOP00000043615
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 4 140,247,313 - 140,579,675 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000041130 ⟹ ENSRNOP00000049540
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 141,209,285 - 141,510,491 (+) Ensembl Rnor_6.0 Ensembl 4 140,247,335 - 140,580,748 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000043646 ⟹ ENSRNOP00000048661
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 141,187,418 - 141,510,491 (+) Ensembl Rnor_6.0 Ensembl 4 140,247,335 - 140,580,748 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000064025 ⟹ ENSRNOP00000063885
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 141,187,418 - 141,510,491 (+) Ensembl Rnor_6.0 Ensembl 4 140,247,335 - 140,580,748 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000082723 ⟹ ENSRNOP00000075403
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 141,317,533 - 141,510,491 (+) Ensembl Rnor_6.0 Ensembl 4 140,377,565 - 140,579,477 (+) Ensembl
RefSeq Acc Id:
NM_001007235 ⟹ NP_001007236
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 142,743,440 - 143,066,505 (+) NCBI mRatBN7.2 4 141,187,418 - 141,510,492 (+) NCBI Rnor_6.0 4 140,247,335 - 140,580,749 (+) NCBI Rnor_5.0 4 204,714,729 - 205,047,901 (+) NCBI RGSC_v3.4 4 143,705,360 - 144,030,051 (+) RGD Celera 4 129,839,611 - 130,162,657 (+) NCBI
Sequence:
GAGAGAAAGCGCACGCCGAGAGGAGGTGTGGGTGTTCCGCTCCCATCCTAACGGAACGAGCTCCCTCTTCGCGGACATGGGATTGCCCAGCGGCTGCTAACCCCTGTCCTGGTCCTGATCCCTCAAAC
hide sequence
RefSeq Acc Id:
NM_001270596 ⟹ NP_001257525
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 142,743,440 - 143,066,505 (+) NCBI mRatBN7.2 4 141,187,418 - 141,510,492 (+) NCBI Rnor_6.0 4 140,247,335 - 140,580,749 (+) NCBI Rnor_5.0 4 204,714,729 - 205,047,901 (+) NCBI Celera 4 129,839,611 - 130,162,657 (+) NCBI
Sequence:
GAGAGAAAGCGCACGCCGAGAGGAGGTGTGGGTGTTCCGCTCCCATCCTAACGGAACGAGCTCC
hide sequence
RefSeq Acc Id:
NM_001270597 ⟹ NP_001257526
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 142,743,440 - 143,066,505 (+) NCBI mRatBN7.2 4 141,187,418 - 141,510,492 (+) NCBI Rnor_6.0 4 140,247,335 - 140,580,749 (+) NCBI Rnor_5.0 4 204,714,729 - 205,047,901 (+) NCBI Celera 4 129,839,611 - 130,162,657 (+) NCBI
Sequence:
GAGAGAAAGCGCACGCCGAGAGGAGGTGTGGGTGTTCCGCTCCCATCCTAACGGAACGAGCTCCCTCTTCGCGGACATGGGATTGCCCAGCGGCTGCTAACCCCTGTCCTGGTCCTGATCCCTCAAAC
hide sequence
RefSeq Acc Id:
XM_063285577 ⟹ XP_063141647
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 142,743,401 - 143,066,505 (+) NCBI
RefSeq Acc Id:
NP_001007236 ⟸ NM_001007235
- Peptide Label:
isoform 1
- UniProtKB:
Q62869 (UniProtKB/Swiss-Prot), P29994 (UniProtKB/Swiss-Prot), C7E1V2 (UniProtKB/TrEMBL), F1LQS8 (UniProtKB/TrEMBL)
- Sequence:
MSDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPEAGDLNNPPKKFRDCLFKLCPMNRYSAQKQFWKAAKPGANSTTDAVLLNKLHHAADLEKKQNETENRKLLGTVIQYGNVIQLLHLKS
hide sequence
RefSeq Acc Id:
NP_001257526 ⟸ NM_001270597
- Peptide Label:
isoform 3
- UniProtKB:
A0A0A0MY31 (UniProtKB/TrEMBL)
- Sequence:
MSDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPEAGDLNNPPKKFRDCLFKLCPMN
hide sequence
RefSeq Acc Id:
NP_001257525 ⟸ NM_001270596
- Peptide Label:
isoform 2
- UniProtKB:
Q62869 (UniProtKB/Swiss-Prot), P29994 (UniProtKB/Swiss-Prot)
- Sequence:
MSDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPEAGDLNNPPKKFRDCLFKLCPMNRYSAQKQFWKAAKPGANSTTDAVLLNKLHHAADLEKKQNETENRKLLGTVIQYGNVIQLLHLKS
hide sequence
Ensembl Acc Id:
ENSRNOP00000075403 ⟸ ENSRNOT00000082723
Ensembl Acc Id:
ENSRNOP00000049540 ⟸ ENSRNOT00000041130
Ensembl Acc Id:
ENSRNOP00000048661 ⟸ ENSRNOT00000043646
Ensembl Acc Id:
ENSRNOP00000043615 ⟸ ENSRNOT00000040255
Ensembl Acc Id:
ENSRNOP00000063885 ⟸ ENSRNOT00000064025
RefSeq Acc Id:
XP_063141647 ⟸ XM_063285577
- Peptide Label:
isoform X1
- UniProtKB:
A0A8J8XAG4 (UniProtKB/TrEMBL)
RGD ID: 13693288 Promoter ID: EPDNEW_R3807 Type: single initiation site Name: Itpr1_1 Description: inositol 1,4,5-trisphosphate receptor, type 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 4 140,247,229 - 140,247,289 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2011-08-02
Itpr1
inositol 1,4,5-trisphosphate receptor, type 1
Itpr1
inositol 1,4,5-triphosphate receptor, type 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-11-17
Itpr1
inositol 1,4,5-triphosphate receptor, type 1
Itpr1
inositol 1,4,5-triphosphate receptor 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2003-04-09
Itpr1
inositol 1,4,5-triphosphate receptor 1
inositol 1,4,5-triphosphate receptor type 1
Name updated
629478 APPROVED
2002-06-10
Itpr1
inositol 1,4,5-triphosphate receptor type 1
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_process
mobilizes calcium ion permeability in insulin secreting cells
68695
gene_process
plays a role in insulin secretion
68695
gene_regulation
down regulated in response to muscarinic receptor activation by carbachol
68695
gene_transcript
has two alternative splicing forms which are differentially expressed in a neuronal and non-neuronal manner
729259
