Symbol:
Gstt1
Name:
glutathione S-transferase theta 1
RGD ID:
2765
Description:
Enables alkylhalidase activity; glutathione peroxidase activity; and glutathione transferase activity. Involved in several processes, including dichloromethane metabolic process; response to selenium ion; and response to vitamin E. Predicted to be located in cytosol. Predicted to be active in cytoplasm. Biomarker of obesity and type 1 diabetes mellitus. Human ortholog(s) of this gene implicated in several diseases, including autoimmune disease (multiple); cancer (multiple); cardiovascular system disease (multiple); eye disease (multiple); and lung disease (multiple). Orthologous to human GSTT1 (glutathione S-transferase theta 1); PARTICIPATES IN glutathione conjugation pathway; paracetamol pharmacokinetics pathway; glutathione metabolic pathway; INTERACTS WITH (+)-schisandrin B; (E)-1,3-dichloropropene; (R,R,R)-alpha-tocopherol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
Glutathione S-transferase 1 (theta); glutathione S-transferase 5; glutathione S-transferase theta-1; glutathione S-transferase, theta 1; GST 5-5; GST class-theta-1; GSTYRS
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
GSTT1 (glutathione S-transferase theta 1)
RGD
RGD
Mus musculus (house mouse):
Gstt1 (glutathione S-transferase, theta 1)
RGD
RGD
Alliance orthologs 3
Mus musculus (house mouse):
Gstt1 (glutathione S-transferase, theta 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
GSTT1 (glutathione S-transferase theta 1)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
gstt1b (glutathione S-transferase theta 1b)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Danio rerio (zebrafish):
gstt1a (glutathione S-transferase theta 1a)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
GstT1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
GstT2
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
GstT3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
GstT4
Alliance
DIOPT (InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
gstt1
Alliance
DIOPT (OMA|OrthoFinder|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
gstt1l.2
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 12,856,068 - 12,873,020 (+) NCBI GRCr8 mRatBN7.2 20 12,856,613 - 12,873,586 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 12,856,669 - 12,873,585 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 13,563,264 - 13,580,163 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 12,924,193 - 12,941,104 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 13,396,180 - 13,413,203 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 13,799,102 - 13,816,527 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 13,799,102 - 13,816,526 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 15,989,083 - 16,006,508 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 13,604,355 - 13,621,456 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 13,604,582 - 13,621,683 (-) NCBI Celera 20 14,348,088 - 14,365,283 (+) NCBI Celera Cytogenetic Map 20 p12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Gstt1 Rat acute chest syndrome susceptibility ISO RGD:736934 10450838 associated with Anemia, Sickle Cell;DNA:deletion:: (human) RGD Gstt1 Rat acute lymphoblastic leukemia susceptibility ISO RGD:736934 10755410 RGD Gstt1 Rat acute lymphoblastic leukemia disease_progression ISO RGD:736934 10450829 RGD Gstt1 Rat acute myeloid leukemia disease_progression ISO RGD:736934 10755318 RGD Gstt1 Rat acute myeloid leukemia no_association ISO RGD:736934 10450779 RGD Gstt1 Rat acute myeloid leukemia susceptibility ISO RGD:736934 10450822 RGD Gstt1 Rat acute promyelocytic leukemia susceptibility ISO RGD:736934 10755406 RGD Gstt1 Rat aggressive periodontitis ISO RGD:736934 14700939 RGD Gstt1 Rat alcohol dependence ISO RGD:736934 14700988 RGD Gstt1 Rat Alcoholic Liver Diseases ISO RGD:736934 14700973 RGD Gstt1 Rat Alcoholic Liver Diseases ISO RGD:736934 11060494 RGD Gstt1 Rat Alzheimer's disease onset ISO RGD:736934 5490271 DNA:deletion: : RGD Gstt1 Rat Alzheimer's disease susceptibility ISO RGD:736934 5490213 DNA:deletion: : RGD Gstt1 Rat anemia ISO RGD:736934 10450867 associated with kidney transplantation; RGD Gstt1 Rat aplastic anemia susceptibility ISO RGD:736934 10450790 RGD Gstt1 Rat aplastic anemia no_association ISO RGD:736934 10450878 RGD Gstt1 Rat asthma ISO RGD:736934 5490962 RGD Gstt1 Rat asthma susceptibility ISO RGD:736934 4140921 DNA:deletion: : RGD Gstt1 Rat asthma ISO RGD:736934 4142539 RGD Gstt1 Rat atopic dermatitis ISO RGD:736934 5490540 DNA:deletion, haplotype: : RGD Gstt1 Rat beta thalassemia susceptibility ISO RGD:736934 10755320 DNA:deletion:: (human) RGD Gstt1 Rat breast cancer susceptibility ISO RGD:736934 2293799 DNA:deletion RGD Gstt1 Rat bronchopulmonary dysplasia susceptibility ISO RGD:736934 12792215 DNA:deletion, haplotype:: (human) RGD Gstt1 Rat cancer ISO RGD:736934 14701044 RGD Gstt1 Rat cardiovascular system disease severity ISO RGD:736934 2306630 associated with Diabetes Mellitus, Type 2;DNA:deletion:cds (human) RGD Gstt1 Rat cataract no_association ISO RGD:736934 7794839 DNA:deletion:cds (human) RGD Gstt1 Rat cataract susceptibility ISO RGD:736934 7794821 DNA:deletion:cds (human) RGD Gstt1 Rat cervical cancer susceptibility ISO RGD:736934 2293825 RGD Gstt1 Rat cervix carcinoma susceptibility ISO RGD:736934 7495819 DNA:deletion:cds (human) RGD Gstt1 Rat Chronic Bronchitis susceptibility ISO RGD:736934 4142512 DNA:deletion: : RGD Gstt1 Rat Chronic Hepatitis C ISO RGD:736934 14700966 RGD Gstt1 Rat chronic obstructive pulmonary disease susceptibility ISO RGD:736934 4140928 DNA:deletion: : RGD Gstt1 Rat chronic obstructive pulmonary disease ISO RGD:736934 4140939 associated with GSTM1 null mutation; DNA:deletion: : RGD Gstt1 Rat colorectal adenocarcinoma onset ISO RGD:736934 14701003 RGD Gstt1 Rat colorectal adenocarcinoma ISO RGD:736934 14700996 RGD Gstt1 Rat colorectal cancer ISO RGD:736934 14700995 RGD Gstt1 Rat colorectal cancer severity ISO RGD:736934 14700986 RGD Gstt1 Rat colorectal cancer ISO RGD:736934 11353274 DNA:deletion RGD Gstt1 Rat colorectal cancer no_association ISO RGD:736934 14700954 DNA:CNVs RGD Gstt1 Rat colorectal carcinoma ISO RGD:736934 14700936 RGD Gstt1 Rat Congenital Abnormalities susceptibility ISO RGD:736934 12792223 DNA:deletion:: (human) RGD Gstt1 Rat congenital heart disease susceptibility ISO RGD:736934 12792220 DNA:deletion, haplotype:: (human) RGD Gstt1 Rat coronary artery disease susceptibility ISO RGD:736934 2306633 DNA:deletion RGD Gstt1 Rat coronary artery disease susceptibility ISO RGD:736934 2306625 associated with Diabetes Mellitus, Non-Insulin-Dependent RGD Gstt1 Rat COVID-19 severity ISO RGD:736934 30309963 DNA:deletion: RGD Gstt1 Rat Crohn's disease susceptibility ISO RGD:736934 5490554 DNA:deletion: : RGD Gstt1 Rat cystic fibrosis severity ISO RGD:736934 12792207 DNA:deletion, haplotype:: (human) RGD Gstt1 Rat cystic fibrosis no_association ISO RGD:736934 14700942 RGD Gstt1 Rat cystic fibrosis no_association ISO RGD:736934 12792246 DNA:deletion: : (human) RGD Gstt1 Rat cystic fibrosis severity ISO RGD:736934 10401929 DNA:deletion:: (human) RGD Gstt1 Rat diabetes mellitus susceptibility ISO RGD:736934 5490997 DNA:deletion: : RGD Gstt1 Rat Diabetic Nephropathies no_association ISO RGD:736934 7495818 associated with Diabetes Mellitus, Type 1;DNA:deletion:cds (human) RGD Gstt1 Rat Diabetic Nephropathies disease_progression ISO RGD:736934 2306630 associated with Diabetes Mellitus, Type 2;DNA:deletion:cds (human) RGD Gstt1 Rat diabetic retinopathy no_association ISO RGD:736934 7495818 associated with Diabetes Mellitus, Type 1;DNA:deletion:cds (human) RGD Gstt1 Rat diabetic retinopathy disease_progression ISO RGD:736934 2306630 associated with Diabetes Mellitus, Type 2;DNA:deletion:cds (human) RGD Gstt1 Rat diffuse large B-cell lymphoma severity ISO RGD:736934 10450835 DNA:deletion:cds: RGD Gstt1 Rat drug allergy susceptibility ISO RGD:736934 5491000 DNA:deletion: : RGD Gstt1 Rat Drug-induced Anemia susceptibility ISO RGD:736934 10755330 associated with breast cancer RGD Gstt1 Rat Drug-Induced Immune Thrombocytopenia treatment ISO RGD:736934 10450835 associated with diffuse large B-cell lymphoma; DNA:deletion:cds: RGD Gstt1 Rat Drug-Induced Leukopenia severity ISO RGD:736934 10450835 associated with diffuse large B-cell lymphoma; DNA:deletion:cds: RGD Gstt1 Rat Drug-induced Neutropenia susceptibility ISO RGD:736934 10755330 associated with breast cancer RGD Gstt1 Rat end stage renal disease susceptibility ISO RGD:736934 2306631 associated with Diabetes Mellitus;DNA:deletion RGD Gstt1 Rat Epistaxis susceptibility ISO RGD:736934 7794809 DNA:deletion:cds (human) RGD Gstt1 Rat esophageal cancer ISO RGD:736934 14700969 RGD Gstt1 Rat Esophageal Neoplasms susceptibility ISO RGD:736934 5490562 DNA:deletion: : RGD Gstt1 Rat esophagus adenocarcinoma ISO RGD:736934 12792242 DNA:deletion:: (human) RGD Gstt1 Rat esophagus squamous cell carcinoma ISO RGD:736934 14700948 RGD Gstt1 Rat esophagus squamous cell carcinoma ISO RGD:736934 14700982 RGD Gstt1 Rat exfoliation syndrome no_association ISO RGD:736934 7495792 DNA:deletion:cds (human) RGD Gstt1 Rat exfoliation syndrome susceptibility ISO RGD:736934 7794822 DNA:deletion:cds (human) RGD Gstt1 Rat exfoliation syndrome ISO RGD:736934 7794853 mRNA:decreased expression:ciliary processes, iris (human) RGD Gstt1 Rat Fanconi anemia treatment ISO RGD:736934 10450839 RGD Gstt1 Rat Femur Head Necrosis susceptibility ISO RGD:736934 10450838 associated with sickle cell anemia; RGD Gstt1 Rat Fetal Growth Retardation ISO RGD:736934 12792219 DNA:deletion:: (human) RGD Gstt1 Rat Fetal Growth Retardation susceptibility ISO RGD:736934 10450795 DNA:deletion, haplotype:: (human) RGD Gstt1 Rat Fever treatment ISO RGD:736934 10450835 associated with diffuse large B-cell lymphoma; DNA:deletion:cds: RGD Gstt1 Rat head and neck cancer ISO RGD:736934 14700998 RGD Gstt1 Rat Hearing Loss, Noise-Induced no_association ISO RGD:736934 7794850 DNA:deletion:cds (human) RGD Gstt1 Rat Hearing Loss, Noise-Induced susceptibility ISO RGD:736934 7495798 DNA:deletion:cds (human) RGD Gstt1 Rat Hematologic Neoplasms susceptibility ISO RGD:736934 10450857 associated with Breast Neoplasms; RGD Gstt1 Rat hepatocellular carcinoma susceptibility ISO RGD:736934 14401714 DNA:deletion RGD Gstt1 Rat hepatocellular carcinoma no_association ISO RGD:736934 14700979 RGD Gstt1 Rat hepatocellular carcinoma ISO RGD:736934 14700951 RGD Gstt1 Rat Hirschsprung's disease susceptibility ISO RGD:736934 12792222 DNA:missense mutation:cds:p.V155I (human) (rs2266637) RGD Gstt1 Rat Hodgkin's lymphoma disease_progression ISO RGD:736934 10450802 RGD Gstt1 Rat hypertension ISO RGD:736934 401827127 DNA:deletion RGD Gstt1 Rat hypertension ISO RGD:736934 5490587 associated with scleroderma, systemic;DNA:deletion: : RGD Gstt1 Rat hypospadias ISO RGD:736934 11576313 DNA:deletion, haplotype: : (human) RGD Gstt1 Rat infectious mononucleosis susceptibility ISO RGD:736934 10450797 RGD Gstt1 Rat inflammatory bowel disease ISO RGD:736934 5490537 DNA:deletion: : RGD Gstt1 Rat Iron Overload ISO RGD:736934 10755320 associated with Beta-Thalassemia;DNA:deletion: : (human) RGD Gstt1 Rat juvenile rheumatoid arthritis susceptibility ISO RGD:736934 5490992 DNA:deletion: : RGD Gstt1 Rat Kidney Neoplasms susceptibility ISO RGD:736934 2293828 DNA:deletion RGD Gstt1 Rat Kidney Reperfusion Injury IEP 401827821 protein:decreased expression:kidney RGD Gstt1 Rat Kuhnt-Junius degeneration susceptibility ISO RGD:736934 12792224 DNA:deletion, haplotype:: (human) RGD Gstt1 Rat leukemia no_association ISO RGD:736934 10755326 RGD Gstt1 Rat leukopenia susceptibility ISO RGD:736934 10450844 RGD Gstt1 Rat Leukoplakia ISO RGD:736934 14701002 RGD Gstt1 Rat liver cirrhosis ISO RGD:736934 11097429 associated with Hepatitis C, Chronic RGD Gstt1 Rat liver disease ISO RGD:736934 14700987 associated with Graft vs Host Disease RGD Gstt1 Rat lung cancer susceptibility ISO RGD:736934 4140924 DNA:deletion: : RGD Gstt1 Rat lung disease ISO RGD:736934 5490587 associated with scleroderma, systemic;DNA:deletion: : RGD Gstt1 Rat lymphoid leukemia susceptibility ISO RGD:736934 10450797 RGD Gstt1 Rat Lynch syndrome ISO RGD:736934 12792228 DNA:deletion, haplotype:: (human) RGD Gstt1 Rat medulloblastoma ISO RGD:736934 5490237 DNA:deletion: : RGD Gstt1 Rat motor neuron disease susceptibility ISO RGD:736934 5490213 DNA:deletion: : RGD Gstt1 Rat Mouth Abnormalities no_association ISO RGD:736934 12792235 DNA:deletion:: (human) RGD Gstt1 Rat mucositis treatment ISO RGD:736934 10450835 associated with diffuse large B-cell lymphoma; DNA:deletion:cds: RGD Gstt1 Rat multiple myeloma susceptibility ISO RGD:736934 10450846 RGD Gstt1 Rat multiple myeloma no_association ISO RGD:736934 10450847 RGD Gstt1 Rat multiple sclerosis no_association ISO RGD:736934 5490267 DNA:deletion:: (human) RGD Gstt1 Rat multiple sclerosis ISO RGD:736934 12792225 DNA:deletion:: (human) RGD Gstt1 Rat myelodysplastic syndrome disease_progression ISO RGD:736934 10450840 RGD Gstt1 Rat myelodysplastic syndrome no_association ISO RGD:736934 10450779 RGD Gstt1 Rat myelodysplastic syndrome ISO RGD:736934 10450772 RGD Gstt1 Rat myeloid leukemia disease_progression ISO RGD:736934 10755327 RGD Gstt1 Rat myeloid leukemia no_association ISO RGD:736934 10755403 RGD Gstt1 Rat myeloid leukemia susceptibility ISO RGD:736934 10755324 RGD Gstt1 Rat Nasal Polyps ISO RGD:736934 4142518 DNA:deletion: : RGD Gstt1 Rat neutropenia susceptibility ISO RGD:736934 10450844 RGD Gstt1 Rat obesity IEP 14701042 mRNA:decreased expression:liver RGD Gstt1 Rat optic neuritis susceptibility ISO RGD:736934 5148007 DNA:deletion, haplotype:cds (human) RGD Gstt1 Rat oral cavity cancer ISO RGD:736934 14701001 RGD Gstt1 Rat oral cavity cancer ISO RGD:736934 14700997 RGD Gstt1 Rat oral mucosa leukoplakia ISO RGD:736934 14700975 RGD Gstt1 Rat oral submucous fibrosis ISO RGD:736934 14701000 RGD Gstt1 Rat oral submucous fibrosis ISO RGD:736934 14700981 RGD Gstt1 Rat orofacial cleft susceptibility ISO RGD:736934 12792210 DNA:deletion:cds: (human) RGD Gstt1 Rat ovary epithelial cancer disease_progression ISO RGD:736934 2293830 DNA:deletion RGD Gstt1 Rat pancreatic adenocarcinoma ISO RGD:736934 14700985 RGD Gstt1 Rat Parkinson's disease ISO RGD:736934 5490165 DNA:deletion: : RGD Gstt1 Rat Perinatal Asphyxia severity ISO RGD:736934 12792218 DNA:deletion:: (human) RGD Gstt1 Rat peripheral nervous system disease susceptibility ISO RGD:736934 10450871 associated with multiple myeloma; RGD Gstt1 Rat pre-malignant neoplasm ISO RGD:736934 14700971 associated with stomach disease RGD Gstt1 Rat Premature Birth ISO RGD:736934 12792239 DNA:deletion:: (human) RGD Gstt1 Rat Premature Birth susceptibility ISO RGD:736934 10450837 RGD Gstt1 Rat Presbycusis no_association ISO RGD:736934 7495803 DNA:deletion:cds (human) RGD Gstt1 Rat Presbycusis susceptibility ISO RGD:736934 7794838 DNA:deletion:cds (human) RGD Gstt1 Rat primary open angle glaucoma no_association ISO RGD:736934 7794823 DNA:deletion:cds (human) RGD Gstt1 Rat primary open angle glaucoma susceptibility ISO RGD:736934 7794820 DNA:deletion, haplotype:cds (human) RGD Gstt1 Rat primary open angle glaucoma no_association ISO RGD:736934 7794825 DNA:deletion:cds (human) RGD Gstt1 Rat prostate cancer susceptibility ISO RGD:736934 2293829 DNA:polymorphism RGD Gstt1 Rat pulmonary tuberculosis susceptibility ISO RGD:736934 4140932 DNA:deletion: : RGD Gstt1 Rat renal cell carcinoma susceptibility ISO RGD:736934 2293845 RGD Gstt1 Rat rheumatoid arthritis susceptibility ISO RGD:736934 5490983 DNA:deletion: : RGD Gstt1 Rat rheumatoid arthritis severity ISO RGD:736934 5490553 DNA:deletion: : RGD Gstt1 Rat rheumatoid arthritis ISO RGD:736934 5490982 DNA:deletion: : RGD Gstt1 Rat senile cataract ISO RGD:736934 14700972 RGD Gstt1 Rat sickle cell anemia susceptibility ISO RGD:736934 10450863 RGD Gstt1 Rat skin melanoma susceptibility ISO RGD:736934 12792221 DNA:deletion:: (human) RGD Gstt1 Rat stomach cancer ISO RGD:736934 14700994 RGD Gstt1 Rat stomach cancer ISO RGD:736934 14700936 RGD Gstt1 Rat stomach cancer ISO RGD:736934 14700984 associated with Helicobacter Infections RGD Gstt1 Rat Therapy-related Acute Myeloid Leukemia susceptibility ISO RGD:736934 10450873 associated with neoplasms; RGD Gstt1 Rat transitional cell carcinoma ISO RGD:736934 2293800 protein:increased expression:urinary bladder mucosa RGD Gstt1 Rat Transplant Rejection ISO RGD:736934 10450792 associated with Hemoglobinopathies;DNA:deletion:: (human) RGD Gstt1 Rat type 1 diabetes mellitus IEP 7794858 mRNA:decreased expression:islets of Langerhans (rat) RGD Gstt1 Rat type 2 diabetes mellitus susceptibility ISO RGD:736934 2306627 RGD Gstt1 Rat ulcerative colitis susceptibility ISO RGD:736934 5490554 DNA:deletion: : RGD Gstt1 Rat ulcerative colitis ISO RGD:736934 11538341 RGD Gstt1 Rat urinary bladder cancer susceptibility ISO RGD:736934 6906879 DNA:deletion: : (human) RGD Gstt1 Rat Vaso-occlusive Crisis ISO RGD:736934 10450838 associated with Anemia, Sickle Cell;DNA:deletion:: (human) RGD Gstt1 Rat venous insufficiency susceptibility ISO RGD:736934 7794848 associated with Behcet Syndrome;DNA:deletion:cds (human) RGD
Only show annotations with direct experimental evidence (0 objects hidden)
Gstt1 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of GSTT1 mRNA] CTD PMID:31150632 Gstt1 Rat (1->4)-beta-D-glucan multiple interactions ISO RGD:10700 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of GSTT1 mRNA CTD PMID:36331819 Gstt1 Rat (E)-1,3-dichloropropene multiple interactions EXP 6480464 GSTT1 protein affects the metabolism of and results in increased activity of 1,3-dichloro-1-propene CTD PMID:15790493 Gstt1 Rat (R,R,R)-alpha-tocopherol increases expression EXP 6480464 alpha-Tocopherol results in increased expression of GSTT1 protein CTD PMID:9855024 Gstt1 Rat 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane affects expression EXP 6480464 o,p'-DDT affects the expression of GSTT1 mRNA CTD PMID:17984292 Gstt1 Rat 1,2-dibromoethane multiple interactions ISO RGD:736934 6480464 GSTT1 gene SNP inhibits the reaction [GSTT1 protein results in increased glutathionylation of Ethylene Dibromide]; more ... CTD PMID:21781954|PMID:8565128 Gstt1 Rat 1,2-dibromoethane increases activity EXP 6480464 GSTT1 protein results in increased activity of Ethylene Dibromide CTD PMID:12505322 Gstt1 Rat 1,2-dibromoethane affects response to substance EXP 6480464 GSTT1 protein affects the susceptibility to Ethylene Dibromide CTD PMID:12902151 Gstt1 Rat 1,2-dibromoethane multiple interactions EXP 6480464 GSTT1 protein results in increased metabolism of and results in increased activity of Ethylene Dibromide CTD PMID:10413528 Gstt1 Rat 1,2-dibromoethane increases glutathionylation ISO RGD:736934 6480464 GSTT1 protein results in increased glutathionylation of Ethylene Dibromide CTD PMID:21781954 Gstt1 Rat 1,2-dibromoethane increases activity ISO RGD:736934 6480464 GSTT1 protein results in increased activity of Ethylene Dibromide CTD PMID:19664997 Gstt1 Rat 1,2-dimethylhydrazine multiple interactions ISO RGD:10700 6480464 Folic Acid inhibits the reaction [1,2-Dimethylhydrazine results in decreased expression of GSTT1 mRNA] CTD PMID:22206623 Gstt1 Rat 1,2-dimethylhydrazine decreases expression ISO RGD:10700 6480464 1,2-Dimethylhydrazine results in decreased expression of GSTT1 mRNA CTD PMID:22206623 Gstt1 Rat 1,2-epoxy-3-(4-nitrophenoxy)propane multiple interactions EXP 6480464 GSTT1 protein affects the metabolism of and results in decreased activity of 1,2-epoxy-3-(p-nitrophenoxy)propane; GSTT1 protein more ... CTD PMID:7578934|PMID:8951341 Gstt1 Rat 1,2-epoxy-3-(4-nitrophenoxy)propane affects metabolic processing ISO RGD:736934 6480464 GSTT1 protein affects the metabolism of 1,2-epoxy-3-(p-nitrophenoxy)propane CTD PMID:15683365|PMID:15882759 Gstt1 Rat 1,2-epoxy-3-(4-nitrophenoxy)propane increases glutathionylation ISO RGD:736934 6480464 GSTT1 protein results in increased glutathionylation of 1,2-epoxy-3-(p-nitrophenoxy)propane CTD PMID:19664997|PMID:21781954 Gstt1 Rat 1,2-epoxy-3-(4-nitrophenoxy)propane multiple interactions ISO RGD:736934 6480464 GSTT1 gene SNP inhibits the reaction [GSTT1 protein results in increased glutathionylation of 1,2-epoxy-3-(p-nitrophenoxy)propane] CTD PMID:21781954 Gstt1 Rat 1,2-epoxy-3-(4-nitrophenoxy)propane affects metabolic processing ISO RGD:10700 6480464 GSTT1 protein affects the metabolism of 1,2-epoxy-3-(p-nitrophenoxy)propane CTD PMID:17827337|PMID:9854036 Gstt1 Rat 1-chloro-2,4-dinitrobenzene decreases expression ISO RGD:10700 6480464 Dinitrochlorobenzene results in decreased expression of GSTT1 mRNA CTD PMID:28219650 Gstt1 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of GSTT1 mRNA CTD PMID:12883083 Gstt1 Rat 17beta-estradiol decreases expression ISO RGD:736934 6480464 Estradiol results in decreased expression of GSTT1 mRNA CTD PMID:23019147|PMID:31614463 Gstt1 Rat 17beta-estradiol decreases expression ISO RGD:10700 6480464 Estradiol results in decreased expression of GSTT1 mRNA CTD PMID:14664709|PMID:39298647 Gstt1 Rat 17beta-estradiol multiple interactions ISO RGD:736934 6480464 [Progesterone co-treated with Estradiol] results in decreased expression of GSTT1 mRNA CTD PMID:17404688 Gstt1 Rat 1H-pyrazole decreases expression ISO RGD:10700 6480464 pyrazole results in decreased expression of GSTT1 mRNA CTD PMID:17945193 Gstt1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:10700 6480464 Tetrachlorodibenzodioxin results in decreased expression of GSTT1 mRNA CTD PMID:22496397 Gstt1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:10700 6480464 AHR protein affects the reaction [Tetrachlorodibenzodioxin results in decreased expression of GSTT1 mRNA] CTD PMID:22496397 Gstt1 Rat 2,4,6-trinitrobenzenesulfonic acid decreases expression EXP 6480464 Trinitrobenzenesulfonic Acid results in decreased expression of GSTT1 mRNA CTD PMID:31669340 Gstt1 Rat 2,4,6-trinitrotoluene affects expression EXP 6480464 Trinitrotoluene affects the expression of GSTT1 mRNA CTD PMID:21346803 Gstt1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO RGD:10700 6480464 2,2',4,4',5-brominated diphenyl ether affects the expression of GSTT1 mRNA CTD PMID:38648751 Gstt1 Rat 2,6-di-tert-butyl-4-methylphenol increases expression EXP 6480464 Butylated Hydroxytoluene results in increased expression of GSTT1 mRNA CTD PMID:15110098 Gstt1 Rat 2-amino-2-deoxy-D-glucopyranose increases expression ISO RGD:10700 6480464 Glucosamine results in increased expression of GSTT1 mRNA CTD PMID:17178593 Gstt1 Rat 2-amino-7-methyl-1,7-dihydro-6H-purin-6-one multiple interactions ISO RGD:736934 6480464 GSTT1 gene polymorphism affects the susceptibility to and affects the metabolism of 7-methylguanine CTD PMID:15066569 Gstt1 Rat 2-butoxyethanol increases expression ISO RGD:10700 6480464 n-butoxyethanol results in increased expression of GSTT1 mRNA CTD PMID:19812364 Gstt1 Rat 2-methylcholine affects expression ISO RGD:736934 6480464 beta-methylcholine affects the expression of GSTT1 mRNA CTD PMID:21179406 Gstt1 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO RGD:10700 6480464 tetrabromobisphenol A results in decreased expression of GSTT1 mRNA CTD PMID:25172293 Gstt1 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of GSTT1 mRNA CTD PMID:28522335 Gstt1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RGD:10700 6480464 [Dexamethasone co-treated with rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in decreased expression more ... CTD PMID:16054899 Gstt1 Rat 3-phenylprop-2-enal affects expression ISO RGD:10700 6480464 cinnamaldehyde affects the expression of GSTT1 mRNA CTD PMID:28219650 Gstt1 Rat 3H-1,2-dithiole-3-thione increases expression EXP 6480464 1,2-dithiol-3-thione results in increased expression of GSTT1 mRNA CTD PMID:19162173|PMID:19695238 Gstt1 Rat 4,4'-diaminodiphenylmethane decreases expression ISO RGD:10700 6480464 4,4'-diaminodiphenylmethane results in decreased expression of GSTT1 mRNA CTD PMID:18648102 Gstt1 Rat 4,4'-sulfonyldiphenol decreases expression ISO RGD:10700 6480464 bisphenol S results in decreased expression of GSTT1 mRNA CTD PMID:39298647 Gstt1 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:736934 6480464 bisphenol S results in increased expression of GSTT1 protein CTD PMID:34186270 Gstt1 Rat 4-hydroxyphenyl retinamide decreases expression ISO RGD:10700 6480464 Fenretinide results in decreased expression of GSTT1 mRNA CTD PMID:16467112 Gstt1 Rat 5-fluorouracil increases expression ISO RGD:736934 6480464 Fluorouracil results in increased expression of GSTT1 protein CTD PMID:15585135|PMID:16803524 Gstt1 Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole affects expression EXP 6480464 Omeprazole affects the expression of GSTT1 mRNA CTD PMID:19483382 Gstt1 Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of GSTT1 mRNA CTD PMID:19483382 Gstt1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of GSTT1 mRNA CTD PMID:22504374|PMID:24780913 Gstt1 Rat 7,9-dihydro-1H-purine-2,6,8(3H)-trione affects abundance ISO RGD:736934 6480464 GSTT1 protein polymorphism affects the abundance of Uric Acid CTD PMID:23747713 Gstt1 Rat acetylsalicylic acid increases expression EXP 6480464 Aspirin results in increased expression of GSTT1 protein CTD PMID:9729437 Gstt1 Rat acrylamide affects metabolic processing ISO RGD:736934 6480464 GSTT1 gene polymorphism affects the metabolism of Acrylamide CTD PMID:19131562 Gstt1 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of GSTT1 mRNA CTD PMID:28959563 Gstt1 Rat acrylamide multiple interactions ISO RGD:736934 6480464 [CYP2E1 gene polymorphism co-treated with GSTM1 gene polymorphism co-treated with GSTT1 gene polymorphism] affects the more ... CTD PMID:19131562 Gstt1 Rat aflatoxin B1 affects response to substance ISO RGD:10700 6480464 GSTT1 gene SNP affects the susceptibility to Aflatoxin B1 CTD PMID:12907637 Gstt1 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of GSTT1 mRNA CTD PMID:33354967 Gstt1 Rat aflatoxin B1 decreases expression ISO RGD:736934 6480464 Aflatoxin B1 results in decreased expression of GSTT1 mRNA CTD PMID:22100608|PMID:27153756 Gstt1 Rat aflatoxin B1 multiple interactions EXP 6480464 GSTT1 protein affects the metabolism of and results in decreased activity of Aflatoxin B1 metabolite CTD PMID:8951341 Gstt1 Rat aldehydo-D-glucosamine increases expression ISO RGD:10700 6480464 Glucosamine results in increased expression of GSTT1 mRNA CTD PMID:17178593 Gstt1 Rat amiodarone affects expression EXP 6480464 Amiodarone affects the expression of GSTT1 mRNA CTD PMID:19483382 Gstt1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of GSTT1 mRNA CTD PMID:16483693 Gstt1 Rat amphotericin B decreases expression EXP 6480464 Amphotericin B results in decreased expression of GSTT1 mRNA CTD PMID:20623750 Gstt1 Rat angelica lactone increases expression EXP 6480464 angelica lactone results in increased expression of GSTT1 protein CTD PMID:9855024 Gstt1 Rat aristolochic acid A increases expression EXP 6480464 aristolochic acid I results in increased expression of GSTT1 mRNA CTD PMID:17483316 Gstt1 Rat arsane affects methylation ISO RGD:736934 6480464 Arsenic affects the methylation of GSTT1 gene; GSTT1 gene polymorphism affects the methylation of Arsenic CTD PMID:24511153|PMID:25304211|PMID:25876999 Gstt1 Rat arsane multiple interactions ISO RGD:736934 6480464 [GSTT1 gene polymorphism affects the metabolism of Arsenic] which affects the abundance of Arsenic; [GSTT1 more ... CTD PMID:32650499 Gstt1 Rat arsane affects metabolic processing ISO RGD:736934 6480464 GSTT1 gene SNP affects the metabolism of Arsenic CTD PMID:27327299 Gstt1 Rat arsane affects response to substance ISO RGD:736934 6480464 GSTT1 gene affects the susceptibility to Arsenic; GSTT1 gene polymorphism affects the susceptibility to Arsenic; more ... CTD PMID:16214926|PMID:17284320|PMID:31864032 Gstt1 Rat arsenic atom affects methylation ISO RGD:736934 6480464 Arsenic affects the methylation of GSTT1 gene; GSTT1 gene polymorphism affects the methylation of Arsenic CTD PMID:24511153|PMID:25304211|PMID:25876999 Gstt1 Rat arsenic atom multiple interactions ISO RGD:736934 6480464 [GSTT1 gene polymorphism affects the metabolism of Arsenic] which affects the abundance of Arsenic; [GSTT1 more ... CTD PMID:32650499 Gstt1 Rat arsenic atom affects metabolic processing ISO RGD:736934 6480464 GSTT1 gene SNP affects the metabolism of Arsenic CTD PMID:27327299 Gstt1 Rat arsenic atom affects response to substance ISO RGD:736934 6480464 GSTT1 gene affects the susceptibility to Arsenic; GSTT1 gene polymorphism affects the susceptibility to Arsenic; more ... CTD PMID:16214926|PMID:17284320|PMID:31864032 Gstt1 Rat arsenite(3-) increases expression ISO RGD:10700 6480464 arsenite results in increased expression of GSTT1 mRNA CTD PMID:15345372 Gstt1 Rat arsenite(3-) multiple interactions ISO RGD:736934 6480464 arsenite promotes the reaction [G3BP1 protein binds to GSTT1 mRNA] CTD PMID:32406909 Gstt1 Rat arsenous acid decreases expression ISO RGD:736934 6480464 Arsenic Trioxide results in decreased expression of GSTT1 mRNA CTD PMID:20458559 Gstt1 Rat asbestos affects response to substance ISO RGD:736934 6480464 GSTT1 gene polymorphism affects the susceptibility to Asbestos; GSTT1 protein affects the susceptibility to Asbestos CTD PMID:17563610|PMID:20847076 Gstt1 Rat atrazine increases expression EXP 6480464 Atrazine results in increased expression of GSTT1 mRNA CTD PMID:28882082|PMID:36841081 Gstt1 Rat benzbromarone affects expression EXP 6480464 Benzbromarone affects the expression of GSTT1 mRNA CTD PMID:19483382 Gstt1 Rat benzene affects response to substance ISO RGD:736934 6480464 GSTT1 gene polymorphism affects the susceptibility to Benzene; GSTT1 polymorphism affects the susceptibility to Benzene; more ... CTD PMID:12460800|PMID:15226677|PMID:15256146|PMID:15533900|PMID:15591089|PMID:15935803|PMID:18836923|PMID:29204680 Gstt1 Rat benzene increases response to substance ISO RGD:736934 6480464 GSTT1 gene polymorphism results in increased susceptibility to Benzene CTD PMID:15226677|PMID:15748501|PMID:17119198|PMID:17178637 Gstt1 Rat benzene multiple interactions ISO RGD:736934 6480464 [GSTT1 gene SNP affects the metabolism of Benzene] which affects the abundance of S-phenyl-N-acetylcysteine; GSTM1 more ... CTD PMID:15533900|PMID:17178637|PMID:30086327 Gstt1 Rat benzene increases metabolic processing ISO RGD:736934 6480464 GSTT1 protein results in increased metabolism of Benzene CTD PMID:17885617 Gstt1 Rat benzene affects chemical synthesis ISO RGD:736934 6480464 GSTT1 protein polymorphism affects the chemical synthesis of Benzene metabolite CTD PMID:15935803 Gstt1 Rat benzene affects metabolic processing ISO RGD:736934 6480464 GSTT1 gene SNP affects the metabolism of Benzene; GSTT1 protein affects the metabolism of Benzene CTD PMID:15226677|PMID:30086327 Gstt1 Rat benzo[a]pyrene increases expression ISO RGD:10700 6480464 Benzo(a)pyrene results in increased expression of GSTT1 mRNA CTD PMID:22228805 Gstt1 Rat benzo[a]pyrene decreases methylation ISO RGD:736934 6480464 Benzo(a)pyrene results in decreased methylation of GSTT1 promoter CTD PMID:27901495 Gstt1 Rat benzo[a]pyrene increases methylation ISO RGD:736934 6480464 Benzo(a)pyrene results in increased methylation of GSTT1 5' UTR CTD PMID:27901495 Gstt1 Rat benzo[a]pyrene affects methylation ISO RGD:736934 6480464 Benzo(a)pyrene affects the methylation of GSTT1 3' UTR CTD PMID:27901495 Gstt1 Rat benzo[a]pyrene multiple interactions ISO RGD:10700 6480464 [lipopolysaccharide, E coli O55-B5 co-treated with Benzo(a)pyrene] affects the expression of GSTT1 mRNA CTD PMID:28987381 Gstt1 Rat benzyl isothiocyanate increases expression EXP 6480464 benzyl isothiocyanate results in increased expression of GSTT1 protein CTD PMID:9794803 Gstt1 Rat beta-D-glucosamine increases expression ISO RGD:10700 6480464 Glucosamine results in increased expression of GSTT1 mRNA CTD PMID:17178593 Gstt1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of GSTT1 mRNA CTD PMID:25181051 Gstt1 Rat bisphenol A affects expression ISO RGD:736934 6480464 bisphenol A affects the expression of GSTT1 mRNA CTD PMID:30903817 Gstt1 Rat bromobenzene decreases expression EXP 6480464 bromobenzene results in decreased expression of GSTT1 mRNA CTD PMID:15056800 Gstt1 Rat bromodichloromethane increases metabolic processing EXP 6480464 GSTT1 protein results in increased metabolism of bromodichloromethane CTD PMID:12588193 Gstt1 Rat bromodichloromethane increases metabolic processing ISO RGD:736934 6480464 GSTT1 protein results in increased metabolism of bromodichloromethane CTD PMID:12588193 Gstt1 Rat bromodichloromethane multiple interactions EXP 6480464 GSTT1 protein affects the metabolism of [bromodichloromethane co-treated with Glutathione] CTD PMID:14998683 Gstt1 Rat bromodichloromethane increases metabolic processing ISO RGD:10700 6480464 GSTT1 protein results in increased metabolism of bromodichloromethane CTD PMID:12588193 Gstt1 Rat bromomethane increases metabolic processing ISO RGD:736934 6480464 GSTT1 protein results in increased metabolism of methyl bromide CTD PMID:11305778 Gstt1 Rat busulfan multiple interactions ISO RGD:736934 6480464 [GSTM1 gene polymorphism co-treated with GSTT1 gene polymorphism] affects the metabolism of Busulfan CTD PMID:21215809 Gstt1 Rat buta-1,3-diene affects abundance ISO RGD:736934 6480464 GSTT1 affects the abundance of 1,3-butadiene metabolite CTD PMID:16949064 Gstt1 Rat buta-1,3-diene multiple interactions ISO RGD:736934 6480464 GSTT1 gene polymorphism promotes the reaction [EPHX1 gene polymorphism results in increased susceptibility to 1,3-butadiene] CTD PMID:11238181 Gstt1 Rat butylated hydroxyanisole increases expression EXP 6480464 Butylated Hydroxyanisole results in increased expression of GSTT1 mRNA; Butylated Hydroxyanisole results in increased expression more ... CTD PMID:9794803 Gstt1 Rat cadmium dichloride decreases methylation EXP 6480464 Cadmium Chloride results in decreased methylation of GSTT1 promoter CTD PMID:22457795 Gstt1 Rat carbamazepine affects expression ISO RGD:736934 6480464 Carbamazepine affects the expression of GSTT1 mRNA CTD PMID:24752500 Gstt1 Rat carbon disulfide affects metabolic processing ISO RGD:736934 6480464 GSTT1 gene polymorphism affects the metabolism of Carbon Disulfide CTD PMID:17333241 Gstt1 Rat carbon nanotube decreases expression ISO RGD:10700 6480464 Nanotubes, Carbon analog results in decreased expression of GSTT1 mRNA; Nanotubes, Carbon results in decreased more ... CTD PMID:25554681|PMID:25620056 Gstt1 Rat carmustine affects response to substance ISO RGD:736934 6480464 GSTT1 protein affects the susceptibility to Carmustine CTD PMID:16874663 Gstt1 Rat carmustine affects metabolic processing ISO RGD:10700 6480464 GSTT1 protein affects the metabolism of Carmustine CTD PMID:17827337 Gstt1 Rat carmustine decreases nitrosation ISO RGD:736934 6480464 GSTT1 protein results in decreased nitrosation of Carmustine CTD PMID:11841793 Gstt1 Rat chenodeoxycholic acid multiple interactions ISO RGD:736934 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated more ... CTD PMID:33819548 Gstt1 Rat chloroethene multiple interactions ISO RGD:736934 6480464 [GSTM1 gene polymorphism co-treated with GSTT1 gene polymorphism] results in increased susceptibility to Vinyl Chloride; more ... CTD PMID:16097394|PMID:16977343 Gstt1 Rat chloroethene increases response to substance ISO RGD:736934 6480464 GSTT1 gene polymorphism results in increased susceptibility to Vinyl Chloride CTD PMID:16270392 Gstt1 Rat chlorohydrocarbon affects response to substance ISO RGD:736934 6480464 GSTT1 gene polymorphism affects the susceptibility to Hydrocarbons, Chlorinated CTD PMID:26479327|PMID:31569996 Gstt1 Rat chlorohydrocarbon increases abundance ISO RGD:736934 6480464 GSTT1 gene polymorphism results in increased abundance of Hydrocarbons, Chlorinated CTD PMID:32734539 Gstt1 Rat chloromethane multiple interactions ISO RGD:736934 6480464 GSTT1 protein polymorphism affects the metabolism of and affects the susceptibility to Methyl Chloride CTD PMID:11218045 Gstt1 Rat chloromethane increases metabolic processing ISO RGD:736934 6480464 GSTT1 protein results in increased metabolism of Methyl Chloride CTD PMID:11305778 Gstt1 Rat chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of GSTT1 mRNA CTD PMID:17452286|PMID:19440498 Gstt1 Rat cisplatin multiple interactions ISO RGD:736934 6480464 GSTT1 gene polymorphism affects the susceptibility to [Paclitaxel co-treated with Cisplatin] CTD PMID:12851839 Gstt1 Rat clofibrate multiple interactions ISO RGD:10700 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of GSTT1 mRNA; PPARA affects the reaction [[Clofibrate more ... CTD PMID:17585979 Gstt1 Rat clofibrate affects expression EXP 6480464 Clofibrate affects the expression of GSTT1 mRNA CTD PMID:19483382 Gstt1 Rat clofibrate increases expression EXP 6480464 Clofibrate results in increased expression of GSTT1 mRNA CTD PMID:12883083 Gstt1 Rat clofibrate increases expression ISO RGD:10700 6480464 Clofibrate results in increased expression of GSTT1 mRNA CTD PMID:18723825 Gstt1 Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of GSTT1 mRNA CTD PMID:24386269 Gstt1 Rat copper atom decreases expression EXP 6480464 Copper results in decreased expression of GSTT1 mRNA CTD PMID:22465980 Gstt1 Rat copper(0) decreases expression EXP 6480464 Copper results in decreased expression of GSTT1 mRNA CTD PMID:22465980 Gstt1 Rat coumarin increases expression EXP 6480464 coumarin results in increased expression of GSTT1 mRNA; coumarin results in increased expression of GSTT1 more ... CTD PMID:10413528|PMID:9794803|PMID:9855024 Gstt1 Rat cumene hydroperoxide affects oxidation ISO RGD:736934 6480464 GSTT1 protein affects the oxidation of cumene hydroperoxide CTD PMID:19664997 Gstt1 Rat cumene hydroperoxide affects metabolic processing ISO RGD:10700 6480464 GSTT1 protein affects the metabolism of cumene hydroperoxide CTD PMID:9854036 Gstt1 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of GSTT1 mRNA CTD PMID:26577399 Gstt1 Rat cyclosporin A decreases expression ISO RGD:736934 6480464 Cyclosporine results in decreased expression of GSTT1 mRNA CTD PMID:20106945|PMID:23830897|PMID:25562108 Gstt1 Rat cyclosporin A decreases expression ISO RGD:10700 6480464 Cyclosporine results in decreased expression of GSTT1 mRNA CTD PMID:19770486|PMID:23308384|PMID:23830897 Gstt1 Rat cylindrospermopsin decreases expression ISO RGD:10700 6480464 cylindrospermopsin results in decreased expression of GSTT1 mRNA CTD PMID:20936652 Gstt1 Rat cyproconazole increases expression ISO RGD:10700 6480464 cyproconazole results in increased expression of GSTT1 mRNA CTD PMID:22334560 Gstt1 Rat deoxycholic acid multiple interactions ISO RGD:736934 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated more ... CTD PMID:33819548 Gstt1 Rat Deoxycorticosterone acetate multiple interactions EXP 6480464 [Desoxycorticosterone Acetate co-treated with Sodium Chloride, Dietary co-treated with Potassium Chloride] results in decreased expression more ... CTD PMID:22228705 Gstt1 Rat dexamethasone multiple interactions ISO RGD:10700 6480464 [Dexamethasone co-treated with rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in decreased expression more ... CTD PMID:16054899 Gstt1 Rat dexamethasone decreases expression EXP 6480464 Dexamethasone results in decreased expression of GSTT1 mRNA CTD PMID:12971794 Gstt1 Rat Diallyl sulfide increases expression EXP 6480464 allyl sulfide results in increased expression of GSTT1 mRNA CTD PMID:19695238 Gstt1 Rat diarsenic trioxide decreases expression ISO RGD:736934 6480464 Arsenic Trioxide results in decreased expression of GSTT1 mRNA CTD PMID:20458559 Gstt1 Rat diazinon increases expression EXP 6480464 Diazinon results in increased expression of GSTT1 mRNA CTD PMID:17452286 Gstt1 Rat dibromomethane affects metabolic processing ISO RGD:736934 6480464 GSTT1 protein affects the metabolism of methylene bromide CTD PMID:14727918 Gstt1 Rat dibromomethane multiple interactions EXP 6480464 GSTT1 protein affects the metabolism of and results in increased activity of methylene bromide CTD PMID:11511186 Gstt1 Rat dibromomethane multiple interactions ISO RGD:736934 6480464 GSTT1 protein affects the metabolism of and results in increased activity of methylene bromide CTD PMID:8565128 Gstt1 Rat dibromomethane affects metabolic processing EXP 6480464 GSTT1 protein affects the metabolism of methylene bromide CTD PMID:14727918 Gstt1 Rat dichloromethane affects metabolic processing ISO RGD:736934 6480464 GSTT1 gene polymorphism affects the metabolism of Methylene Chloride; GSTT1 protein affects the metabolism of more ... CTD PMID:14727918|PMID:15683365|PMID:7979958 Gstt1 Rat dichloromethane increases metabolic processing EXP 6480464 GSTT1 protein results in increased metabolism of Methylene Chloride CTD PMID:11453994 Gstt1 Rat dichloromethane affects metabolic processing EXP 6480464 GSTT1 protein affects the metabolism of Methylene Chloride CTD PMID:14727918 Gstt1 Rat dichloromethane multiple interactions EXP 6480464 GSTT1 protein results in increased metabolism of and results in increased activity of Methylene Chloride CTD PMID:10413528 Gstt1 Rat dichloromethane affects metabolic processing ISO RGD:10700 6480464 GSTT1 protein affects the metabolism of Methylene Chloride CTD PMID:17827337|PMID:8670055|PMID:9854036 Gstt1 Rat dichloromethane affects response to substance ISO RGD:736934 6480464 GSTT1 protein alternative form affects the susceptibility to Methylene Chloride CTD PMID:20837120 Gstt1 Rat dichloromethane multiple interactions ISO RGD:10700 6480464 [GSTT1 protein affects the metabolism of Methylene Chloride] which results in increased abundance of Formaldehyde; more ... CTD PMID:15683365|PMID:16765633|PMID:8761485 Gstt1 Rat dichloromethane increases metabolic processing ISO RGD:736934 6480464 GSTT1 protein results in increased metabolism of Methylene Chloride CTD PMID:11446825|PMID:12054768 Gstt1 Rat diclofenac affects expression ISO RGD:736934 6480464 Diclofenac affects the expression of GSTT1 mRNA CTD PMID:24752500 Gstt1 Rat diclofenac affects activity ISO RGD:736934 6480464 Diclofenac affects the activity of GSTT1 protein CTD PMID:27183920 Gstt1 Rat diepoxybutane affects response to substance ISO RGD:736934 6480464 GSTT1 gene polymorphism affects the susceptibility to diepoxybutane; GSTT1 protein affects the susceptibility to diepoxybutane CTD PMID:12694746|PMID:15036125|PMID:33381973 Gstt1 Rat diepoxybutane multiple interactions EXP 6480464 GSTT1 protein affects the metabolism of and results in increased activity of diepoxybutane CTD PMID:7578934 Gstt1 Rat diepoxybutane decreases activity ISO RGD:736934 6480464 GSTT1 protein results in decreased activity of diepoxybutane CTD PMID:12694746 Gstt1 Rat diepoxybutane multiple interactions ISO RGD:736934 6480464 GSTT1 protein affects the metabolism of and results in increased activity of diepoxybutane; GSTT1 protein more ... CTD PMID:33381973|PMID:8565128 Gstt1 Rat diepoxybutane increases response to substance ISO RGD:736934 6480464 GSTT1 gene polymorphism results in increased susceptibility to diepoxybutane CTD PMID:17078101 Gstt1 Rat diethyl maleate increases expression EXP 6480464 diethyl maleate results in increased expression of GSTT1 protein CTD PMID:9794803 Gstt1 Rat dimethylarsinic acid affects metabolic processing ISO RGD:736934 6480464 GSTT1 protein affects the metabolism of Cacodylic Acid CTD PMID:17431481 Gstt1 Rat dimethylarsinic acid multiple interactions ISO RGD:736934 6480464 [GSTT1 gene polymorphism affects the metabolism of Arsenic] which affects the abundance of Cacodylic Acid CTD PMID:32650499 Gstt1 Rat dimethylarsinic acid affects response to substance ISO RGD:736934 6480464 GSTT1 gene affects the susceptibility to Cacodylic Acid CTD PMID:17431481 Gstt1 Rat disodium selenite increases expression ISO RGD:736934 6480464 Sodium Selenite results in increased expression of GSTT1 mRNA CTD PMID:16705456|PMID:24383545 Gstt1 Rat elemental selenium increases expression EXP 6480464 Selenium deficiency results in increased expression of GSTT1 CTD PMID:9331086 Gstt1 Rat ellagic acid affects expression EXP 6480464 Ellagic Acid affects the expression of GSTT1 protein CTD PMID:9855024 Gstt1 Rat epoxiconazole increases expression ISO RGD:10700 6480464 epoxiconazole results in increased expression of GSTT1 mRNA CTD PMID:22334560 Gstt1 Rat epoxiconazole decreases expression ISO RGD:10700 6480464 epoxiconazole results in decreased expression of GSTT1 mRNA CTD PMID:35436446 Gstt1 Rat ethanol affects response to substance ISO RGD:736934 6480464 GSTT1 gene polymorphism affects the susceptibility to Ethanol CTD PMID:15932176 Gstt1 Rat ethoxyquin increases expression EXP 6480464 Ethoxyquin results in increased expression of GSTT1 mRNA; Ethoxyquin results in increased expression of GSTT1 more ... CTD PMID:9794803 Gstt1 Rat ethoxyquin increases expression ISO RGD:10700 6480464 Ethoxyquin results in increased expression of GSTT1 mRNA CTD PMID:18723825 Gstt1 Rat folic acid multiple interactions ISO RGD:10700 6480464 Folic Acid inhibits the reaction [1,2-Dimethylhydrazine results in decreased expression of GSTT1 mRNA] CTD PMID:22206623 Gstt1 Rat formaldehyde multiple interactions ISO RGD:10700 6480464 [GSTT1 protein affects the metabolism of Methylene Chloride] which results in increased abundance of Formaldehyde CTD PMID:16765633 Gstt1 Rat furan increases methylation EXP 6480464 furan results in increased methylation of GSTT1 gene CTD PMID:22079235 Gstt1 Rat genistein increases expression ISO RGD:10700 6480464 Genistein results in increased expression of GSTT1 mRNA CTD PMID:32186404 Gstt1 Rat glutathione multiple interactions EXP 6480464 GSTT1 protein affects the metabolism of [bromodichloromethane co-treated with Glutathione] CTD PMID:14998683 Gstt1 Rat glutathione affects metabolic processing EXP 6480464 GSTT1 protein affects the metabolism of Glutathione CTD PMID:14727918 Gstt1 Rat glutathione multiple interactions ISO RGD:736934 6480464 GSTT1 protein polymorphism affects the metabolism of [Benzene co-treated with Glutathione]; GSTT1 protein promotes the more ... CTD PMID:15533900|PMID:33381973 Gstt1 Rat glutathione affects metabolic processing ISO RGD:736934 6480464 GSTT1 protein affects the metabolism of Glutathione CTD PMID:14727918 Gstt1 Rat glycochenodeoxycholic acid multiple interactions ISO RGD:736934 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated more ... CTD PMID:33819548 Gstt1 Rat glycocholic acid multiple interactions ISO RGD:736934 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated more ... CTD PMID:33819548 Gstt1 Rat glycodeoxycholic acid multiple interactions ISO RGD:736934 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated more ... CTD PMID:33819548 Gstt1 Rat graphite affects expression EXP 6480464 Graphite affects the expression of GSTT1 mRNA CTD PMID:29933104 Gstt1 Rat herbicide multiple interactions EXP 6480464 Herbicides binds to and results in decreased activity of GSTT1 protein CTD PMID:6686184 Gstt1 Rat hydrogen peroxide multiple interactions ISO RGD:736934 6480464 [HP gene polymorphism co-treated with GSTT1 gene polymorphism] affects the susceptibility to Hydrogen Peroxide CTD PMID:20444272 Gstt1 Rat hydroquinone affects response to substance ISO RGD:736934 6480464 GSTT1 affects the susceptibility to hydroquinone CTD PMID:19778234 Gstt1 Rat hydroquinone increases expression ISO RGD:10700 6480464 hydroquinone results in increased expression of GSTT1 mRNA CTD PMID:23290930 Gstt1 Rat ibuprofen increases expression EXP 6480464 Ibuprofen results in increased expression of GSTT1 protein CTD PMID:9729437 Gstt1 Rat indole-3-methanol affects expression EXP 6480464 indole-3-carbinol affects the expression of GSTT1 mRNA CTD PMID:21396975 Gstt1 Rat indole-3-methanol increases expression EXP 6480464 indole-3-carbinol results in increased expression of GSTT1 mRNA; indole-3-carbinol results in increased expression of GSTT1 more ... CTD PMID:10413528|PMID:9794803 Gstt1 Rat indometacin increases expression EXP 6480464 Indomethacin results in increased expression of GSTT1 protein CTD PMID:9729437 Gstt1 Rat inulin multiple interactions ISO RGD:10700 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of GSTT1 mRNA CTD PMID:36331819 Gstt1 Rat isoniazide multiple interactions ISO RGD:736934 6480464 GSTT1 gene polymorphism affects the susceptibility to [Isoniazid co-treated with Rifampin]; GSTT1 gene polymorphism results more ... CTD PMID:18397238|PMID:20485159 Gstt1 Rat isothiocyanate affects response to substance ISO RGD:736934 6480464 GSTT1 gene polymorphism affects the susceptibility to Isothiocyanates CTD PMID:14693750 Gstt1 Rat L-ascorbic acid affects response to substance ISO RGD:736934 6480464 GSTT1 affects the susceptibility to Ascorbic Acid deficiency CTD PMID:19710200 Gstt1 Rat L-ethionine affects expression EXP 6480464 Ethionine affects the expression of GSTT1 mRNA CTD PMID:19483382 Gstt1 Rat lead nitrate multiple interactions ISO RGD:10700 6480464 lead nitrate affects the reaction [GSTT1 affects the expression of MT1 mRNA]; lead nitrate affects more ... CTD PMID:11891201 Gstt1 Rat lead(0) multiple interactions ISO RGD:736934 6480464 [GSTM1 gene mutant form co-treated with GSTT1 gene mutant form] promotes the reaction [Lead results more ... CTD PMID:23484121 Gstt1 Rat lead(0) affects abundance ISO RGD:736934 6480464 GSTT1 gene polymorphism affects the abundance of Lead CTD PMID:25728017 Gstt1 Rat lead(0) increases response to substance ISO RGD:736934 6480464 GSTT1 gene mutant form results in increased susceptibility to Lead CTD PMID:23484121 Gstt1 Rat lead(0) decreases expression ISO RGD:736934 6480464 Lead results in decreased expression of GSTT1 mRNA CTD PMID:19921347 Gstt1 Rat lipopolysaccharide increases expression ISO RGD:736934 6480464 Lipopolysaccharides results in increased expression of GSTT1 mRNA CTD PMID:24001438 Gstt1 Rat lipopolysaccharide multiple interactions ISO RGD:736934 6480464 Plant Extracts inhibits the reaction [Lipopolysaccharides results in increased expression of GSTT1 mRNA] CTD PMID:24001438 Gstt1 Rat malonaldehyde affects abundance ISO RGD:736934 6480464 GSTT1 gene polymorphism affects the abundance of Malondialdehyde CTD PMID:25728017 Gstt1 Rat MeIQx affects response to substance ISO RGD:736934 6480464 GSTT1 gene polymorphism affects the susceptibility to 2-amino-3,8-dimethylimidazo(4,5-f)quinoxaline CTD PMID:22564066 Gstt1 Rat mercury atom affects response to substance ISO RGD:736934 6480464 GSTT1 gene polymorphism affects the susceptibility to Mercury; GSTT1 polymorphism affects the susceptibility to Mercury CTD PMID:17716707|PMID:20194072 Gstt1 Rat mercury atom affects abundance ISO RGD:736934 6480464 GSTT1 gene polymorphism affects the abundance of Mercury CTD PMID:21967774 Gstt1 Rat mercury atom multiple interactions ISO RGD:736934 6480464 [GSTM1 gene polymorphism co-treated with GSTT1 gene polymorphism] affects the susceptibility to Mercury; GSTT1 gene more ... CTD PMID:19515364|PMID:24319713 Gstt1 Rat mercury(0) affects response to substance ISO RGD:736934 6480464 GSTT1 gene polymorphism affects the susceptibility to Mercury; GSTT1 polymorphism affects the susceptibility to Mercury CTD PMID:17716707|PMID:20194072 Gstt1 Rat mercury(0) multiple interactions ISO RGD:736934 6480464 [GSTM1 gene polymorphism co-treated with GSTT1 gene polymorphism] affects the susceptibility to Mercury; GSTT1 gene more ... CTD PMID:19515364|PMID:24319713 Gstt1 Rat mercury(0) affects abundance ISO RGD:736934 6480464 GSTT1 gene polymorphism affects the abundance of Mercury CTD PMID:21967774 Gstt1 Rat methamphetamine affects response to substance ISO RGD:736934 6480464 GSTT1 gene polymorphism affects the susceptibility to Methamphetamine; GSTT1 protein affects the susceptibility to Methamphetamine CTD PMID:18186040|PMID:19254865 Gstt1 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of GSTT1 mRNA CTD PMID:22504374 Gstt1 Rat methoxyacetic acid affects expression EXP 6480464 methoxyacetic acid affects the expression of GSTT1 mRNA CTD PMID:20864626 Gstt1 Rat methylarsonic acid affects methylation ISO RGD:736934 6480464 GSTT1 protein affects the methylation of monomethylarsonic acid CTD PMID:17431481 Gstt1 Rat methylarsonic acid multiple interactions ISO RGD:736934 6480464 [GSTT1 gene polymorphism affects the metabolism of Arsenic] which affects the abundance of monomethylarsonic acid CTD PMID:32650499 Gstt1 Rat microcystin affects expression EXP 6480464 Microcystins affects the expression of GSTT1 mRNA CTD PMID:19790251 Gstt1 Rat microcystin increases expression EXP 6480464 Microcystins results in increased expression of GSTT1 mRNA CTD PMID:19790251 Gstt1 Rat microcystin RR increases glutathionylation ISO RGD:736934 6480464 GSTT1 protein results in increased glutathionylation of microcystin RR CTD PMID:23538035 Gstt1 Rat microcystin-LR multiple interactions ISO RGD:736934 6480464 GSTT1 protein results in increased glutathionylation of and affects the susceptibility to cyanoginosin LR CTD PMID:21504230 Gstt1 Rat muconic acid affects abundance ISO RGD:736934 6480464 GSTT1 affects the abundance of muconic acid CTD PMID:10780264 Gstt1 Rat N-acetyl-S-phenyl-L-cysteine multiple interactions ISO RGD:736934 6480464 [GSTT1 gene SNP affects the metabolism of Benzene] which affects the abundance of S-phenyl-N-acetylcysteine; GSTT1 more ... CTD PMID:20100551|PMID:30086327 Gstt1 Rat N-acetyl-S-phenyl-L-cysteine affects chemical synthesis ISO RGD:736934 6480464 GSTT1 protein polymorphism affects the chemical synthesis of S-phenyl-N-acetylcysteine CTD PMID:15533900|PMID:15935803 Gstt1 Rat N-acetyl-S-phenyl-L-cysteine affects abundance ISO RGD:736934 6480464 GSTT1 gene polymorphism affects the abundance of S-phenyl-N-acetylcysteine; GSTT1 polymorphism affects the abundance of S-phenyl-N-acetylcysteine CTD PMID:20100551|PMID:21300142 Gstt1 Rat N-ethyl-N-nitrosourea affects response to substance ISO RGD:736934 6480464 GSTT1 gene polymorphism affects the susceptibility to Ethylnitrosourea CTD PMID:17158087 Gstt1 Rat naphthalene decreases expression ISO RGD:10700 6480464 naphthalene results in decreased expression of GSTT1 mRNA CTD PMID:31020322 Gstt1 Rat nickel atom decreases expression ISO RGD:736934 6480464 Nickel results in decreased expression of GSTT1 mRNA CTD PMID:24768652 Gstt1 Rat nickel dichloride decreases expression ISO RGD:10700 6480464 nickel chloride results in decreased expression of GSTT1 mRNA CTD PMID:12729255|PMID:14645679 Gstt1 Rat nickel subsulfide decreases expression ISO RGD:10700 6480464 nickel subsulfide results in decreased expression of GSTT1 mRNA CTD PMID:12729255 Gstt1 Rat nitrogen dioxide affects response to substance ISO RGD:736934 6480464 GSTT1 gene polymorphism affects the susceptibility to Nitrogen Dioxide CTD PMID:22732554 Gstt1 Rat obeticholic acid increases expression ISO RGD:736934 6480464 obeticholic acid results in increased expression of GSTT1 mRNA CTD PMID:27939613 Gstt1 Rat ochratoxin A decreases expression EXP 6480464 ochratoxin A results in decreased expression of GSTT1 mRNA CTD PMID:23358140 Gstt1 Rat oltipraz affects localization EXP 6480464 oltipraz affects the localization of GSTT1 protein CTD PMID:10413528|PMID:9794803 Gstt1 Rat oltipraz increases expression EXP 6480464 oltipraz results in increased expression of GSTT1 protein CTD PMID:9794803|PMID:9855024 Gstt1 Rat omeprazole affects expression EXP 6480464 Omeprazole affects the expression of GSTT1 mRNA CTD PMID:19483382 Gstt1 Rat oxirane affects abundance ISO RGD:736934 6480464 GSTT1 protein affects the abundance of Ethylene Oxide metabolite CTD PMID:17416773 Gstt1 Rat ozone affects response to substance ISO RGD:736934 6480464 GSTT1 gene polymorphism affects the susceptibility to Ozone CTD PMID:22732554 Gstt1 Rat p-nitrobenzyl chloride affects metabolic processing ISO RGD:736934 6480464 GSTT1 protein affects the metabolism of 4-nitrobenzyl chloride CTD PMID:15683365 Gstt1 Rat p-nitrobenzyl chloride increases glutathionylation ISO RGD:736934 6480464 GSTT1 protein results in increased glutathionylation of 4-nitrobenzyl chloride CTD PMID:19664997 Gstt1 Rat p-nitrobenzyl chloride affects metabolic processing ISO RGD:10700 6480464 GSTT1 protein affects the metabolism of 4-nitrobenzyl chloride CTD PMID:9854036 Gstt1 Rat paclitaxel multiple interactions ISO RGD:736934 6480464 GSTT1 gene polymorphism affects the susceptibility to [Paclitaxel co-treated with Cisplatin] CTD PMID:12851839 Gstt1 Rat paracetamol affects expression ISO RGD:10700 6480464 Acetaminophen affects the expression of GSTT1 mRNA CTD PMID:17562736 Gstt1 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of GSTT1 mRNA CTD PMID:33387578 Gstt1 Rat paracetamol multiple interactions ISO RGD:736934 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated more ... CTD PMID:33819548 Gstt1 Rat paracetamol increases expression ISO RGD:736934 6480464 Acetaminophen results in increased expression of GSTT1 mRNA CTD PMID:29067470 Gstt1 Rat paracetamol multiple interactions ISO RGD:10700 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of GSTT1 mRNA; [CTH gene mutant form results more ... CTD PMID:17585979|PMID:25499718 Gstt1 Rat paraquat affects response to substance ISO RGD:736934 6480464 GSTT1 protein affects the susceptibility to Paraquat CTD PMID:23045187 Gstt1 Rat parathion-methyl multiple interactions ISO RGD:736934 6480464 GSTT1 protein affects the metabolism of and results in decreased alkylation of Methyl Parathion CTD PMID:15103050 Gstt1 Rat perfluorooctane-1-sulfonic acid affects expression ISO RGD:10700 6480464 perfluorooctane sulfonic acid affects the expression of GSTT1 mRNA CTD PMID:19429403 Gstt1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:10700 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of GSTT1 mRNA; [perfluorooctane sulfonic more ... CTD PMID:36331819 Gstt1 Rat perfluorooctanoic acid affects expression ISO RGD:10700 6480464 perfluorooctanoic acid affects the expression of GSTT1 mRNA CTD PMID:19429403 Gstt1 Rat phenethyl isothiocyanate increases expression EXP 6480464 phenethyl isothiocyanate results in increased expression of GSTT1 protein CTD PMID:9855024 Gstt1 Rat phenobarbital affects expression ISO RGD:10700 6480464 Phenobarbital affects the expression of GSTT1 mRNA CTD PMID:23091169 Gstt1 Rat phenobarbital affects expression EXP 6480464 Phenobarbital affects the expression of GSTT1 mRNA CTD PMID:19162173 Gstt1 Rat phenobarbital increases expression ISO RGD:10700 6480464 Phenobarbital results in increased expression of GSTT1 mRNA CTD PMID:18723825|PMID:9854036 Gstt1 Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of GSTT1 mRNA; Phenobarbital results in increased expression of GSTT1 more ... CTD PMID:10413528|PMID:9794803 Gstt1 Rat PhIP affects response to substance ISO RGD:736934 6480464 GSTT1 gene polymorphism affects the susceptibility to 2-amino-1-methyl-6-phenylimidazo(4,5-b)pyridine CTD PMID:22564066 Gstt1 Rat phlorizin increases expression ISO RGD:10700 6480464 Phlorhizin results in increased expression of GSTT1 mRNA CTD PMID:22538082 Gstt1 Rat phlorizin decreases expression ISO RGD:10700 6480464 Phlorhizin results in decreased expression of GSTT1 mRNA CTD PMID:22538082 Gstt1 Rat phorbol 13-acetate 12-myristate multiple interactions ISO RGD:10700 6480464 [sodium arsenite co-treated with Tetradecanoylphorbol Acetate] results in increased expression of GSTT1 mRNA CTD PMID:16368122 Gstt1 Rat pioglitazone multiple interactions ISO RGD:10700 6480464 [N-nitroso-tris-chloroethylurea co-treated with pioglitazone] results in decreased expression of GSTT1 mRNA CTD PMID:27935865 Gstt1 Rat pirinixic acid multiple interactions ISO RGD:10700 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ... CTD PMID:19710929 Gstt1 Rat pirinixic acid affects expression EXP 6480464 pirinixic acid affects the expression of GSTT1 mRNA CTD PMID:19483382 Gstt1 Rat piroxicam increases expression EXP 6480464 Piroxicam results in increased expression of GSTT1 protein CTD PMID:9729437 Gstt1 Rat potassium chloride multiple interactions EXP 6480464 [Desoxycorticosterone Acetate co-treated with Sodium Chloride, Dietary co-treated with Potassium Chloride] results in decreased expression more ... CTD PMID:22228705 Gstt1 Rat potassium dichromate increases expression ISO RGD:736934 6480464 Potassium Dichromate results in increased expression of GSTT1 mRNA CTD PMID:18332044 Gstt1 Rat progesterone multiple interactions ISO RGD:736934 6480464 [Progesterone co-treated with Estradiol] results in decreased expression of GSTT1 mRNA CTD PMID:17404688 Gstt1 Rat propargite increases response to substance ISO RGD:736934 6480464 GSTT1 gene mutant form results in increased susceptibility to Omite CTD PMID:30446643 Gstt1 Rat propiconazole increases expression ISO RGD:10700 6480464 propiconazole results in increased expression of GSTT1 mRNA CTD PMID:22334560 Gstt1 Rat pyrazinecarboxamide multiple interactions ISO RGD:736934 6480464 GSTT1 gene polymorphism results in increased susceptibility to [Isoniazid co-treated with Rifampin co-treated with Pyrazinamide] CTD PMID:18397238 Gstt1 Rat quercetin decreases expression ISO RGD:10700 6480464 Quercetin results in decreased expression of GSTT1 mRNA CTD PMID:16455785 Gstt1 Rat quercetin decreases expression ISO RGD:736934 6480464 Quercetin results in decreased expression of GSTT1 protein CTD PMID:22830632 Gstt1 Rat radon atom increases response to substance ISO RGD:736934 6480464 GSTT1 gene mutant form results in increased susceptibility to Radon CTD PMID:24852519 Gstt1 Rat radon(0) increases response to substance ISO RGD:736934 6480464 GSTT1 gene mutant form results in increased susceptibility to Radon CTD PMID:24852519 Gstt1 Rat rifampicin multiple interactions ISO RGD:736934 6480464 GSTT1 gene polymorphism affects the susceptibility to [Isoniazid co-treated with Rifampin]; GSTT1 gene polymorphism results more ... CTD PMID:18397238|PMID:20485159 Gstt1 Rat selenium atom increases expression EXP 6480464 Selenium deficiency results in increased expression of GSTT1 CTD PMID:9331086 Gstt1 Rat senecionine decreases expression ISO RGD:736934 6480464 senecionine results in decreased expression of GSTT1 mRNA CTD PMID:26100227 Gstt1 Rat sirolimus increases response to substance ISO RGD:736934 6480464 GSTT1 gene mutant form results in increased susceptibility to Sirolimus CTD PMID:12916871 Gstt1 Rat sodium arsenite multiple interactions ISO RGD:10700 6480464 [sodium arsenite co-treated with Tetradecanoylphorbol Acetate] results in increased expression of GSTT1 mRNA CTD PMID:16368122 Gstt1 Rat sodium arsenite decreases expression ISO RGD:10700 6480464 sodium arsenite results in decreased expression of GSTT1 mRNA CTD PMID:29108910 Gstt1 Rat sodium arsenite affects expression ISO RGD:10700 6480464 sodium arsenite affects the expression of GSTT1 mRNA CTD PMID:16507464 Gstt1 Rat sodium arsenite increases expression ISO RGD:10700 6480464 sodium arsenite results in increased expression of GSTT1 mRNA CTD PMID:17451858 Gstt1 Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of GSTT1 mRNA CTD PMID:12325037 Gstt1 Rat sterigmatocystin multiple interactions EXP 6480464 GSTT1 protein affects the metabolism of and results in decreased activity of Sterigmatocystin metabolite CTD PMID:8951341 Gstt1 Rat stilbene oxide increases expression EXP 6480464 stilbene oxide results in increased expression of GSTT1 protein CTD PMID:9794803 Gstt1 Rat styrene multiple interactions ISO RGD:736934 6480464 GSTM1 gene polymorphism promotes the reaction [GSTT1 gene polymorphism results in increased susceptibility to Styrene] CTD PMID:12016165 Gstt1 Rat styrene increases response to substance ISO RGD:736934 6480464 GSTT1 gene polymorphism results in increased susceptibility to Styrene CTD PMID:12016165|PMID:16424821 Gstt1 Rat styrene affects response to substance ISO RGD:736934 6480464 GSTT1 gene polymorphism affects the susceptibility to Styrene CTD PMID:12717779|PMID:14751678 Gstt1 Rat styrene oxide increases response to substance ISO RGD:736934 6480464 GSTT1 gene polymorphism results in increased susceptibility to styrene oxide CTD PMID:12016165 Gstt1 Rat styrene oxide affects response to substance ISO RGD:736934 6480464 GSTT1 protein affects the susceptibility to styrene oxide CTD PMID:15468052 Gstt1 Rat sulforaphane decreases expression ISO RGD:736934 6480464 sulforaphane results in decreased expression of GSTT1 mRNA CTD PMID:20442190 Gstt1 Rat sulforaphane multiple interactions ISO RGD:10700 6480464 [NFE2L2 protein affects the susceptibility to sulforaphane] which affects the expression of GSTT1 mRNA CTD PMID:30529165 Gstt1 Rat sulforaphane increases expression EXP 6480464 sulforaphane analog results in increased expression of GSTT1 protein CTD PMID:9855024 Gstt1 Rat sulindac increases expression EXP 6480464 Sulindac results in increased expression of GSTT1 protein CTD PMID:9729437 Gstt1 Rat Sunset Yellow FCF multiple interactions ISO RGD:736934 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated more ... CTD PMID:33819548 Gstt1 Rat tartrazine multiple interactions ISO RGD:736934 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated more ... CTD PMID:33819548 Gstt1 Rat tert-butyl hydroperoxide affects metabolic processing ISO RGD:10700 6480464 GSTT1 protein affects the metabolism of tert-Butylhydroperoxide CTD PMID:9854036 Gstt1 Rat testosterone multiple interactions ISO RGD:10700 6480464 1,2-dibromo-4-(1,2-dibromoethyl)cyclohexane inhibits the reaction [Testosterone deficiency results in increased expression of GSTT1 mRNA] CTD PMID:33848595 Gstt1 Rat testosterone increases expression ISO RGD:10700 6480464 Testosterone deficiency results in increased expression of GSTT1 mRNA CTD PMID:33848595 Gstt1 Rat tetrachloromethane affects expression ISO RGD:10700 6480464 Carbon Tetrachloride affects the expression of GSTT1 mRNA CTD PMID:17484886 Gstt1 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of GSTT1 mRNA CTD PMID:31150632 Gstt1 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of GSTT1 mRNA] CTD PMID:31150632 Gstt1 Rat tetrachloromethane decreases expression ISO RGD:10700 6480464 Carbon Tetrachloride results in decreased expression of GSTT1 mRNA CTD PMID:27339419|PMID:31919559 Gstt1 Rat thiabendazole increases expression EXP 6480464 Thiabendazole results in increased expression of GSTT1 mRNA CTD PMID:15110098 Gstt1 Rat thimerosal affects response to substance ISO RGD:736934 6480464 GSTT1 affects the susceptibility to Thimerosal CTD PMID:11007341 Gstt1 Rat thimerosal decreases expression ISO RGD:736934 6480464 Thimerosal results in decreased expression of GSTT1 mRNA CTD PMID:27188386 Gstt1 Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of GSTT1 mRNA CTD PMID:19483382 Gstt1 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of GSTT1 mRNA CTD PMID:34492290 Gstt1 Rat triadimefon increases expression ISO RGD:10700 6480464 triadimefon results in increased expression of GSTT1 mRNA CTD PMID:16730040 Gstt1 Rat trichloroethene decreases expression ISO RGD:10700 6480464 Trichloroethylene results in decreased expression of GSTT1 mRNA CTD PMID:19448997 Gstt1 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of GSTT1 mRNA CTD PMID:33387578 Gstt1 Rat triclosan multiple interactions ISO RGD:736934 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated more ... CTD PMID:33819548 Gstt1 Rat triphenyl phosphate increases expression EXP 6480464 triphenyl phosphate results in increased expression of GSTT1 mRNA CTD PMID:30589522 Gstt1 Rat troglitazone affects response to substance ISO RGD:736934 6480464 GSTT1 gene polymorphism affects the susceptibility to troglitazone CTD PMID:12732844 Gstt1 Rat tunicamycin decreases expression ISO RGD:10700 6480464 Tunicamycin results in decreased expression of GSTT1 mRNA CTD PMID:17127020 Gstt1 Rat valproic acid affects expression ISO RGD:736934 6480464 Valproic Acid affects the expression of GSTT1 mRNA CTD PMID:25979313 Gstt1 Rat valproic acid decreases expression ISO RGD:736934 6480464 Valproic Acid results in decreased expression of GSTT1 mRNA CTD PMID:23179753|PMID:29154799 Gstt1 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of GSTT1 mRNA CTD PMID:23034163 Gstt1 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of GSTT1 mRNA CTD PMID:22570695 Gstt1 Rat xanthohumol increases expression ISO RGD:736934 6480464 xanthohumol results in increased expression of GSTT1 mRNA; xanthohumol results in increased expression of GSTT1 more ... CTD PMID:23085367
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(+)-schisandrin B (EXP) (1->4)-beta-D-glucan (ISO) (E)-1,3-dichloropropene (EXP) (R,R,R)-alpha-tocopherol (EXP) 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP) 1,2-dibromoethane (EXP,ISO) 1,2-dimethylhydrazine (ISO) 1,2-epoxy-3-(4-nitrophenoxy)propane (EXP,ISO) 1-chloro-2,4-dinitrobenzene (ISO) 1-naphthyl isothiocyanate (EXP) 17beta-estradiol (ISO) 1H-pyrazole (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4,6-trinitrobenzenesulfonic acid (EXP) 2,4,6-trinitrotoluene (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,6-di-tert-butyl-4-methylphenol (EXP) 2-amino-2-deoxy-D-glucopyranose (ISO) 2-amino-7-methyl-1,7-dihydro-6H-purin-6-one (ISO) 2-butoxyethanol (ISO) 2-methylcholine (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3-chloropropane-1,2-diol (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3-phenylprop-2-enal (ISO) 3H-1,2-dithiole-3-thione (EXP) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 5-fluorouracil (ISO) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP) 6-propyl-2-thiouracil (EXP) 7,9-dihydro-1H-purine-2,6,8(3H)-trione (ISO) acetylsalicylic acid (EXP) acrylamide (EXP,ISO) aflatoxin B1 (EXP,ISO) aldehydo-D-glucosamine (ISO) amiodarone (EXP) ammonium chloride (EXP) amphotericin B (EXP) angelica lactone (EXP) aristolochic acid A (EXP) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) asbestos (ISO) atrazine (EXP) benzbromarone (EXP) benzene (ISO) benzo[a]pyrene (ISO) benzyl isothiocyanate (EXP) beta-D-glucosamine (ISO) bisphenol A (EXP,ISO) bromobenzene (EXP) bromodichloromethane (EXP,ISO) bromomethane (ISO) busulfan (ISO) buta-1,3-diene (ISO) butylated hydroxyanisole (EXP) cadmium dichloride (EXP) carbamazepine (ISO) carbon disulfide (ISO) carbon nanotube (ISO) carmustine (ISO) chenodeoxycholic acid (ISO) chloroethene (ISO) chlorohydrocarbon (ISO) chloromethane (ISO) chlorpyrifos (EXP) cisplatin (ISO) clofibrate (EXP,ISO) cobalt dichloride (EXP) copper atom (EXP) copper(0) (EXP) coumarin (EXP) cumene hydroperoxide (ISO) Cuprizon (EXP) cyclosporin A (ISO) cylindrospermopsin (ISO) cyproconazole (ISO) deoxycholic acid (ISO) Deoxycorticosterone acetate (EXP) dexamethasone (EXP,ISO) Diallyl sulfide (EXP) diarsenic trioxide (ISO) diazinon (EXP) dibromomethane (EXP,ISO) dichloromethane (EXP,ISO) diclofenac (ISO) diepoxybutane (EXP,ISO) diethyl maleate (EXP) dimethylarsinic acid (ISO) disodium selenite (ISO) elemental selenium (EXP) ellagic acid (EXP) epoxiconazole (ISO) ethanol (ISO) ethoxyquin (EXP,ISO) folic acid (ISO) formaldehyde (ISO) furan (EXP) genistein (ISO) glutathione (EXP,ISO) glycochenodeoxycholic acid (ISO) glycocholic acid (ISO) glycodeoxycholic acid (ISO) graphite (EXP) herbicide (EXP) hydrogen peroxide (ISO) hydroquinone (ISO) ibuprofen (EXP) indole-3-methanol (EXP) indometacin (EXP) inulin (ISO) isoniazide (ISO) isothiocyanate (ISO) L-ascorbic acid (ISO) L-ethionine (EXP) lead nitrate (ISO) lead(0) (ISO) lipopolysaccharide (ISO) malonaldehyde (ISO) MeIQx (ISO) mercury atom (ISO) mercury(0) (ISO) methamphetamine (ISO) methimazole (EXP) methoxyacetic acid (EXP) methylarsonic acid (ISO) microcystin (EXP) microcystin RR (ISO) microcystin-LR (ISO) muconic acid (ISO) N-acetyl-S-phenyl-L-cysteine (ISO) N-ethyl-N-nitrosourea (ISO) naphthalene (ISO) nickel atom (ISO) nickel dichloride (ISO) nickel subsulfide (ISO) nitrogen dioxide (ISO) obeticholic acid (ISO) ochratoxin A (EXP) oltipraz (EXP) omeprazole (EXP) oxirane (ISO) ozone (ISO) p-nitrobenzyl chloride (ISO) paclitaxel (ISO) paracetamol (EXP,ISO) paraquat (ISO) parathion-methyl (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenethyl isothiocyanate (EXP) phenobarbital (EXP,ISO) PhIP (ISO) phlorizin (ISO) phorbol 13-acetate 12-myristate (ISO) pioglitazone (ISO) pirinixic acid (EXP,ISO) piroxicam (EXP) potassium chloride (EXP) potassium dichromate (ISO) progesterone (ISO) propargite (ISO) propiconazole (ISO) pyrazinecarboxamide (ISO) quercetin (ISO) radon atom (ISO) radon(0) (ISO) rifampicin (ISO) selenium atom (EXP) senecionine (ISO) sirolimus (ISO) sodium arsenite (ISO) sodium dichromate (EXP) sterigmatocystin (EXP) stilbene oxide (EXP) styrene (ISO) styrene oxide (ISO) sulforaphane (EXP,ISO) sulindac (EXP) Sunset Yellow FCF (ISO) tartrazine (ISO) tert-butyl hydroperoxide (ISO) testosterone (ISO) tetrachloromethane (EXP,ISO) thiabendazole (EXP) thimerosal (ISO) thioacetamide (EXP) triadimefon (ISO) trichloroethene (EXP,ISO) triclosan (ISO) triphenyl phosphate (EXP) troglitazone (ISO) tunicamycin (ISO) valproic acid (ISO) vinclozolin (EXP) xanthohumol (ISO)
1.
GSTM1, GSTT1, GSTP1 and CYP1A1 genetic polymorphisms and susceptibility to esophageal cancer in a French population: different pattern of squamous cell carcinoma and adenocarcinoma.
Abbas A, etal., World J Gastroenterol. 2004 Dec 1;10(23):3389-93.
2.
T null and M null genotypes of the glutathione S-transferase gene are risk factor for CAD independent of smoking.
Abu-Amero KK, etal., BMC Med Genet. 2006 Apr 19;7:38.
3.
GSTM1 and GSTT1 deletion genotypes in various spontaneous optic neuropathies in Arabs.
Abu-Amero KK, etal., Br J Ophthalmol. 2009 Aug;93(8):1101-4. Epub 2009 Mar 13.
4.
Audioprofiles and antioxidant enzyme genotypes in presbycusis.
Angeli SI, etal., Laryngoscope. 2012 Nov;122(11):2539-42. doi: 10.1002/lary.23577. Epub 2012 Sep 10.
5.
Increased risk for acute myeloid leukaemia in individuals with glutathione S-transferase mu 1 (GSTM1) and theta 1 (GSTT1) gene defects.
Arruda VR, etal., Eur J Haematol. 2001 Jun;66(6):383-8.
6.
Genetic polymorphism of glutathione S transferases M1 and T1 in Indian patients with hepatocellular carcinoma.
Asim M, etal., Dis Markers. 2010;28(6):369-76. doi: 10.3233/DMA-2010-0717.
7.
Glutathione S-transferase gene polymorphisms in presbycusis.
Ates NA, etal., Otol Neurotol. 2005 May;26(3):392-7.
8.
Glutathione S-transferase M1 and T1 polymorphisms may predict adverse effects after therapy in children with medulloblastoma.
Barahmani N, etal., Neuro Oncol. 2009 Jun;11(3):292-300. Epub 2008 Oct 24.
9.
GSTT1 polymorphism and oral leukoplakia.
Barroso Duarte EC, etal., Anticancer Res. 2006 Jan-Feb;26(1A):427-30.
10.
Glutathione S-transferase theta 1 (GSTT1) gene defect in myelodysplasia and acute myeloid leukaemia.
Basu T, etal., Lancet. 1997 May 17;349(9063):1450.
11.
Glutathione S-transferase activity and subunit composition in transitional cell cancer and mucosa of the human bladder.
Berendsen CL, etal., Urology. 1997 Apr;49(4):644-51.
12.
Biobreeding rat islets exhibit reduced antioxidative defense and N-acetyl cysteine treatment delays type 1 diabetes.
Bogdani M, etal., J Endocrinol. 2013 Jan 18;216(2):111-23. doi: 10.1530/JOE-12-0385. Print 2013 Feb.
13.
Genetic polymorphisms of glutathione S-transferases and disease activity of rheumatoid arthritis.
Bohanec Grabar P, etal., Clin Exp Rheumatol. 2009 Mar-Apr;27(2):229-36.
14.
Profile of polymorphisms of drug-metabolising enzymes and the risk of therapy-related leukaemia.
Bolufer P, etal., Br J Haematol. 2007 Feb;136(4):590-6.
15.
Possible gene dosage effect of glutathione-S-transferases on atopic asthma: using real-time PCR for quantification of GSTM1 and GSTT1 gene copy numbers.
Brasch-Andersen C, etal., Hum Mutat. 2004 Sep;24(3):208-14.
16.
Association study of multiple gene polymorphisms with the risk of adult-onset primary open-angle glaucoma in a Mexican population.
Buentello-Volante B, etal., Exp Eye Res. 2013 Feb;107:59-64. doi: 10.1016/j.exer.2012.11.013. Epub 2012 Nov 30.
17.
Glutathione S-transferases M1-1 and T1-1 as risk modifiers for renal cell cancer associated with occupational exposure to chemicals.
Buzio L, etal., Occup Environ Med. 2003 Oct;60(10):789-93.
18.
Glutathione S-transferases M1, T1 genotypes and the risk of gastric cancer: a case-control study.
Cai L, etal., World J Gastroenterol. 2001 Aug;7(4):506-9. doi: 10.3748/wjg.v7.i4.506.
19.
The influence of genetic variation in oxidative stress genes on human noise susceptibility.
Carlsson PI, etal., Hear Res. 2005 Apr;202(1-2):87-96.
20.
Genetic polymorphisms of microsomal epoxide hydroxylase and glutathione S-transferases M1, T1 and P1, interactions with smoking, and risk for esophageal (Barrett) adenocarcinoma.
Casson AG, etal., Cancer Detect Prev. 2006;30(5):423-31. Epub 2006 Oct 24.
21.
Increased risk for myelodysplastic syndromes in individuals with glutathione transferase theta 1 (GSTT1) gene defect.
Chen H, etal., Lancet. 1996 Feb 3;347(8997):295-7.
22.
Genetic polymorphisms of metabolic enzymes CYP1A1, CYP2D6, GSTM1 and GSTT1 and leukemia susceptibility.
Chen HC, etal., Eur J Cancer Prev. 2008 Jun;17(3):251-8. doi: 10.1097/CEJ.0b013e3282b72093.
23.
A meta-analysis of the relationship between glutathione S-transferases gene polymorphism and hepatocellular carcinoma in Asian population.
Chen J, etal., Mol Biol Rep. 2012 Dec;39(12):10383-93. doi: 10.1007/s11033-012-1917-0. Epub 2012 Oct 10.
24.
Glutathione-S-transferase genotypes influence the risk of chemotherapy-related toxicities and prognosis in Korean patients with diffuse large B-cell lymphoma.
Cho HJ, etal., Cancer Genet Cytogenet. 2010 Apr 1;198(1):40-6. doi: 10.1016/j.cancergencyto.2009.12.004.
25.
Association of glutathione-S-transferase polymorphisms with atopic dermatitis risk in preschool age children.
Chung J, etal., Clin Chem Lab Med. 2009;47(12):1475-81.
26.
Impact on response and survival of DNA repair single nucleotide polymorphisms in relapsed or refractory multiple myeloma patients treated with thalidomide.
Cibeira MT, etal., Leuk Res. 2011 Sep;35(9):1178-83. doi: 10.1016/j.leukres.2011.02.009. Epub 2011 Mar 23.
27.
Association of periodontitis with GSTM1/GSTT1-null variants--a pilot study.
Concolino P, etal., Clin Biochem. 2007 Sep;40(13-14):939-45. doi: 10.1016/j.clinbiochem.2007.04.012. Epub 2007 Apr 27.
28.
Maternal and paternal environmental risk factors, metabolizing GSTM1 and GSTT1 polymorphisms, and congenital heart disease.
Cresci M, etal., Am J Cardiol. 2011 Dec 1;108(11):1625-31. doi: 10.1016/j.amjcard.2011.07.022. Epub 2011 Sep 3.
29.
GST genotype may modify clinical phenotype in patients with Fanconi anaemia.
Davies SM, etal., Br J Haematol. 2005 Oct;131(1):118-22.
30.
Genetic interaction of GSH metabolic pathway genes in cystic fibrosis.
de Lima Marson FA, etal., BMC Med Genet. 2013 Jun 10;14:60. doi: 10.1186/1471-2350-14-60.
31.
Association between the genetic polymorphisms of glutathione S-transferase (GSTM1 and GSTT1) and the clinical manifestations in sickle cell anemia.
de Oliveira Filho RA, etal., Blood Cells Mol Dis. 2013 Aug;51(2):76-9. doi: 10.1016/j.bcmd.2013.03.003. Epub 2013 Apr 13.
32.
Association of combined genetic variations in SOD3, GPX3, PON1, and GSTT1 with hypertension and severity of coronary artery disease.
Decharatchakul N, etal., Heart Vessels. 2020 Jul;35(7):918-929. doi: 10.1007/s00380-020-01564-6. Epub 2020 Feb 8.
33.
A case-control study of CYP1A1, GSTT1 and GSTM1 gene polymorphisms, pregnancy smoking and fetal growth restriction.
Delpisheh A, etal., Eur J Obstet Gynecol Reprod Biol. 2009 Mar;143(1):38-42. doi: 10.1016/j.ejogrb.2008.11.006. Epub 2009 Jan 14.
34.
Glutathione S transferase theta 1 gene (GSTT1) null genotype is associated with an increased risk for acquired aplastic anemia in children.
Dirksen U, etal., Pediatr Res. 2004 Mar;55(3):466-71. Epub 2003 Dec 17.
35.
Increased cardiovascular morbidity and mortality in type 2 diabetes is associated with the glutathione S transferase theta-null genotype: a Go-DARTS study.
Doney AS, etal., Circulation. 2005 Jun 7;111(22):2927-34. Epub 2005 May 31.
36.
Genetic polymorphisms of carcinogen metabolizing enzymes are associated with oral leukoplakia development and p53 overexpression.
Duarte EC, etal., Anticancer Res. 2008 Mar-Apr;28(2A):1101-6.
37.
A population-based, case-control study of polymorphisms in carcinogen-metabolizing genes, smoking, and pancreatic adenocarcinoma risk.
Duell EJ, etal., J Natl Cancer Inst. 2002 Feb 20;94(4):297-306. doi: 10.1093/jnci/94.4.297.
38.
Glutathione S-transferase T1-null seems to be associated with graft failure in hematopoietic SCT.
Elhasid R, etal., Bone Marrow Transplant. 2010 Dec;45(12):1728-31. doi: 10.1038/bmt.2010.61. Epub 2010 Mar 29.
39.
Genetic polymorphism of GSTT1 and GSTM1 and susceptibility to chronic obstructive pulmonary disease (COPD).
Faramawy MM, etal., J Crit Care. 2009 Sep;24(3):e7-10.
40.
Correlating of GSTM1, GSTT1, and GSTP1 genetic polymorphisms with the risk and expressions in children with isolated Hirschsprung disease.
Gao H, etal., Int J Colorectal Dis. 2011 Jan;26(1):117-25. doi: 10.1007/s00384-010-1013-7. Epub 2010 Jul 27.
41.
Glutathione S-transferase mu and theta polymorphisms and breast cancer susceptibility.
Garcia-Closas M, etal., J Natl Cancer Inst. 1999 Nov 17;91(22):1960-4.
42.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
43.
Association analysis of TNFR2, VDR, A2M, GSTT1, GSTM1, and ACE genes with rheumatoid arthritis in South Asians and Caucasians of East Midlands in the United Kingdom.
Ghelani AM, etal., Rheumatol Int. 2010 Apr 18.
44.
Association of CYP1A1, GSTM1, and GSTT1 gene polymorphism with risk of oral submucous fibrosis in a section of North Indian population.
Ghosh T, etal., Mol Biol Rep. 2012 Oct;39(10):9383-9. doi: 10.1007/s11033-012-1802-x. Epub 2012 Jul 1.
45.
Inheritance and Myelodysplasia progression.
Giannouli S and Voulgarelis M, Leuk Res. 2013 Oct;37(10):1185-6. doi: 10.1016/j.leukres.2013.06.001. Epub 2013 Jul 13.
46.
Dichloromethane mediated in vivo selection and functional characterization of rat glutathione S-transferase theta 1-1 variants.
Gisi D, etal., Eur J Biochem. 2001 Jul;268(14):4001-10.
47.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
48.
Evaluating glutathione S-transferase (GST) null genotypes (GSTT1 and GSTM1) as a potential biomarker of predisposition for developing leukopenia.
Goncalves MS, etal., Int J Lab Hematol. 2010 Feb;32(1 Pt 1):e49-56. doi: 10.1111/j.1751-553X.2009.01169.x. Epub 2009 Jun 23.
49.
Association GSTT1, GSTM1 and GSTP1 (Ile105Val) genetic polymorphisms in mothers with risk of congenital malformations in their children in Western Siberia: a case-control study.
Gordeeva LA, etal., Prenat Diagn. 2013 Nov;33(11):1095-101. doi: 10.1002/pd.4204. Epub 2013 Aug 24.
50.
The role of genetic determinant in the development of severe perinatal asphyxia.
Gorovenko NG, etal., Tsitol Genet. 2010 Sep-Oct;44(5):41-6.
51.
[Analysis of genetic predisposition to pulmonary tuberculosis in native Russians].
Gra OA, etal., Genetika. 2010 Feb;46(2):262-71.
52.
[Correlation between smoking and the polymorphisms of cytochrome P450 1A1-Msp I and glutathione S-transferase T1 genes and oral cancer].
Guo L, etal., Hua Xi Kou Qiang Yi Xue Za Zhi. 2012 Apr;30(2):187-91.
53.
Increased risk for therapy-associated hematologic malignancies in patients with carcinoma of the breast and combined homozygous gene deletions of glutathione transferases M1 and T1.
Haase D, etal., Leuk Res. 2002 Mar;26(3):249-54.
54.
A common variant in the glutathione S transferase gene is associated with elevated markers of inflammation and lipid peroxidation in subjects with diabetes mellitus.
Hayek T, etal., Atherosclerosis. 2006 Feb;184(2):404-12. Epub 2005 Jul 5.
55.
Rat liver theta-class glutathione S-transferases T1-1 and T2-2: their chromatographic, electrophoretic, immunochemical, and functional properties.
Hiratsuka A, etal., Anal Biochem. 1997 Oct 15;252(2):229-37.
56.
Combined glutathione S-transferase T1 and M1 positive genotypes afford protection against type 2 diabetes in Japanese.
Hori M, etal., Pharmacogenomics. 2007 Oct;8(10):1307-14.
57.
Genetic polymorphisms in genes encoding antioxidant enzymes are associated with diabetic retinopathy in type 1 diabetes.
Hovnik T, etal., Diabetes Care. 2009 Dec;32(12):2258-62. doi: 10.2337/dc09-0852. Epub 2009 Sep 14.
58.
Association of glutathione S-transferase polymorphisms (GSTM1 and GSTT1) with primary open-angle glaucoma: an evidence-based meta-analysis.
Huang W, etal., Gene. 2013 Sep 10;526(2):80-6. doi: 10.1016/j.gene.2013.05.032. Epub 2013 Jun 4.
59.
Glutathione S-Transferase M1 and T1 Gene Polymorphisms and the Outcome of Chronic Hepatitis C Virus Infection in Egyptian Patients.
Ibrahim AM, etal., Ann Hum Genet. 2016 Jan;80(1):32-7. doi: 10.1111/ahg.12138. Epub 2015 Nov 9.
60.
Influence of glutathione-related genes on symptoms and immunologic markers among vulcanization workers in the southern Sweden rubber industries.
Jonsson LS, etal., Int Arch Occup Environ Health. 2008 Jul;81(7):913-9. Epub 2007 Dec 8.
61.
Interaction of glutathione S-transferase M1 and T1 genotypes and malignant melanoma.
Kanetsky PA, etal., Cancer Epidemiol Biomarkers Prev. 2001 May;10(5):509-13.
62.
Influence of glutathione-S-transferase theta (GSTT1) and micro (GSTM1) gene polymorphisms on the susceptibility of hepatocellular carcinoma in Taiwan.
Kao CC, etal., J Surg Oncol. 2010 Sep 15;102(4):301-7. doi: 10.1002/jso.21643.
63.
Non-Jewish Israeli IBD patients have significantly higher glutathione S-transferase GSTT1-null frequency.
Karban A, etal., Dig Dis Sci. 2011 Jul;56(7):2081-7. Epub 2011 Jan 18.
64.
Effect of interactions of glutathione S-transferase T1, M1, and P1 and HMOX1 gene promoter polymorphisms with heavy smoking on the risk of rheumatoid arthritis.
Keenan BT, etal., Arthritis Rheum. 2010 Nov;62(11):3196-210. doi: 10.1002/art.27639.
65.
The association of glutathione S-transferase GSTT1 and GSTM1 gene polymorphism with pseudoexfoliative glaucoma in a Pakistani population.
Khan MI, etal., Mol Vis. 2010 Oct 26;16:2146-52.
66.
Combined analysis of germline polymorphisms of p53, GSTM1, GSTT1, CYP1A1, and CYP2E1: relation to the incidence rate of cervical carcinoma.
Kim JW, etal., Cancer. 2000 May 1;88(9):2082-91.
67.
Genetic polymorphisms in the cytochromes P-450 (1A1, 2E1), microsomal epoxide hydrolase and glutathione S-transferase M1, T1, and P1 genes, and their relationship with chronic bronchitis and relapsing pneumonia in children.
Korytina GF, etal., J Mol Med. 2005 Sep;83(9):700-10. Epub 2005 Jun 1.
68.
Polymorphisms of the glutathione S-transferases mu-1 (GSTM1) and theta-1 (GSTT1) and the risk of advanced alcoholic liver disease.
Ladero JM, etal., Scand J Gastroenterol. 2005 Mar;40(3):348-53. doi: 10.1080/00365520510012109.
69.
Clinical significance of GSTM1 and GSTT1 polymorphisms in younger patients with acute myeloid leukemia of intermediate-risk cytogenetics.
Lee HS, etal., Leuk Res. 2009 Mar;33(3):426-33. doi: 10.1016/j.leukres.2008.07.021. Epub 2008 Aug 29.
70.
[Genetic polymorphism of GST gene in children with infectious mononucleosis and acute lymphocytic leukemia].
Li YH, etal., Zhongguo Dang Dai Er Ke Za Zhi. 2012 Apr;14(4):260-3.
71.
Maternal smoking and oral clefts: the role of detoxification pathway genes.
Lie RT, etal., Epidemiology. 2008 Jul;19(4):606-15. doi: 10.1097/EDE.0b013e3181690731.
72.
Cystic fibrosis transmembrane conductance regulator gene mutations and glutathione S-transferase null genotypes in cystic fibrosis patients in Brazil.
Lima CS, etal., J Bras Pneumol. 2012 Jan-Feb;38(1):50-6. doi: 10.1590/s1806-37132012000100008.
73.
Xenobiotic gene polymorphisms and susceptibility to multiple myeloma.
Lincz LF, etal., Haematologica. 2004 May;89(5):628-9.
74.
Polymorphisms of glutathione S-transferase mu1 (GSTM1) and theta 1 (GSTT1) genes in chronic myeloid leukaemia.
Lourenco GJ, etal., Eur J Haematol. 2005 Dec;75(6):530-1.
75.
Are glutathione S-transferase polymorphisms (GSTM1, GSTT1) associated with primary open angle glaucoma? A meta-analysis.
Lu Y, etal., Gene. 2013 Sep 15;527(1):311-5. doi: 10.1016/j.gene.2013.06.031. Epub 2013 Jul 1.
76.
Association between GSTM1 and GSTT1 polymorphisms and esophageal squamous cell carcinoma: results from a case-control study in Kashmir, India.
Makhdoomi MA, etal., Tumour Biol. 2015 Apr;36(4):2613-9. doi: 10.1007/s13277-014-2882-0. Epub 2014 Nov 29.
77.
GSTM1 and GSTT1 polymorphisms and the risk of prostate cancer in a Caribbean population of African descent.
Mallick S, etal., Urology. 2007 Jun;69(6):1165-9.
78.
Gluthatione-S-transferase T1-null genotype predisposes adults to acute promyelocytic leukemia; a case-control study.
Mandegary A, etal., Asian Pac J Cancer Prev. 2011;12(5):1279-82.
79.
Glutathione S-transferase T1- and M1-null genotypes and coronary artery disease risk in patients with Type 2 diabetes mellitus.
Manfredi S, etal., Pharmacogenomics. 2009 Jan;10(1):29-34.
80.
Glutathione S-transferase polymorphisms in MS: their relationship to disability.
Mann CL, etal., Neurology. 2000 Feb 8;54(3):552-7.
81.
ADH1B, ALDH2, GSTM1 and GSTT1 Gene Polymorphic Frequencies among Alcoholics and Controls in the Arcadian
Population of Central India
Mansoori AA and Jain SK, Asian Pac J Cancer Prev. 2018 Mar 27;19(3):725-731. doi: 10.22034/APJCP.2018.19.3.725.
82.
Polymorphisms in the glutathione pathway modulate cystic fibrosis severity: a cross-sectional study.
Marson FA, etal., BMC Med Genet. 2014 Mar 4;15:27. doi: 10.1186/1471-2350-15-27.
83.
GSTT1 and GSTM1 null genotypes may facilitate hepatitis C virus infection becoming chronic.
Martínez C, etal., J Infect Dis. 2007 May 1;195(9):1320-3. doi: 10.1086/513569. Epub 2007 Mar 15.
84.
Glutathione S-transferases mu 1, theta 1, pi 1, alpha 1 and mu 3 genetic polymorphisms and the risk of colorectal and gastric cancers in humans.
Martínez C, etal., Pharmacogenomics. 2006 Jul;7(5):711-8. doi: 10.2217/14622416.7.5.711.
85.
Influence of glutathione S-transferase T1 donor/recipient mismatch and anti-GSTT1 antibodies in hepatic graft-versus-host-disease.
Martínez-Bravo MJ, etal., Immunol Lett. 2011 Dec 30;141(1):140-4. doi: 10.1016/j.imlet.2011.09.005. Epub 2011 Sep 24.
86.
Epidemiological factors related to GSTM1 and GSTT1 genes deletion in colon and rectum cancers: A case-control study.
Masood N, etal., Cancer Biomark. 2015;15(5):583-9. doi: 10.3233/CBM-150498.
87.
Protection conferred by selenium deficiency against aflatoxin B1 in the rat is associated with the hepatic expression of an aldo-keto reductase and a glutathione S-transferase subunit that metabolize the mycotoxin.
McLeod R, etal., Cancer Res. 1997 Oct 1;57(19):4257-66.
88.
Polymorphism of glutathione S-transferase M1 and T1 gene LOCI in COPD.
Mehrotra S, etal., Int J Immunogenet. 2010 Aug;37(4):263-7. Epub 2010 Apr 6.
89.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
90.
Analysis of polymorphisms of tumor necrosis factor-alpha and polymorphic xenobiotic metabolizing enzymes in inflammatory bowel disease: study from northern India.
Mittal RD, etal., J Gastroenterol Hepatol. 2007 Jun;22(6):920-4.
91.
Genetic polymorphisms in carcinogen metabolism and their association to hereditary nonpolyposis colon cancer.
Moisio AL, etal., Gastroenterology. 1998 Dec;115(6):1387-94.
92.
Glutathione S-transferase polymorphisms, cruciferous vegetable intake and cancer risk in the Central and Eastern European Kidney Cancer Study.
Moore LE, etal., Carcinogenesis. 2007 Sep;28(9):1960-4. Epub 2007 Jul 7.
93.
Role of glutathione-S-transferase (GST) polymorphisms in patients with advanced Hodgkin lymphoma: results from the HD2000 GISL trial.
Morabito F, etal., Leuk Lymphoma. 2012 Mar;53(3):406-10. doi: 10.3109/10428194.2011.623254.
94.
Gene-environment interaction in preterm delivery with special reference to organochlorine pesticides.
Mustafa MD, etal., Mol Hum Reprod. 2013 Jan;19(1):35-42. doi: 10.1093/molehr/gas039. Epub 2012 Sep 3.
95.
The role of glutathione-S-transferase polymorphisms in ovarian cancer survival.
Nagle CM, etal., Eur J Cancer. 2007 Jan;43(2):283-90. Epub 2006 Nov 3.
96.
Possible influence of glutathione S-transferase GSTT1 null genotype on age of onset of sporadic colorectal adenocarcinoma.
Nascimento H, etal., Dis Colon Rectum. 2003 Apr;46(4):510-5. doi: 10.1007/s10350-004-6591-4.
97.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
98.
The Interaction between GSTT1, GSTM1, and GSTP1 Ile105Val Gene Polymorphisms and Environmental Risk Factors in Premalignant Gastric Lesions Risk.
Negovan A, etal., Biomed Res Int. 2017;2017:7365080. doi: 10.1155/2017/7365080. Epub 2017 Jan 15.
99.
Association of GSTM1 and GSTT1 gene deletions with risk of head and neck cancer in Pakistan: a case control study.
Nosheen M, etal., Asian Pac J Cancer Prev. 2010;11(4):881-5.
100.
Molecular cloning and amino acid sequencing of rat liver class theta glutathione S-transferase Yrs-Yrs inactivating reactive sulfate esters of carcinogenic arylmethanols.
Ogura K, etal., Biochem Biophys Res Commun 1991 Dec 31;181(3):1294-300.
101.
Isolation and characterization of the gene encoding rat class theta glutathione S-transferase subunit yrs.
Ogura K, etal., Biochem Biophys Res Commun 1994 Dec 15;205(2):1250-6.
102.
Online Mendelian Inheritance in Man, OMIM (TM).
Online Mendelian Inheritance in Man, OMIM (TM).
103.
Polymorphisms of glutathione S-transferase mu1 (GSTM1) and theta1 (GSTT1) genes in multiple myeloma.
Ortega MM, etal., Acta Haematol. 2003;109(2):108-9.
104.
[Cytochrome P4501A1, glutathione S-transferase M1 and T1 gene polymorphisms in chronic myeloid leukemia].
Ovsepian VA, etal., Genetika. 2010 Oct;46(10):1360-2.
105.
Glutathione s-transferase m1, t1, and p1 gene polymorphism in exudative age-related macular degeneration: a preliminary report.
Oz O, etal., Eur J Ophthalmol. 2006 Jan - Feb;16(1):105-110. doi: 10.5301/EJO.2008.3524.
106.
The glutathione-S-transferase gene polymorphisms (Gstt1, Gstm1, and Gstp1) in patients with non-allergic nasal polyposis.
Ozcan C, etal., Eur Arch Otorhinolaryngol. 2010 Feb;267(2):227-32. Epub 2009 Aug 23.
107.
The impact of smoking on clinical features of Behcet's disease patients with glutathione S-transferase polymorphisms.
Ozer HT, etal., Clin Exp Rheumatol. 2012 May-Jun;30(3 Suppl 72):S14-7. Epub 2012 Oct 8.
108.
Quantitative dimensions of histopathological attributes and status of GSTM1-GSTT1 in oral submucous fibrosis.
Pal M, etal., Tissue Cell. 2008 Dec;40(6):425-35. doi: 10.1016/j.tice.2008.04.003. Epub 2008 Jun 24.
109.
GPX3 and GSTT1 as biomarkers related to oxidative stress during renal ischemia reperfusion injuries and their relationship with immune infiltration.
Pei J, etal., Front Immunol. 2023 Mar 22;14:1136146. doi: 10.3389/fimmu.2023.1136146. eCollection 2023.
110.
An evolutionary perspective on glutathione transferases inferred from class-theta glutathione transferase cDNA sequences.
Pemble SE and Taylor JB, Biochem J 1992 Nov 1;287 ( Pt 3):957-63.
111.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
112.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
113.
Cytochrome P4501A1 and glutathione S transferase gene polymorphisms in patients with aplastic anemia in India.
Poonkuzhali B, etal., Acta Haematol. 2005;114(3):127-32.
114.
Glutathione S-transferase T1 polymorphisms are associated with outcome in colorectal cancer.
Rajagopal R, etal., Carcinogenesis. 2005 Dec;26(12):2157-63. doi: 10.1093/carcin/bgi195. Epub 2005 Jul 28.
115.
GOA pipeline
RGD automated data pipeline
116.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
117.
GSTT1, GSTM1 and GSTP1 polymorphisms and susceptibility to juvenile idiopathic arthritis.
Rohr P, etal., Clin Exp Rheumatol. 2008 Jan-Feb;26(1):151-5.
118.
Glutathione transferase theta 1-1-dependent metabolism of the water disinfection byproduct bromodichloromethane.
Ross MK and Pegram RA, Chem Res Toxicol. 2003 Feb;16(2):216-26.
119.
Polymorphisms of GSTP1 and GSTT1, but not of CYP2A6, CYP2E1 or GSTM1, modify the risk for esophageal cancer in a western population.
Rossini A, etal., Carcinogenesis. 2007 Dec;28(12):2537-42. doi: 10.1093/carcin/bgm222. Epub 2007 Oct 4.
120.
Genetic Association and Gene-Gene Interaction Reveal Genetic Variations in ADH1B, GSTM1 and MnSOD Independently Confer Risk to Alcoholic Liver Diseases in India.
Roy N, etal., PLoS One. 2016 Mar 3;11(3):e0149843. doi: 10.1371/journal.pone.0149843. eCollection 2016.
121.
Copy number variations of GSTT1 and GSTM1, colorectal cancer risk and possible effect modification of cigarette smoking and menopausal hormone therapy.
Rudolph A, etal., Int J Cancer. 2012 Sep 1;131(5):E841-8. doi: 10.1002/ijc.27428. Epub 2012 May 29.
122.
Association between cataract and genetic polymorphisms of GSTM1, GSTT1, and GSTO2 with respect of work place.
Saadat I, etal., Mol Vis. 2012;18:1996-2000. Epub 2012 Jul 18.
123.
An evidence for correlation between the glutathione S-transferase T1 (GSTT1) polymorphism and outcome of COVID-19.
Saadat M, Clin Chim Acta. 2020 May 23;508:213-216. doi: 10.1016/j.cca.2020.05.041.
124.
Prevalence of glutathione S-transferase gene deletions and their effect on sickle cell patients.
Sanjay P, etal., Rev Bras Hematol Hemoter. 2012;34(2):100-2. doi: 10.5581/1516-8484.20120030.
125.
Genetic Polymorphisms of Multidrug Resistance Gene-1 (MDR1/ABCB1) and Glutathione S-Transferase Gene and the Risk of Inflammatory Bowel Disease among Moroccan Patients.
Senhaji N, etal., Mediators Inflamm. 2015;2015:248060. doi: 10.1155/2015/248060. Epub 2015 Oct 28.
126.
Glutathione S-transferase (GST) polymorphisms as risk factors for cancer in a highly homogeneous population from southern Italy.
Sgambato A, etal., Anticancer Res. 2002 Nov-Dec;22(6B):3647-52.
127.
Prenatal and infant acetaminophen exposure, antioxidant gene polymorphisms, and childhood asthma.
Shaheen SO, etal., J Allergy Clin Immunol. 2010 Dec;126(6):1141-8.e7. Epub 2010 Nov 4.
128.
GSTM1 and GSTT1 polymorphism and susceptibility to esophageal cancer in high- and low-risk regions of India.
Sharma A, etal., Tumour Biol. 2013 Oct;34(5):3249-57. doi: 10.1007/s13277-013-0897-6. Epub 2013 Jun 8.
129.
A case control study of gene environmental interaction in fetal growth restriction with special reference to organochlorine pesticides.
Sharma E, etal., Eur J Obstet Gynecol Reprod Biol. 2012 Apr;161(2):163-9. doi: 10.1016/j.ejogrb.2012.01.008. Epub 2012 Feb 4.
130.
Glutathione S-transferase gene deletions and their effect on iron status in HbE/beta thalassemia patients.
Sharma V, etal., Ann Hematol. 2010 Apr;89(4):411-4. doi: 10.1007/s00277-009-0847-y. Epub 2009 Oct 17.
131.
Polymorphism in CYP1A1, GSTMI, GSTT1 genes and organochlorine pesticides in the etiology of hypospadias.
Shekharyadav C, etal., Hum Exp Toxicol. 2011 Oct;30(10):1464-74. doi: 10.1177/0960327110392402. Epub 2011 Feb 7.
132.
Increased bioactivation of dihaloalkanes in rat liver due to induction of class theta glutathione S-transferase T1-1.
Sherratt PJ, etal., Biochem J. 1998 Nov 1;335 ( Pt 3):619-30.
133.
Residue 234 is a master switch of the alternative-substrate activity profile of human and rodent theta class glutathione transferase T1-1.
Shokeer A and Mannervik B, Biochim Biophys Acta. 2010 Apr;1800(4):466-73. doi: 10.1016/j.bbagen.2010.01.003. Epub 2010 Jan 25.
134.
Glutathione S-transferase M3 (A/A) genotype as a risk factor for oral cancer and leukoplakia among Indian tobacco smokers.
Sikdar N, etal., Int J Cancer. 2004 Mar;109(1):95-101. doi: 10.1002/ijc.11610.
135.
Association of GSTM1, GSTT1, and GSTM3 gene polymorphisms and susceptibility to cervical cancer in a North Indian population.
Singh H, etal., Am J Obstet Gynecol. 2008 Mar;198(3):303.e1-6. Epub 2008 Feb 21.
136.
Total activity of glutathione-S-transferase (GST) and polymorphisms of GSTM1 and GSTT1 genes conferring risk for the development of age related cataracts.
Sireesha R, etal., Exp Eye Res. 2012 May;98:67-74. doi: 10.1016/j.exer.2012.03.002. Epub 2012 Mar 16.
137.
Glutathione S-transferase P1 and T1 gene polymorphisms predict longitudinal course and age at onset of Alzheimer disease.
Spalletta G, etal., Am J Geriatr Psychiatry. 2007 Oct;15(10):879-87.
138.
Polymorphisms within glutathione S-transferase genes (GSTM1, GSTT1, GSTP1) and risk of relapse in childhood B-cell precursor acute lymphoblastic leukemia: a case-control study.
Stanulla M, etal., Blood. 2000 Feb 15;95(4):1222-8.
139.
DNA damage and related modifier genes in Italian cystic fibrosis patients.
Sterpone S, etal., Biol Res. 2009;42(4):477-86. doi: /S0716-97602009000400009. Epub 2010 Jan 29.
140.
Glutathione S-transferase: genetics and role in toxicology.
Strange RC, etal., Toxicol Lett 2000 Mar 15;112-113:357-63.
141.
Determination of glutathione S-transferase mu and theta polymorphisms in neurological disease.
Stroombergen MC and Waring RH, Hum Exp Toxicol. 1999 Mar;18(3):141-5.
142.
Impact of glutathione S-transferase gene deletion on early relapse in childhood B-precursor acute lymphoblastic leukemia.
Takanashi M, etal., Haematologica. 2003 Nov;88(11):1238-44.
143.
Variability and validity of polymorphism association studies in Parkinson's disease.
Tan EK, etal., Neurology. 2000 Aug 22;55(4):533-8.
144.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
145.
Glutathione S-transferase genotypes in systemic sclerosis and their association with clinical manifestations in early disease.
Tew MB, etal., Genes Immun. 2001 Jun;2(4):236-8.
146.
Association between gastric mucosal glutathione-S-transferase activity, glutathione-S-transferase gene polymorphisms and Helicobacter pylori infection in gastric cancer.
Tripathi S, etal., Indian J Gastroenterol. 2011 Dec;30(6):257-63. doi: 10.1007/s12664-011-0144-2. Epub 2011 Dec 3.
147.
Maternal cigarette smoking, metabolic gene polymorphisms, and preterm delivery: new insights on GxE interactions and pathogenic pathways.
Tsai HJ, etal., Hum Genet. 2008 May;123(4):359-69. doi: 10.1007/s00439-008-0485-9. Epub 2008 Mar 5.
148.
Pharmacogenetic influence of GST polymorphisms on anthracycline-based chemotherapy responses and toxicity in breast cancer patients: a multi-analytical approach.
Tulsyan S, etal., Mol Diagn Ther. 2013 Dec;17(6):371-9. doi: 10.1007/s40291-013-0045-4.
149.
Nonsteroidal anti-inflammatory drugs enhance glutathione S-transferase theta levels in rat colon.
Van Lieshout EM, etal., Biochim Biophys Acta. 1998 Aug 24;1381(3):305-11.
150.
Effects of dietary anticarcinogens on rat gastrointestinal glutathione S-transferase theta 1-1 levels.
van Lieshout EM, etal., Carcinogenesis. 1998 Nov;19(11):2055-7.
151.
Smoking, genetic polymorphisms in biotransformation enzymes, and nonsyndromic oral clefting: a gene-environment interaction.
van Rooij IA, etal., Epidemiology. 2001 Sep;12(5):502-7.
152.
[Genetic polymorphism in glutathione S-transferase M1 and T1 in children with bronchial asthma]
Vavilin VA, etal., Vopr Med Khim. 2000 Jul-Aug;46(4):388-97.
153.
GSTM1 and GSTT1 gene polymorphisms as major risk factors for bronchopulmonary dysplasia in a Chinese Han population.
Wang X, etal., Gene. 2014 Jan 1;533(1):48-51. doi: 10.1016/j.gene.2013.10.004. Epub 2013 Oct 10.
154.
Glutathione S-transferase T1 gene deletion polymorphism and lung cancer risk in Chinese population: A meta-analysis.
Wang Y, etal., Cancer Epidemiol. 2010 Jun 7.
155.
The diagnostic potential of glutathione S-transferase (GST) polymorphisms in patients with colorectal cancer.
Waś J, etal., Adv Clin Exp Med. 2018 Nov;27(11):1561-1566. doi: 10.17219/acem/74682.
156.
Homozygous gene deletions of the glutathione S-transferases M1 and T1 are associated with thimerosal sensitization.
Westphal GA, etal., Int Arch Occup Environ Health. 2000 Aug;73(6):384-8.
157.
Molecular predictors for anaemia after kidney transplantation.
Wilflingseder J, etal., Nephrol Dial Transplant. 2009 Mar;24(3):1015-23. doi: 10.1093/ndt/gfn683. Epub 2008 Dec 18.
158.
Glutathione S-transferases (GSTT1 and GSTM1) genes polymorphisms and the treatment response and prognosis in Chinese patients with de novo acute myeloid leukemia.
Xiao Z, etal., Leuk Res. 2008 Aug;32(8):1288-91. Epub 2007 Nov 26.
159.
Age-associated changes in GSH S-transferase gene/proteins in livers of rats.
Xu S, etal., Redox Rep. 2018 Dec;23(1):213-218. doi: 10.1080/13510002.2018.1546985.
160.
[Relationship between GSTM1 and GSTT1 gene polymorphisms and noise induced hearing loss in Chinese workers].
Yang M, etal., Wei Sheng Yan Jiu. 2005 Nov;34(6):647-9.
161.
Glutathione S-transferase T1 deletion is a risk factor for developing end-stage renal disease in diabetic patients.
Yang Y, etal., Int J Mol Med. 2004 Nov;14(5):855-9.
162.
Is GST gene polymorphism a risk factor in developing exfoliation syndrome?
Yilmaz A, etal., Curr Eye Res. 2005 Jul;30(7):575-81.
163.
Genetic determinants in the metabolism of bladder carcinogens in relation to risk of bladder cancer.
Yuan JM, etal., Carcinogenesis. 2008 Jul;29(7):1386-93. Epub 2008 Jun 9.
164.
Impaired cytoprotective mechanisms in eyes with pseudoexfoliation syndrome/glaucoma.
Zenkel M, etal., Invest Ophthalmol Vis Sci. 2007 Dec;48(12):5558-66.
165.
Diet-induced obese alters the expression and function of hepatic drug-metabolizing enzymes and transporters in rats.
Zhang L, etal., Biochem Pharmacol. 2019 Jun;164:368-376. doi: 10.1016/j.bcp.2019.05.002. Epub 2019 May 4.
166.
The association between copy number variations in glutathione S-transferase M1 and T1 and age-related cataract in a Han Chinese population.
Zhou J, etal., Invest Ophthalmol Vis Sci. 2010 Aug;51(8):3924-8. doi: 10.1167/iovs.10-5240. Epub 2010 Mar 24.
167.
[The relationship between GSTM1, GSTT1 gene polymorphisms and susceptibility to sporadic colorectal adenocarcinoma].
Zhu Y, etal., Zhonghua Nei Ke Za Zhi. 2002 Aug;41(8):538-40.
168.
The glutathione S-transferase T1 deletion is associated with susceptibility to multiple sclerosis.
Živkovic M, etal., J Neurol Sci. 2013 Nov 15;334(1-2):6-9. doi: 10.1016/j.jns.2013.07.001. Epub 2013 Aug 9.
Gstt1 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 12,856,068 - 12,873,020 (+) NCBI GRCr8 mRatBN7.2 20 12,856,613 - 12,873,586 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 12,856,669 - 12,873,585 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 13,563,264 - 13,580,163 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 12,924,193 - 12,941,104 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 13,396,180 - 13,413,203 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 13,799,102 - 13,816,527 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 13,799,102 - 13,816,526 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 15,989,083 - 16,006,508 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 13,604,355 - 13,621,456 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 13,604,582 - 13,621,683 (-) NCBI Celera 20 14,348,088 - 14,365,283 (+) NCBI Celera Cytogenetic Map 20 p12 NCBI
GSTT1 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh37 22 24,376,133 - 24,384,311 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 22 22,706,141 - 22,714,231 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 22 22,700,694 - 22,708,785 NCBI Celera 22 8,176,027 - 8,184,162 (-) NCBI Celera Cytogenetic Map 22 q11.23 NCBI HuRef 22 7,324,342 - 7,332,477 (-) NCBI HuRef T2T-CHM13v2.0 22 24,441,300 - 24,449,468 (-) NCBI T2T-CHM13v2.0
Gstt1 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 75,619,647 - 75,634,418 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 75,619,647 - 75,634,418 (-) Ensembl GRCm39 Ensembl GRCm38 10 75,783,813 - 75,798,584 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 75,783,813 - 75,798,584 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 75,246,558 - 75,261,329 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 75,227,531 - 75,242,300 (-) NCBI MGSCv36 mm8 Celera 10 76,828,580 - 76,843,364 (-) NCBI Celera Cytogenetic Map 10 C1 NCBI cM Map 10 38.58 NCBI
.
Predicted Target Of
Count of predictions: 149 Count of miRNA genes: 114 Interacting mature miRNAs: 120 Transcripts: ENSRNOT00000001669 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
4889870 Pur30 Proteinuria QTL 30 19 0.005 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 20 8042410 29322208 Rat 1354642 Despr15 Despair related QTL 15 0.0027 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 20 1 24159021 Rat 4889857 Pur27 Proteinuria QTL 27 12.2 0.001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 20 4606607 17617956 Rat 70154 Insul2 Insulin level QTL 2 3.75 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 20 6691706 17489458 Rat 9590109 Sffal8 Serum free fatty acids level QTL 8 5.32 0.01 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 20 1 29191651 Rat 9590275 Scort15 Serum corticosterone level QTL 15 3.48 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 20 1 29191651 Rat 1581577 Pur15 Proteinuria QTL 15 4.38 0.0002 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 20 8042410 17617956 Rat 6893685 Bw111 Body weight QTL 111 2.7 0.004 body mass (VT:0001259) body weight (CMO:0000012) 20 1 32578807 Rat 9590092 Insglur9 Insulin/glucose ratio QTL 9 18.38 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 20 11757515 54435887 Rat 1641915 Colcr9 Colorectal carcinoma resistance QTL 9 2.97 0.0024 intestine integrity trait (VT:0010554) benign colorectal tumor number (CMO:0001795) 20 1530655 46530655 Rat 2317057 Aia27 Adjuvant induced arthritis QTL 27 2.83 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 20 2892597 26381954 Rat 7387283 Uae44 Urinary albumin excretion QTL 44 0.1712 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 20 1 26123605 Rat 7411668 Foco32 Food consumption QTL 32 8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 1 36600972 Rat 2305926 Iddm37 Insulin dependent diabetes mellitus QTL 37 6 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 20 1527842 46527842 Rat 1600382 Edcs3 Endometrial carcinoma susceptibility QTL3 3.5 0.003 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 20 1 25159026 Rat 1558640 Prcs2 Prostate cancer susceptibility QTL 2 3.3 prostate integrity trait (VT:0010571) percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943) 20 4606607 17617956 Rat 631265 Iresp1 Immunoglobin response QTL1 8.3 blood anti-double stranded DNA antibody amount (VT:0004762) serum anti-DNA antibody level (CMO:0001533) 20 9039719 13461775 Rat 8694189 Bw153 Body weight QTL 153 3.13 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 20 1 29191651 Rat 9589155 Insul32 Insulin level QTL 32 6.38 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 20 1 29191651 Rat 7411650 Foco23 Food consumption QTL 23 20.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 1 29191651 Rat 7411652 Foco24 Food consumption QTL 24 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 11757515 54435887 Rat 2317851 Alcrsp22 Alcohol response QTL 22 3.2 0.05 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 20 1 27339237 Rat 1598816 Memor12 Memory QTL 12 2.4 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 20 2606836 47606836 Rat 61432 Cia1 Collagen induced arthritis QTL 1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 20 3621656 14101050 Rat 1641893 Alcrsp7 Alcohol response QTL 7 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 20 1 27339237 Rat 9590252 Scort12 Serum corticosterone level QTL 12 20.46 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 20 1 36600972 Rat
RH130749
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 20 12,873,378 - 12,873,564 (+) MAPPER mRatBN7.2 Rnor_6.0 20 13,816,320 - 13,816,505 NCBI Rnor6.0 Rnor_5.0 20 16,006,301 - 16,006,486 UniSTS Rnor5.0 RGSC_v3.4 20 13,604,377 - 13,604,562 UniSTS RGSC3.4 Celera 20 14,365,076 - 14,365,261 UniSTS RH 3.4 Map 20 154.86 UniSTS Cytogenetic Map 20 p12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000001669 ⟹ ENSRNOP00000001669
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 12,856,669 - 12,873,580 (+) Ensembl Rnor_6.0 Ensembl 20 13,799,102 - 13,816,526 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000097156 ⟹ ENSRNOP00000090349
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 12,858,242 - 12,873,585 (+) Ensembl
RefSeq Acc Id:
NM_053293 ⟹ NP_445745
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 12,856,117 - 12,873,020 (+) NCBI mRatBN7.2 20 12,856,680 - 12,873,586 (+) NCBI Rnor_6.0 20 13,799,102 - 13,816,527 (+) NCBI Rnor_5.0 20 15,989,083 - 16,006,508 (+) NCBI RGSC_v3.4 20 13,604,355 - 13,621,456 (-) RGD Celera 20 14,348,088 - 14,365,283 (+) RGD
Sequence:
GTTACGGAAGTAGTTCCCGCTGCTTATGCCATGGTCCTGGAACTGTACCTGGATCTGCTGTCGCAGCCCTGTCGCGCTATTTATATCTTCGCCAAGAAGAACAATATCCCGTTCCAGATGCATACTGT GGAGCTGCGCAAGGGTGAGCACCTCAGCGATGCCTTTGCCCAGGTGAACCCCATGAAGAAGGTACCAGCCATGAAGGATGGTGGCTTCACCTTGTGTGAGAGTGTGGCCATCCTGCTCTACCTGGCGC ACAAGTATAAGGTTCCTGACCACTGGTACCCCCAAGACCTGCAGGCCCGTGCTCGTGTGGATGAGTACCTGGCATGGCAGCATACGACCCTTCGGAGAAGCTGTCTCCGGACCCTGTGGCATAAGGTG ATGTTCCCCGTTTTCCTGGGTGAGCAGATACGCCCGGAGATGCTGGCAGCCACATTGGCAGATCTGGATGTTAACGTACAGGTGCTGGAAGACCAGTTCCTCCAGGACAAAGACTTCCTTGTCGGACC GCACATCTCCCTGGCTGACGTGGTAGCTATCACAGAGCTGATGCATCCTGTAGGTGGTGGCTGCCCAGTCTTTGAAGGGCGTCCCAGGCTGGCTGCATGGTACAGGAGAGTGGAGGCAGCTGTGGGGA AGGACCTCTTCCTGGAGGCCCATGAGGTCATCCTGAAGGTGAGAGACTGTCCACCTGCTGACCCCGTCATAAAGCAAAAGCTGATGCCCAGAGTGCTGACCATGATCCAGTGACGTCAGAAGCTTCAT CCCTGCACCAGCCAGGCCACTCGCATTACACGACTGTGCGCCCCAGCCCTCACGGCATGATGGTTTCTGGGCGAGGGTCCCTCTTCACCCTTTTCCCATGCTAGCCACCCATGGTCACAACTACAACC ACTACTTTTCCCTTTGAGTTTGGGCAATAAACCGAGGCTCGATTCGAGCTTTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
hide sequence
RefSeq Acc Id:
XM_008772859 ⟹ XP_008771081
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 12,856,399 - 12,873,014 (+) NCBI mRatBN7.2 20 12,856,930 - 12,873,580 (+) NCBI Rnor_6.0 20 13,799,394 - 13,816,521 (+) NCBI
Sequence:
CTCTCTCTCTCTCTCTCGCCATCAGGGAGAACCACGGTTCAGGAACCCTGCCAACTCGGCTGTCCGGTGGAATAGACTTCGGCCAGGACCTGCTGAGACCGAATAGCGAGCAGACCTGGCAACAGAAA TGGGCACGCAGTTTGGGCCTGGTTACAGGGAGCTCCAGAAGAGGGGGCGGGGCTAAAAGAACAAATGACAGTCACACCTCAGATCATTTCTCCCCGTGCTGAGATTGGCAGTGTTACACAGAGCCTCC TCCATTGCAAATCACTGCCTTTCCAACTGGTTCTCTCCGCCTGCTCATCCTGGGCTGTTGGAATTCCTTTTTGTCGTTCCTTTTCCTGACTTTCTGTTTTACCTTTCTTCACCGCTCTCTGCCTCTCT CTGTTGGGAAGAGAGGCTGCTGCGTTGGAGTATCCCGGTCACATGGAGCCTCCTCCCTGCTGGCCAGCCCCTGAGGGAGCCCTGCACTCTGGCCAGACACGGTTGTGGCAAAATGAAAGTGTTGCTTA AGGGGCTGTGGCCATCCCCATACTGTCTCACTGCTTGTCCGTCTCTGTCTGAAACCTCACCTCTTTCTTCACGGTCACCTCTGGGTAGAGTGCACTTAACTGCCACAGGTCCTGCCCTTGCAGAGTAT GGTGAGCCCTGCCTGTACTCCCCATTTAGGGAGTAGCCCAAGAAGAACCATGAATTTAAAGTTCAGCCTCCTGGGACCTTGTGGCTCAGGCTATCCTCCCTCACGCTGGCCTCTCTGCAGTGTGGCCA TCCTGCTCTACCTGGCGCACAAGTATAAGGTTCCTGACCACTGGTACCCCCAAGACCTGCAGGCCCGTGCTCGTGTGGATGAGTACCTGGCATGGCAGCATACGACCCTTCGGAGAAGCTGTCTCCGG ACCCTGTGGCATAAGGTGATGTTCCCCGTTTTCCTGGGTGAGCAGATACGCCCGGAGATGCTGGCAGCCACATTGGCAGATCTGGATGTTAACGTACAGGTGCTGGAAGACCAGTTCCTCCAGGACAA AGACTTCCTTGTCGGACCGCACATCTCCCTGGCTGACGTGGTAGCTATCACAGAGCTGATGCATCCTGTAGGTGGTGGCTGCCCAGTCTTTGAAGGGCGTCCCAGGCTGGCTGCATGGTACAGGAGAG TGGAGGCAGCTGTGGGGAAGGACCTCTTCCTGGAGGCCCATGAGGTCATCCTGAAGGTGAGAGACTGTCCACCTGCTGACCCCGTCATAAAGCAAAAGCTGATGCCCAGAGTGCTGACCATGATCCAG TGACGTCAGAAGCTTCATCCCTGCACCAGCCAGGCCACTCGCATTACACGACTGTGCGCCCCAGCCCTCACGGCATGATGGTTTCTGGGCGAGGGTCCCTCTTCACCCTTTTCCCATGCTAGCCACCC ATGGTCACAACTACAACCACTACTTTTCCCTTTGAGTTTGGGCAATAAACCGAGGCTCGATTCGA
hide sequence
RefSeq Acc Id:
XM_008772860 ⟹ XP_008771082
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 12,856,399 - 12,873,014 (+) NCBI mRatBN7.2 20 12,856,963 - 12,873,580 (+) NCBI Rnor_6.0 20 13,799,399 - 13,816,521 (+) NCBI
Sequence:
TCTCTCTCTCTCGCCATCAGGGAGAACCACGGTTCAGGAACCCTGCCAACTCGGCTGTCCGGTGGAATAGACTTCGGCCAGGACCTGCTGAGACCGAATAGCGAGCAGACCTGGCAACAGAAATGGGC ACGCAGTTTGGGCCTGGTTACAGGGAGCTCCAGAAGAGGGGGCGGGGCTAAAAGAACAAATGACAGTCACACCTCAGATCATTTCTCCCCGTGCTGAGATTGGCAGTGTTACACAGAGCCTCCTCCAT TGCAAATCACTGCCTTTCCAACTGGTTCTCTCCGCCTGCTCATCCTGGGCTGTTGGAATTCCTTTTTGTCGTTCCTTTTCCTGACTTTCTGTTTTACCTTTCTTCACCGCTCTCTGCCTCTCTCTGTT GGGAAGAGAGGCTGCTGCGTTGGAGTATCCCGGTCACATGGAGCCTCCTCCCTGCTGGCCAGCCCCTGAGGGAGCCCTGCACTCTGGCCAGACACGGTTGTGGCAAAATGAAAGTGTTGCTTAAGGGG CTGTGGCCATCCCCATACTGTCTCACTGCTTGTCCGTCTCTGTCTGAAACCTCACCTCTTTCTTCACGGTCACCTCTGGGTAGAGTGCACTTAACTGCCACAGGTCCTGCCCTTGCAGAGTATGGTGT GAGCACCTCAGCGATGCCTTTGCCCAGGTGAACCCCATGAAGAAGGTACCAGCCATGAAGGATGGTGGCTTCACCTTGTGTGAGAGTGTGGCCATCCTGCTCTACCTGGCGCACAAGTATAAGGTTCC TGACCACTGGTACCCCCAAGACCTGCAGGCCCGTGCTCGTGTGGATGAGTACCTGGCATGGCAGCATACGACCCTTCGGAGAAGCTGTCTCCGGACCCTGTGGCATAAGGTGATGTTCCCCGTTTTCC TGGGTGAGCAGATACGCCCGGAGATGCTGGCAGCCACATTGGCAGATCTGGATGTTAACGTACAGGTGCTGGAAGACCAGTTCCTCCAGGACAAAGACTTCCTTGTCGGACCGCACATCTCCCTGGCT GACGTGGTAGCTATCACAGAGCTGATGCATCCTGTAGGTGGTGGCTGCCCAGTCTTTGAAGGGCGTCCCAGGCTGGCTGCATGGTACAGGAGAGTGGAGGCAGCTGTGGGGAAGGACCTCTTCCTGGA GGCCCATGAGGTCATCCTGAAGGTGAGAGACTGTCCACCTGCTGACCCCGTCATAAAGCAAAAGCTGATGCCCAGAGTGCTGACCATGATCCAGTGACGTCAGAAGCTTCATCCCTGCACCAGCCAGG CCACTCGCATTACACGACTGTGCGCCCCAGCCCTCACGGCATGATGGTTTCTGGGCGAGGGTCCCTCTTCACCCTTTTCCCATGCTAGCCACCCATGGTCACAACTACAACCACTACTTTTCCCTTTG AGTTTGGGCAATAAACCGAGGCTCGATTCGA
hide sequence
RefSeq Acc Id:
XM_008772861 ⟹ XP_008771083
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 12,870,182 - 12,873,014 (+) NCBI mRatBN7.2 20 12,870,795 - 12,873,580 (+) NCBI Rnor_6.0 20 13,813,552 - 13,816,521 (+) NCBI
Sequence:
AACTCAGTACTTCTGGAAGATCGGTGATGTTCCCCGTTTTCCTGGGTGAGCAGATACGCCCGGA GATGCTGGCAGCCACATTGGCAGATCTGGATGTTAACGTACAGGTGCTGGAAGACCAGTTCCTCCAGGACAAAGACTTCCTTGTCGGACCGCACATCTCCCTGGCTGACGTGGTAGCTATCACAGAGC TGATGCATCCTGTAGGTGGTGGCTGCCCAGTCTTTGAAGGGCGTCCCAGGCTGGCTGCATGGTACAGGAGAGTGGAGGCAGCTGTGGGGAAGGACCTCTTCCTGGAGGCCCATGAGGTCATCCTGAAG GTGAGAGACTGTCCACCTGCTGACCCCGTCATAAAGCAAAAGCTGATGCCCAGAGTGCTGACCATGATCCAGTGACGTCAGAAGCTTCATCCCTGCACCAGCCAGGCCACTCGCATTACACGACTGTG CGCCCCAGCCCTCACGGCATGATGGTTTCTGGGCGAGGGTCCCTCTTCACCCTTTTCCCATGCTAGCCACCCATGGTCACAACTACAACCACTACTTTTCCCTTTGAGTTTGGGCAATAAACCGAGGC TCGATTCGA
hide sequence
RefSeq Acc Id:
XM_039098441 ⟹ XP_038954369
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 12,856,095 - 12,873,014 (+) NCBI mRatBN7.2 20 12,856,678 - 12,873,580 (+) NCBI
RefSeq Acc Id:
XM_039098442 ⟹ XP_038954370
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 12,856,068 - 12,873,014 (+) NCBI mRatBN7.2 20 12,856,613 - 12,871,278 (+) NCBI
RefSeq Acc Id:
NP_445745 ⟸ NM_053293
- UniProtKB:
Q01579 (UniProtKB/Swiss-Prot), B6DYQ8 (UniProtKB/TrEMBL), A0A8I6ADD6 (UniProtKB/TrEMBL)
- Sequence:
MVLELYLDLLSQPCRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFAQVNPMKKVPAMKDGGFTLCESVAILLYLAHKYKVPDHWYPQDLQARARVDEYLAWQHTTLRRSCLRTLWHKVMFPVFLGEQI RPEMLAATLADLDVNVQVLEDQFLQDKDFLVGPHISLADVVAITELMHPVGGGCPVFEGRPRLAAWYRRVEAAVGKDLFLEAHEVILKVRDCPPADPVIKQKLMPRVLTMIQ
hide sequence
RefSeq Acc Id:
XP_008771082 ⟸ XM_008772860
- Peptide Label:
isoform X3
- UniProtKB:
A6JKH2 (UniProtKB/TrEMBL), A0A8I6ADD6 (UniProtKB/TrEMBL)
- Sequence:
MKKVPAMKDGGFTLCESVAILLYLAHKYKVPDHWYPQDLQARARVDEYLAWQHTTLRRSCLRTLWHKVMFPVFLGEQIRPEMLAATLADLDVNVQVLEDQFLQDKDFLVGPHISLADVVAITELMHPV GGGCPVFEGRPRLAAWYRRVEAAVGKDLFLEAHEVILKVRDCPPADPVIKQKLMPRVLTMIQ
hide sequence
RefSeq Acc Id:
XP_008771081 ⟸ XM_008772859
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6ADD6 (UniProtKB/TrEMBL)
- Sequence:
MVSPACTPHLGSSPRRTMNLKFSLLGPCGSGYPPSRWPLCSVAILLYLAHKYKVPDHWYPQDLQ ARARVDEYLAWQHTTLRRSCLRTLWHKVMFPVFLGEQIRPEMLAATLADLDVNVQVLEDQFLQDKDFLVGPHISLADVVAITELMHPVGGGCPVFEGRPRLAAWYRRVEAAVGKDLFLEAHEVILKVR DCPPADPVIKQKLMPRVLTMIQ
hide sequence
RefSeq Acc Id:
XP_008771083 ⟸ XM_008772861
- Peptide Label:
isoform X5
- Sequence:
MFPVFLGEQIRPEMLAATLADLDVNVQVLEDQFLQDKDFLVGPHISLADVVAITELMHPVGGGC PVFEGRPRLAAWYRRVEAAVGKDLFLEAHEVILKVRDCPPADPVIKQKLMPRVLTMIQ
hide sequence
Ensembl Acc Id:
ENSRNOP00000001669 ⟸ ENSRNOT00000001669
RefSeq Acc Id:
XP_038954370 ⟸ XM_039098442
- Peptide Label:
isoform X4
RefSeq Acc Id:
XP_038954369 ⟸ XM_039098441
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6ADD6 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000090349 ⟸ ENSRNOT00000097156
RGD ID: 13701534
Promoter ID: EPDNEW_R12058
Type: multiple initiation site
Name: Gstt1_1
Description: glutathione S-transferase theta 1
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 20 13,799,083 - 13,799,143 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Gstt1
glutathione S-transferase theta 1
glutathione S-transferase, theta 1
Name updated
1299863
APPROVED
2002-06-10
Gstt1
Glutathione S-transferase 1 (theta)
Symbol and Name status set to approved
70586
APPROVED
Note Type
Note
Reference
gene_protein
244 amino acid residues
68795
gene_transcript
transcript promoter region lacks both TATA and CAAT boxes
68795