Symbol:
Gpi
Name:
glucose-6-phosphate isomerase
RGD ID:
2727
Description:
Enables glucose-6-phosphate isomerase activity and monosaccharide binding activity. Involved in several processes, including response to estradiol; response to progesterone; and response to testosterone. Predicted to be located in ciliary membrane. Predicted to be active in cytosol. Human ortholog(s) of this gene implicated in congenital hemolytic anemia; congenital nonspherocytic hemolytic anemia; congenital nonspherocytic hemolytic anemia 4; intellectual disability; and neuromuscular disease. Orthologous to human GPI (glucose-6-phosphate isomerase); PARTICIPATES IN congenital sucrase-isomaltase deficiency pathway; Fanconi syndrome pathway; fructose-1,6-bisphosphatase deficiency pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
Amf; autocrine motility factor; glucose phosphate isomerase; Gpi1; neuroleukin; Nlk; Pgi; Phi; phosphoglucose isomerase; phosphohexose isomerase
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
GPI (glucose-6-phosphate isomerase) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Gpi1 (glucose-6-phosphate isomerase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Gpi (glucose-6-phosphate isomerase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
GPI (glucose-6-phosphate isomerase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
GPI (glucose-6-phosphate isomerase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Gpi (glucose-6-phosphate isomerase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
GPI (glucose-6-phosphate isomerase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
GPI (glucose-6-phosphate isomerase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Gpi (glucose-6-phosphate isomerase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
KCNJ16 (potassium inwardly rectifying channel subfamily J member 16) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Gpi1 (glucose-6-phosphate isomerase 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
GPI (glucose-6-phosphate isomerase)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
gpia (glucose-6-phosphate isomerase a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
gpib (glucose-6-phosphate isomerase b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
PGI1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Pgi
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
gpi-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
gpi
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 95,965,389 - 95,996,932 (-) NCBI GRCr8 mRatBN7.2 1 86,828,211 - 86,856,077 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 86,828,216 - 86,856,086 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 92,231,564 - 92,259,517 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 100,697,568 - 100,725,522 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 93,989,860 - 94,017,813 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 90,063,411 - 90,091,287 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 90,063,411 - 90,091,287 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 91,207,014 - 91,234,890 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 86,658,836 - 86,686,712 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 86,736,946 - 86,764,823 (-) NCBI Celera 1 81,194,482 - 81,222,306 (-) NCBI Celera Cytogenetic Map 1 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Gpi Rat (1->4)-beta-D-glucan multiple interactions ISO Gpi1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of GPI1 mRNA CTD PMID:36331819 Gpi Rat 1,2-dimethylhydrazine decreases expression ISO Gpi1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of GPI1 mRNA CTD PMID:22206623 Gpi Rat 1-chloro-2,4-dinitrobenzene affects binding ISO GPI (Homo sapiens) 6480464 Dinitrochlorobenzene binds to GPI protein CTD PMID:32991956 Gpi Rat 17alpha-ethynylestradiol increases expression ISO Gpi1 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of GPI1 mRNA CTD PMID:17942748 Gpi Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of GPI mRNA CTD PMID:32145629 Gpi Rat 17beta-estradiol decreases expression ISO Gpi1 (Mus musculus) 6480464 Estradiol results in decreased expression of GPI1 mRNA CTD PMID:39298647 Gpi Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO Gpi1 (Mus musculus) 6480464 Dihydrotestosterone results in increased expression of GPI1 mRNA CTD PMID:17023530 Gpi Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO GPI (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of GPI mRNA CTD PMID:19684285 Gpi Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of GPI mRNA CTD PMID:34747641 Gpi Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO GPI (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of GPI mRNA CTD PMID:23152189 Gpi Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO GPI (Homo sapiens) 6480464 2-methyl-2H-pyrazole-3-carboxylic acid (2-methyl-4-o-tolylazophenyl)amide inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of GPI mRNA] and alpha-naphthoflavone inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of GPI mRNA] CTD PMID:23152189 Gpi Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of GPI mRNA CTD PMID:22298810 Gpi Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Gpi1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of GPI1 mRNA CTD PMID:15667827 and PMID:19770486 Gpi Rat 2,6-dimethoxyphenol multiple interactions ISO GPI (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Gpi Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of GPI mRNA CTD PMID:21346803 Gpi Rat 2-bromohexadecanoic acid multiple interactions ISO GPI (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of GPI protein] CTD PMID:38195004 Gpi Rat 4,4'-sulfonyldiphenol increases expression ISO GPI (Homo sapiens) 6480464 bisphenol S results in increased expression of GPI mRNA CTD PMID:31121516 Gpi Rat 4,4'-sulfonyldiphenol affects expression ISO Gpi1 (Mus musculus) 6480464 bisphenol S affects the expression of GPI1 mRNA CTD PMID:39298647 Gpi Rat 4-amino-2,6-dinitrotoluene affects expression EXP 6480464 4-amino-2 and 6-dinitrotoluene affects the expression of GPI mRNA CTD PMID:21346803 Gpi Rat 4-hydroxyphenyl retinamide increases expression ISO Gpi1 (Mus musculus) 6480464 Fenretinide results in increased expression of GPI mRNA CTD PMID:28973697 Gpi Rat acrylamide decreases expression ISO GPI (Homo sapiens) 6480464 Acrylamide results in decreased expression of GPI mRNA CTD PMID:32763439 Gpi Rat aflatoxin B1 decreases expression ISO Gpi1 (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of GPI1 mRNA CTD PMID:19770486 Gpi Rat all-trans-retinoic acid increases expression ISO GPI (Homo sapiens) 6480464 Tretinoin results in increased expression of GPI mRNA CTD PMID:33167477 Gpi Rat alpha-naphthoflavone multiple interactions ISO GPI (Homo sapiens) 6480464 alpha-naphthoflavone inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of GPI mRNA] CTD PMID:23152189 Gpi Rat alpha-naphthoflavone increases expression ISO GPI (Homo sapiens) 6480464 alpha-naphthoflavone results in increased expression of GPI mRNA CTD PMID:23152189 Gpi Rat AM-251 multiple interactions EXP 6480464 AM 251 inhibits the reaction [Dietary Carbohydrates results in increased expression of GPI protein] CTD PMID:26671069 Gpi Rat AM-251 decreases expression EXP 6480464 AM 251 results in decreased expression of GPI protein CTD PMID:26671069 Gpi Rat aristolochic acid A decreases expression ISO GPI (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of GPI mRNA CTD PMID:33212167 Gpi Rat aristolochic acid A increases expression ISO GPI (Homo sapiens) 6480464 aristolochic acid I results in increased expression of GPI protein CTD PMID:33212167 Gpi Rat arsenous acid increases expression ISO GPI (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of GPI mRNA CTD PMID:22521957 Gpi Rat atrazine increases expression ISO GPI (Homo sapiens) 6480464 Atrazine results in increased expression of GPI mRNA CTD PMID:22378314 Gpi Rat Azaspiracid affects expression ISO GPI (Homo sapiens) 6480464 azaspiracid affects the expression of GPI mRNA CTD PMID:28939011 Gpi Rat benzatropine increases expression ISO GPI (Homo sapiens) 6480464 Benztropine results in increased expression of GPI protein CTD PMID:34122009 Gpi Rat benzo[a]pyrene decreases expression ISO Gpi1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of GPI1 mRNA CTD PMID:19770486 Gpi Rat benzo[a]pyrene increases methylation ISO GPI (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of GPI promoter CTD PMID:27901495 Gpi Rat beta-lapachone decreases expression ISO GPI (Homo sapiens) 6480464 beta-lapachone results in decreased expression of GPI mRNA CTD PMID:38218311 Gpi Rat beta-lapachone increases expression ISO GPI (Homo sapiens) 6480464 beta-lapachone results in increased expression of GPI mRNA CTD PMID:38218311 Gpi Rat bifenthrin increases expression ISO Gpi1 (Mus musculus) 6480464 bifenthrin results in increased expression of GPI1 mRNA CTD PMID:26071804 Gpi Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Gpi1 (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with diethyl phthalate co-treated with diisononyl phthalate co-treated with di-n-octyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate] results in decreased expression of GPI1 mRNA CTD PMID:37364641 Gpi Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of GPI mRNA CTD PMID:25181051 Gpi Rat bisphenol A multiple interactions ISO Gpi1 (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with diethyl phthalate co-treated with diisononyl phthalate co-treated with di-n-octyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate] results in decreased expression of GPI1 mRNA CTD PMID:37364641 Gpi Rat bisphenol A increases expression ISO GPI (Homo sapiens) 6480464 bisphenol A results in increased expression of GPI protein CTD PMID:37567409 Gpi Rat bisphenol A decreases expression ISO Gpi1 (Mus musculus) 6480464 bisphenol A results in decreased expression of GPI protein and bisphenol A results in decreased expression of GPI1 mRNA CTD PMID:33221593 and PMID:35999755 Gpi Rat bisphenol A affects expression ISO GPI (Homo sapiens) 6480464 bisphenol A affects the expression of GPI mRNA CTD PMID:30903817 Gpi Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of GPI mRNA CTD PMID:30816183 more ... Gpi Rat bleomycin A2 decreases expression EXP 6480464 Bleomycin results in decreased expression of GPI protein CTD PMID:25933445 Gpi Rat Brodifacoum increases expression EXP 6480464 bromfenacoum results in increased expression of GPI protein CTD PMID:28903499 Gpi Rat Butylbenzyl phthalate multiple interactions ISO Gpi1 (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with diethyl phthalate co-treated with diisononyl phthalate co-treated with di-n-octyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate] results in decreased expression of GPI1 mRNA CTD PMID:37364641 Gpi Rat cadmium acetate multiple interactions EXP 6480464 [cadmium acetate results in increased abundance of Cadmium] which results in decreased expression of GPI mRNA and puerarin inhibits the reaction [[cadmium acetate results in increased abundance of Cadmium] which results in decreased expression of GPI mRNA] CTD PMID:33404196 Gpi Rat cadmium atom multiple interactions EXP 6480464 [cadmium acetate results in increased abundance of Cadmium] which results in decreased expression of GPI mRNA and puerarin inhibits the reaction [[cadmium acetate results in increased abundance of Cadmium] which results in decreased expression of GPI mRNA] CTD PMID:33404196 Gpi Rat cadmium atom multiple interactions ISO GPI (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of GPI protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of GPI protein CTD PMID:38195004 Gpi Rat cadmium dichloride multiple interactions ISO GPI (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of GPI protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of GPI protein CTD PMID:38195004 Gpi Rat caffeine decreases expression ISO GPI (Homo sapiens) 6480464 Caffeine results in decreased expression of GPI protein CTD PMID:31195006 Gpi Rat caffeine increases phosphorylation ISO GPI (Homo sapiens) 6480464 Caffeine results in increased phosphorylation of GPI protein CTD PMID:35688186 Gpi Rat carbon nanotube affects expression ISO Gpi1 (Mus musculus) 6480464 Nanotubes and Carbon affects the expression of GPI1 protein CTD PMID:21135415 Gpi Rat carbon nanotube decreases expression ISO Gpi1 (Mus musculus) 6480464 Nanotubes and Carbon results in decreased expression of GPI1 mRNA CTD PMID:25620056 Gpi Rat chlorpyrifos increases expression ISO Gpi1 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of GPI1 mRNA CTD PMID:37019170 Gpi Rat chromium atom multiple interactions ISO Gpi1 (Mus musculus) 6480464 LEPR gene mutant form promotes the reaction [[Niacin binds to Chromium] which results in increased expression of GPI1 mRNA] CTD PMID:16940432 Gpi Rat clobetasol increases expression ISO Gpi1 (Mus musculus) 6480464 Clobetasol results in increased expression of GPI1 mRNA CTD PMID:27462272 Gpi Rat clofibric acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of GPI mRNA CTD PMID:17602206 Gpi Rat clozapine increases expression ISO GPI (Homo sapiens) 6480464 Clozapine results in increased expression of GPI protein CTD PMID:34122009 Gpi Rat cobalt atom multiple interactions ISO GPI (Homo sapiens) 6480464 [tungsten carbide binds to Cobalt] which results in increased expression of GPI mRNA CTD PMID:20105288 Gpi Rat cobalt dichloride increases expression ISO GPI (Homo sapiens) 6480464 cobaltous chloride results in increased expression of GPI mRNA CTD PMID:20105288 Gpi Rat cobalt dichloride increases expression EXP 6480464 cobaltous chloride results in increased expression of GPI mRNA and cobaltous chloride results in increased expression of GPI protein CTD PMID:24386269 Gpi Rat copper atom affects binding ISO GPI (Homo sapiens) 6480464 GPI protein binds to Copper CTD PMID:15359738 Gpi Rat copper(0) affects binding ISO GPI (Homo sapiens) 6480464 GPI protein binds to Copper CTD PMID:15359738 Gpi Rat crocidolite asbestos increases expression ISO GPI (Homo sapiens) 6480464 Asbestos and Crocidolite results in increased expression of GPI mRNA CTD PMID:29523930 Gpi Rat cyclosporin A decreases expression ISO GPI (Homo sapiens) 6480464 Cyclosporine results in decreased expression of GPI mRNA CTD PMID:20106945 and PMID:25562108 Gpi Rat dexamethasone decreases expression ISO Gpi1 (Mus musculus) 6480464 Dexamethasone results in decreased expression of GPI protein CTD PMID:33567340 Gpi Rat dextran sulfate decreases expression ISO Gpi1 (Mus musculus) 6480464 Dextran Sulfate results in decreased expression of GPI protein CTD PMID:35999755 Gpi Rat Di-n-octyl phthalate multiple interactions ISO Gpi1 (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with diethyl phthalate co-treated with diisononyl phthalate co-treated with di-n-octyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate] results in decreased expression of GPI1 mRNA CTD PMID:37364641 Gpi Rat diarsenic trioxide increases expression ISO GPI (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of GPI mRNA CTD PMID:22521957 Gpi Rat diazinon decreases methylation ISO GPI (Homo sapiens) 6480464 Diazinon results in decreased methylation of GPI gene CTD PMID:22964155 Gpi Rat Dibutyl phosphate affects expression ISO GPI (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of GPI mRNA CTD PMID:37042841 Gpi Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of GPI mRNA CTD PMID:21266533 Gpi Rat dibutyl phthalate multiple interactions ISO Gpi1 (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with diethyl phthalate co-treated with diisononyl phthalate co-treated with di-n-octyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate] results in decreased expression of GPI1 mRNA CTD PMID:37364641 Gpi Rat dicrotophos increases expression ISO GPI (Homo sapiens) 6480464 dicrotophos results in increased expression of GPI mRNA CTD PMID:28302478 Gpi Rat diethyl phthalate multiple interactions ISO Gpi1 (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with diethyl phthalate co-treated with diisononyl phthalate co-treated with di-n-octyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate] results in decreased expression of GPI1 mRNA CTD PMID:37364641 Gpi Rat diethylstilbestrol decreases expression ISO Gpi1 (Mus musculus) 6480464 Diethylstilbestrol results in decreased expression of GPI1 mRNA CTD PMID:21041162 Gpi Rat dihydroartemisinin affects binding ISO GPI (Homo sapiens) 6480464 artenimol analog binds to GPI protein CTD PMID:26340163 Gpi Rat Diisodecyl phthalate multiple interactions ISO Gpi1 (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with diethyl phthalate co-treated with diisononyl phthalate co-treated with di-n-octyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate] results in decreased expression of GPI1 mRNA CTD PMID:37364641 Gpi Rat diisononyl phthalate multiple interactions ISO Gpi1 (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with diethyl phthalate co-treated with diisononyl phthalate co-treated with di-n-octyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate] results in decreased expression of GPI1 mRNA CTD PMID:37364641 Gpi Rat dinophysistoxin 1 affects expression ISO GPI (Homo sapiens) 6480464 dinophysistoxin 1 affects the expression of GPI mRNA CTD PMID:28939011 Gpi Rat dioxygen increases expression ISO GPI (Homo sapiens) 6480464 Oxygen deficiency results in increased expression of GPI mRNA CTD PMID:20042640 and PMID:24236059 Gpi Rat elemental selenium increases expression ISO GPI (Homo sapiens) 6480464 Selenium results in increased expression of GPI mRNA CTD PMID:19244175 Gpi Rat enzyme inhibitor multiple interactions ISO GPI (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of GPI protein CTD PMID:23301498 Gpi Rat epoxiconazole decreases expression ISO Gpi1 (Mus musculus) 6480464 epoxiconazole results in decreased expression of GPI1 mRNA CTD PMID:35436446 Gpi Rat ethanol increases expression ISO Gpi1 (Mus musculus) 6480464 Ethanol results in increased expression of GPI mRNA CTD PMID:19167417 Gpi Rat ethanol affects splicing ISO Gpi1 (Mus musculus) 6480464 Ethanol affects the splicing of GPI1 mRNA CTD PMID:30319688 Gpi Rat fipronil increases expression EXP 6480464 fipronil results in increased expression of GPI mRNA CTD PMID:34044035 Gpi Rat flutamide increases expression ISO Gpi1 (Mus musculus) 6480464 Flutamide analog results in increased expression of GPI1 mRNA and Flutamide results in increased expression of GPI1 mRNA CTD PMID:17702527 Gpi Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of GPI mRNA CTD PMID:24136188 Gpi Rat formaldehyde decreases expression ISO GPI (Homo sapiens) 6480464 Formaldehyde results in decreased expression of GPI mRNA CTD PMID:23649840 Gpi Rat FR900359 increases phosphorylation ISO GPI (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of GPI protein CTD PMID:37730182 Gpi Rat furfural multiple interactions ISO GPI (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Gpi Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of GPI mRNA CTD PMID:22061828 Gpi Rat hydrogen sulfide decreases expression ISO Gpi1 (Mus musculus) 6480464 Hydrogen Sulfide results in decreased expression of GPI protein CTD PMID:29932956 Gpi Rat ivermectin decreases expression ISO GPI (Homo sapiens) 6480464 Ivermectin results in decreased expression of GPI protein CTD PMID:32959892 Gpi Rat josamycin decreases response to substance ISO GPI (Homo sapiens) 6480464 GPI protein results in decreased susceptibility to Josamycin CTD PMID:31915244 Gpi Rat lead(0) affects expression ISO GPI (Homo sapiens) 6480464 Lead affects the expression of GPI mRNA CTD PMID:28903495 Gpi Rat lipopolysaccharide decreases expression ISO Gpi1 (Mus musculus) 6480464 Lipopolysaccharides results in decreased expression of GPI mRNA CTD PMID:12057914 Gpi Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of GPI gene CTD PMID:35440735 Gpi Rat methyl methanesulfonate decreases expression ISO GPI (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of GPI mRNA CTD PMID:23649840 Gpi Rat N-methyl-4-phenylpyridinium decreases expression ISO Gpi1 (Mus musculus) 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of GPI1 mRNA CTD PMID:22776087 Gpi Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of GPI mRNA CTD PMID:17602206 Gpi Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of GPI mRNA CTD PMID:24136188 Gpi Rat nickel dichloride increases expression ISO Gpi1 (Mus musculus) 6480464 nickel chloride results in increased expression of GPI1 mRNA CTD PMID:12426141 more ... Gpi Rat nickel dichloride multiple interactions ISO Gpi1 (Mus musculus) 6480464 HIF1A affects the reaction [nickel chloride results in increased expression of GPI1 mRNA] CTD PMID:12426141 and PMID:12729255 Gpi Rat nickel subsulfide affects expression ISO Gpi1 (Mus musculus) 6480464 nickel subsulfide affects the expression of GPI1 mRNA CTD PMID:12729255 Gpi Rat nicotinic acid multiple interactions ISO Gpi1 (Mus musculus) 6480464 LEPR gene mutant form promotes the reaction [[Niacin binds to Chromium] which results in increased expression of GPI1 mRNA] CTD PMID:16940432 Gpi Rat nitric oxide increases expression ISO Gpi1 (Mus musculus) 6480464 Nitric Oxide deficiency results in increased expression of GPI1 mRNA CTD PMID:15878706 Gpi Rat ochratoxin A decreases expression ISO GPI (Homo sapiens) 6480464 ochratoxin A results in decreased expression of GPI protein CTD PMID:26861962 Gpi Rat okadaic acid increases expression ISO GPI (Homo sapiens) 6480464 Okadaic Acid results in increased expression of GPI mRNA CTD PMID:28939011 Gpi Rat ozone decreases expression ISO Gpi1 (Mus musculus) 6480464 Ozone results in decreased expression of GPI1 mRNA CTD PMID:16183385 Gpi Rat paclitaxel affects response to substance ISO GPI (Homo sapiens) 6480464 GPI protein affects the susceptibility to Paclitaxel CTD PMID:16217747 Gpi Rat paracetamol affects expression ISO Gpi1 (Mus musculus) 6480464 Acetaminophen affects the expression of GPI1 mRNA CTD PMID:17562736 Gpi Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of GPI mRNA CTD PMID:33387578 Gpi Rat paracetamol decreases expression ISO GPI (Homo sapiens) 6480464 Acetaminophen results in decreased expression of GPI mRNA CTD PMID:22230336 and PMID:29067470 Gpi Rat perfluorooctane-1-sulfonic acid affects expression ISO Gpi1 (Mus musculus) 6480464 perfluorooctane sulfonic acid affects the expression of GPI1 mRNA CTD PMID:19429403 Gpi Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Gpi1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of GPI1 mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in increased expression of GPI1 mRNA CTD PMID:36331819 Gpi Rat perfluorooctanoic acid affects expression ISO Gpi1 (Mus musculus) 6480464 perfluorooctanoic acid affects the expression of GPI1 mRNA CTD PMID:19429403 Gpi Rat perfluorooctanoic acid increases expression ISO Gpi1 (Mus musculus) 6480464 perfluorooctanoic acid results in increased expression of GPI protein more ... CTD PMID:36214631 and PMID:37422089 Gpi Rat perfluorooctanoic acid multiple interactions ISO Gpi1 (Mus musculus) 6480464 Dietary Fats and Unsaturated inhibits the reaction [perfluorooctanoic acid results in increased expression of GPI1 mRNA] CTD PMID:23626681 Gpi Rat picoxystrobin increases expression ISO GPI (Homo sapiens) 6480464 picoxystrobin results in increased expression of GPI mRNA CTD PMID:33512557 Gpi Rat pirinixic acid increases expression ISO Gpi1 (Mus musculus) 6480464 pirinixic acid results in increased expression of GPI1 mRNA CTD PMID:18301758 Gpi Rat prostaglandin A1 increases metabolic processing ISO Gpi1 (Mus musculus) 6480464 prostaglandin A1 analog results in increased metabolism of GPI1 protein CTD PMID:19800325 Gpi Rat puerarin multiple interactions EXP 6480464 puerarin inhibits the reaction [[cadmium acetate results in increased abundance of Cadmium] which results in decreased expression of GPI mRNA] CTD PMID:33404196 Gpi Rat quercetin increases expression ISO GPI (Homo sapiens) 6480464 Quercetin results in increased expression of GPI mRNA CTD PMID:19729006 and PMID:21632981 Gpi Rat rotenone increases expression ISO Gpi1 (Mus musculus) 6480464 Rotenone results in increased expression of GPI1 mRNA CTD PMID:17702527 Gpi Rat rotenone increases expression ISO GPI (Homo sapiens) 6480464 Rotenone results in increased expression of GPI mRNA CTD PMID:33512557 Gpi Rat S-butyl-DL-homocysteine (S,R)-sulfoximine increases expression ISO Gpi1 (Mus musculus) 6480464 Buthionine Sulfoximine results in increased expression of GPI1 mRNA CTD PMID:15878706 Gpi Rat sarin decreases expression ISO GPI (Homo sapiens) 6480464 Sarin results in decreased expression of GPI mRNA CTD PMID:19522546 Gpi Rat SB 431542 multiple interactions ISO GPI (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in decreased expression of GPI protein CTD PMID:37664457 Gpi Rat selenium atom increases expression ISO GPI (Homo sapiens) 6480464 Selenium results in increased expression of GPI mRNA CTD PMID:19244175 Gpi Rat silicon dioxide increases secretion ISO GPI (Homo sapiens) 6480464 Silicon Dioxide analog results in increased secretion of GPI protein CTD PMID:25895662 Gpi Rat sodium arsenite increases expression ISO GPI (Homo sapiens) 6480464 sodium arsenite results in increased expression of GPI mRNA CTD PMID:23648393 and PMID:34032870 Gpi Rat sodium arsenite decreases expression ISO GPI (Homo sapiens) 6480464 sodium arsenite results in decreased expression of GPI mRNA CTD PMID:38568856 Gpi Rat sodium chloride multiple interactions ISO GPI (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of GPI protein more ... CTD PMID:38598786 Gpi Rat sodium fluoride increases expression ISO Gpi1 (Mus musculus) 6480464 Sodium Fluoride results in increased expression of GPI protein CTD PMID:28918527 Gpi Rat temozolomide increases expression ISO GPI (Homo sapiens) 6480464 Temozolomide results in increased expression of GPI mRNA CTD PMID:31758290 Gpi Rat tert-butyl hydroperoxide increases expression ISO Gpi1 (Mus musculus) 6480464 tert-Butylhydroperoxide results in increased expression of GPI1 mRNA CTD PMID:15003993 Gpi Rat thapsigargin increases expression EXP 6480464 Thapsigargin results in increased expression of GPI protein CTD PMID:35544339 Gpi Rat thimerosal decreases expression ISO GPI (Homo sapiens) 6480464 Thimerosal results in decreased expression of GPI mRNA CTD PMID:27188386 Gpi Rat thiram decreases expression ISO GPI (Homo sapiens) 6480464 Thiram results in decreased expression of GPI mRNA CTD PMID:38568856 Gpi Rat trichostatin A increases expression ISO GPI (Homo sapiens) 6480464 trichostatin A results in increased expression of GPI mRNA CTD PMID:24935251 Gpi Rat triclosan decreases expression ISO GPI (Homo sapiens) 6480464 Triclosan results in decreased expression of GPI mRNA CTD PMID:30510588 Gpi Rat triphenyl phosphate increases expression EXP 6480464 triphenyl phosphate results in increased expression of GPI mRNA CTD PMID:30589522 Gpi Rat triptonide affects expression ISO Gpi1 (Mus musculus) 6480464 triptonide affects the expression of GPI1 mRNA CTD PMID:33045310 Gpi Rat triptonide decreases expression ISO Gpi1 (Mus musculus) 6480464 triptonide results in decreased expression of GPI1 mRNA CTD PMID:33045310 Gpi Rat troglitazone decreases expression ISO Gpi1 (Mus musculus) 6480464 troglitazone results in decreased expression of GPI mRNA CTD PMID:28973697 Gpi Rat Tungsten carbide multiple interactions ISO GPI (Homo sapiens) 6480464 [tungsten carbide binds to Cobalt] which results in increased expression of GPI mRNA CTD PMID:20105288 Gpi Rat tunicamycin decreases expression ISO Gpi1 (Mus musculus) 6480464 Tunicamycin results in decreased expression of GPI1 mRNA CTD PMID:17127020 Gpi Rat tunicamycin decreases expression ISO GPI (Homo sapiens) 6480464 Tunicamycin results in decreased expression of GPI mRNA CTD PMID:22378314 Gpi Rat vitamin E increases expression ISO GPI (Homo sapiens) 6480464 Vitamin E results in increased expression of GPI mRNA CTD PMID:19244175 Gpi Rat vorinostat decreases expression ISO GPI (Homo sapiens) 6480464 vorinostat results in decreased expression of GPI mRNA CTD PMID:27188386 Gpi Rat Yessotoxin increases expression ISO GPI (Homo sapiens) 6480464 yessotoxin analog results in increased expression of GPI mRNA CTD PMID:30679557
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 1-chloro-2,4-dinitrobenzene (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,6-dimethoxyphenol (ISO) 2,6-dinitrotoluene (EXP) 2-bromohexadecanoic acid (ISO) 4,4'-sulfonyldiphenol (ISO) 4-amino-2,6-dinitrotoluene (EXP) 4-hydroxyphenyl retinamide (ISO) acrylamide (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-naphthoflavone (ISO) AM-251 (EXP) aristolochic acid A (ISO) arsenous acid (ISO) atrazine (ISO) Azaspiracid (ISO) benzatropine (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bifenthrin (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bleomycin A2 (EXP) Brodifacoum (EXP) Butylbenzyl phthalate (ISO) cadmium acetate (EXP) cadmium atom (EXP,ISO) cadmium dichloride (ISO) caffeine (ISO) carbon nanotube (ISO) chlorpyrifos (ISO) chromium atom (ISO) clobetasol (ISO) clofibric acid (EXP) clozapine (ISO) cobalt atom (ISO) cobalt dichloride (EXP,ISO) copper atom (ISO) copper(0) (ISO) crocidolite asbestos (ISO) cyclosporin A (ISO) dexamethasone (ISO) dextran sulfate (ISO) Di-n-octyl phthalate (ISO) diarsenic trioxide (ISO) diazinon (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) dicrotophos (ISO) diethyl phthalate (ISO) diethylstilbestrol (ISO) dihydroartemisinin (ISO) Diisodecyl phthalate (ISO) diisononyl phthalate (ISO) dinophysistoxin 1 (ISO) dioxygen (ISO) elemental selenium (ISO) enzyme inhibitor (ISO) epoxiconazole (ISO) ethanol (ISO) fipronil (EXP) flutamide (EXP,ISO) formaldehyde (ISO) FR900359 (ISO) furfural (ISO) gentamycin (EXP) hydrogen sulfide (ISO) ivermectin (ISO) josamycin (ISO) lead(0) (ISO) lipopolysaccharide (ISO) methoxychlor (EXP) methyl methanesulfonate (ISO) N-methyl-4-phenylpyridinium (ISO) N-nitrosodiethylamine (EXP) nefazodone (EXP) nickel dichloride (ISO) nickel subsulfide (ISO) nicotinic acid (ISO) nitric oxide (ISO) ochratoxin A (ISO) okadaic acid (ISO) ozone (ISO) paclitaxel (ISO) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) picoxystrobin (ISO) pirinixic acid (ISO) prostaglandin A1 (ISO) puerarin (EXP) quercetin (ISO) rotenone (ISO) S-butyl-DL-homocysteine (S,R)-sulfoximine (ISO) sarin (ISO) SB 431542 (ISO) selenium atom (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sodium chloride (ISO) sodium fluoride (ISO) temozolomide (ISO) tert-butyl hydroperoxide (ISO) thapsigargin (EXP) thimerosal (ISO) thiram (ISO) trichostatin A (ISO) triclosan (ISO) triphenyl phosphate (EXP) triptonide (ISO) troglitazone (ISO) Tungsten carbide (ISO) tunicamycin (ISO) vitamin E (ISO) vorinostat (ISO) Yessotoxin (ISO)
Biological Process
canonical glycolysis (IEA,ISO) carbohydrate derivative metabolic process (IEA) erythrocyte homeostasis (IEA,ISO) fructose 6-phosphate metabolic process (IEA,ISO) gluconeogenesis (IBA,IEA,ISO) glucose 6-phosphate metabolic process (IBA,IDA,IEA,ISO) glucose homeostasis (IEA,ISO) glycolytic process (IBA,IEA,ISO) in utero embryonic development (IEA,ISO) learning or memory (IEP) mesoderm formation (IEA,ISO) negative regulation of apoptotic process (IMP) negative regulation of glycolytic process through fructose-6-phosphate (ISO) positive regulation of endothelial cell migration (IEA,ISO) positive regulation of immunoglobulin production (IEA,ISO) response to cadmium ion (IEP) response to estradiol (IEP) response to immobilization stress (IEP) response to muscle stretch (IEP) response to progesterone (IEP) response to testosterone (IEP) signal transduction (IEA)
1.
Cumene peroxide and Fe(2+)-ascorbate-induced lipid peroxidation and effect of phosphoglucose isomerase.
Agadjanyan ZS, etal., Mol Cell Biochem. 2006 Sep;289(1-2):49-53. Epub 2006 Apr 1.
2.
Glucosephosphate isomerase (GPI) deficiency mutations associated with hereditary nonspherocytic hemolytic anemia (HNSHA).
Beutler E, etal., Blood Cells Mol Dis. 1997 Dec;23(3):402-9.
3.
Time course of chronic oral cadmium nephrotoxicity in Wistar rats: excretion of urinary enzymes.
Bomhard EM, etal., Drug Chem Toxicol. 1999 Nov;22(4):679-703.
4.
The cellular fate of glucose and its relevance in type 2 diabetes.
Bouche C, etal., Endocr Rev. 2004 Oct;25(5):807-30.
5.
Key enzymes of carbohydrate metabolism as targets of the 11.5-kDa Zn(2+)-binding protein (parathymosin).
Brand IA and Heinickel A, J Biol Chem. 1991 Nov 5;266(31):20984-9.
6.
Alterations in the mRNA levels of two metabolic enzymes in rat skeletal muscle during stretch-induced hypertrophy and disuse atrophy.
Brownson C and Loughna P, Pflugers Arch. 1996 Apr;431(6):990-2.
7.
Evidence for the participation of opioids in the regulation of carbohydrate metabolism in rat mammary glands.
Deshpande N and Mitchell I, J Endocrinol. 1980 Jun;85(3):415-21.
8.
Effect of 6-phosphogluconate on phosphoglucose isomerase in rat brain in vitro and in vivo.
Gaitonde MK, etal., J Neurochem. 1989 May;52(5):1348-52.
9.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
10.
Plasma and intracellular levels of lactate dehydrogenase, phosphohexose isomerase and lysozyme activity in acute leukemia.
Ho AD, etal., Blut. 1984 Jul;49(1):19-28.
11.
Glycolytic enzyme levels in synaptosomes.
Knull HR and Fillmore SJ, Comp Biochem Physiol B. 1985;81(2):349-51.
12.
Molecular basis of neurological dysfunction coupled with haemolytic anaemia in human glucose-6-phosphate isomerase (GPI) deficiency.
Kugler W, etal., Hum Genet. 1998 Oct;103(4):450-4.
13.
A link between maze learning and hippocampal expression of neuroleukin and its receptor gp78.
Luo Y, etal., J Neurochem. 2002 Jan;80(2):354-61.
14.
Comparative study of the effects of beta-sitosterol, estradiol and progesterone on selected biochemical parameters of the uterus of ovariectomised rats.
Malini T and Vanithakumari G, J Ethnopharmacol. 1992 Feb;36(1):51-5.
15.
Glucose-6-phosphate isomerase deficiency associated with nonspherocytic hemolytic anemia in the mouse: an animal model for the human disease.
Merkle S and Pretsch W, Blood. 1993 Jan 1;81(1):206-13.
16.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
17.
Silencing of autocrine motility factor induces mesenchymal-to-epithelial transition and suppression of osteosarcoma pulmonary metastasis.
Niinaka Y, etal., Cancer Res. 2010 Nov 15;70(22):9483-93. doi: 10.1158/0008-5472.CAN-09-3880. Epub 2010 Oct 26.
18.
[Androgen regulation of aldolase and phosphohexose isomerase in the liver and seminal vesicles of white rats].
Nikulin AA, Vopr Med Khim. 1985 Mar-Apr;31(2):51-5.
19.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
20.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
21.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
22.
A glucose-6-phosphate isomerase peptide induces T and B cell-dependent chronic arthritis in C57BL/10 mice: arthritis without reactive oxygen species and complement.
Pizzolla A, etal., Am J Pathol. 2013 Oct;183(4):1144-55. doi: 10.1016/j.ajpath.2013.06.019. Epub 2013 Jul 30.
23.
Red cell glucose phosphate isomerase (GPI): a molecular study of three novel mutations associated with hereditary nonspherocytic hemolytic anemia.
Repiso A, etal., Hum Mutat. 2006 Nov;27(11):1159.
24.
GOA pipeline
RGD automated data pipeline
25.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
26.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
27.
Neuroleukin inhibition sensitises neuronal cells to caspase-dependent apoptosis.
Romagnoli A, etal., Biochem Biophys Res Commun. 2003 Mar 14;302(3):448-53.
28.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
29.
Increased red cell turnover in a line of CD22-deficient mice is caused by Gpi1c: a model for hereditary haemolytic anaemia.
Walker JA, etal., Eur J Immunol. 2012 Dec;42(12):3212-22. doi: 10.1002/eji.201242633. Epub 2012 Oct 16.
30.
DNA sequence abnormalities in human glucose 6-phosphate isomerase deficiency.
Walker JI, etal., Hum Mol Genet. 1993 Mar;2(3):327-9.
Gpi Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 95,965,389 - 95,996,932 (-) NCBI GRCr8 mRatBN7.2 1 86,828,211 - 86,856,077 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 86,828,216 - 86,856,086 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 92,231,564 - 92,259,517 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 100,697,568 - 100,725,522 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 93,989,860 - 94,017,813 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 90,063,411 - 90,091,287 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 90,063,411 - 90,091,287 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 91,207,014 - 91,234,890 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 86,658,836 - 86,686,712 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 86,736,946 - 86,764,823 (-) NCBI Celera 1 81,194,482 - 81,222,306 (-) NCBI Celera Cytogenetic Map 1 q21 NCBI
GPI Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 34,359,718 - 34,402,413 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 34,359,480 - 34,402,413 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 34,855,645 - 34,893,318 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 39,547,909 - 39,583,076 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 39,547,908 - 39,583,076 NCBI Celera 19 31,557,376 - 31,605,748 (+) NCBI Celera Cytogenetic Map 19 q13.11 NCBI HuRef 19 31,360,777 - 31,377,222 (+) NCBI HuRef HuRef 19 31,390,807 - 31,399,974 (+) NCBI HuRef CHM1_1 19 34,857,156 - 34,895,165 (+) NCBI CHM1_1 T2T-CHM13v2.0 19 36,886,877 - 36,946,977 (+) NCBI T2T-CHM13v2.0
Gpi1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 33,900,752 - 33,929,761 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 33,900,755 - 33,929,761 (-) Ensembl GRCm39 Ensembl GRCm38 7 34,201,327 - 34,230,336 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 34,201,330 - 34,230,336 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 34,986,346 - 35,015,324 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 33,910,918 - 33,939,022 (-) NCBI MGSCv36 mm8 MGSCv36 7 24,688,418 - 24,717,214 (-) NCBI MGSCv36 mm8 Celera 7 29,335,681 - 29,371,931 (-) NCBI Celera Cytogenetic Map 7 B1 NCBI cM Map 7 19.46 NCBI
Gpi Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955468 3,980,999 - 4,008,652 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955468 3,980,999 - 4,007,553 (+) NCBI ChiLan1.0 ChiLan1.0
GPI Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 40,351,367 - 40,402,743 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 42,351,411 - 42,404,890 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 31,301,469 - 31,355,362 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 40,024,584 - 40,080,598 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 40,024,584 - 40,080,598 (+) Ensembl panpan1.1 panPan2
GPI Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 117,922,380 - 117,948,325 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 117,922,635 - 117,948,316 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 117,320,830 - 117,346,503 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 118,518,230 - 118,543,889 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 118,497,395 - 118,544,065 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 118,079,121 - 118,105,067 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 117,705,505 - 117,731,413 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 118,763,883 - 118,789,615 (-) NCBI UU_Cfam_GSD_1.0
Gpi Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409349 10,037,338 - 10,063,762 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936570 1,579,372 - 1,608,788 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936570 1,582,120 - 1,608,537 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
GPI Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 44,038,357 - 44,069,328 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 44,038,374 - 44,069,331 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 39,516,820 - 39,547,963 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3 Pig Cytomap 6 q12 NCBI
GPI Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 6 29,404,067 - 29,451,290 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 6 29,403,500 - 29,453,162 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666073 7,177,821 - 7,221,208 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Gpi
.
Assembly: RGSC_v3.4 Assembly: Rnor_5.0 Assembly: Rnor_6.0
Predicted Target Of
Count of predictions: 55 Count of miRNA genes: 48 Interacting mature miRNAs: 52 Transcripts: ENSRNOT00000032613 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2313059 Bss55 Bone structure and strength QTL 55 3.2 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 631688 Hcas2 Hepatocarcinoma susceptibility QTL 2 3 0.0001 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 5925874 115540829 Rat 1578649 Bmd8 Bone mineral density QTL 8 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 1 49393172 94393172 Rat 1582234 Gluco18 Glucose level QTL 18 3.4 0.0003 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 78479925 123479925 Rat 1358359 Sradr1 Stress Responsive Adrenal Weight QTL 1 4.74 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 30882023 123479925 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 49393172 159356837 Rat 2300324 Fetw1 Fetal weight QTL 1 12.1 0.005 fetal growth trait (VT:0004201) fetal body weight (CMO:0002080) 1 85424647 100358001 Rat 2302059 Pia36 Pristane induced arthritis QTL 36 3.8 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 1 43333002 88333002 Rat 1300121 Hrtrt1 Heart rate QTL 1 3.7 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 65789093 115540829 Rat 7421628 Bp361 Blood pressure QTL 361 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 66023617 118608521 Rat 631495 Bp96 Blood pressure QTL 96 4.52 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 22340647 102268831 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 631512 Scl6 Serum cholesterol level QTL 6 9.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 1 72197680 90508767 Rat 2298545 Neuinf8 Neuroinflammation QTL 8 4.6 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 1 57336763 151090257 Rat 2313072 Bss53 Bone structure and strength QTL 53 4.3 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 43284731 118944897 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 2313078 Bss54 Bone structure and strength QTL 54 3.5 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 1549903 Bp267 Blood pressure QTL 267 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 77876254 106047988 Rat 2313083 Bmd74 Bone mineral density QTL 74 4 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 1 82174743 118944897 Rat 2313402 Anxrr24 Anxiety related response QTL 24 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 1 48963584 144267916 Rat 4889494 Scort2 Serum corticosterone level QTL 2 4.2 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 80592172 125592172 Rat 61342 Bp27 Blood pressure QTL 27 3.4 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 56732668 98773277 Rat 1300172 Bp172 Blood pressure QTL 172 3.56 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 32737273 90665040 Rat 61344 Bp29 Blood pressure QTL 29 7.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 78350581 123350581 Rat 1358192 Ept13 Estrogen-induced pituitary tumorigenesis QTL 13 3.4 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 77494165 122494165 Rat 2313094 Bss58 Bone structure and strength QTL 58 3.7 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 43284731 118944897 Rat 6903308 Scl36 Serum cholesterol QTL 36 2 0.0125 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 53863041 90532583 Rat 2300164 Bmd44 Bone mineral density QTL 44 5.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 1 56949932 101949932 Rat 2313099 Bss56 Bone structure and strength QTL 56 2.4 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 1 43284731 118944897 Rat 2313098 Bmd70 Bone mineral density QTL 70 3.6 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 43284731 118944897 Rat 738022 Anxrr13 Anxiety related response QTL 13 4.6 0.00039 locomotor behavior trait (VT:0001392) number of 20 x 20 cm floor squares crossed into, out of or within a discrete space in an experimental apparatus (CMO:0001514) 1 83547917 128547917 Rat 152025249 Scl82 Serum cholesterol level QTL 82 4.77 blood cholesterol amount (VT:0000180) 1 50343510 99980958 Rat 10054135 Gmadr2 Adrenal mass QTL 2 1.97 0.0129 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 77857876 122857876 Rat 7411712 Strs4 Sensitivity to stroke QTL 4 8.7 cerebrum integrity trait (VT:0010549) percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932) 1 78430536 123430536 Rat 2313051 Bss57 Bone structure and strength QTL 57 3.7 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 43284731 118944897 Rat 61433 Cia2 Collagen induced arthritis QTL 2 5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 1 78430754 91209302 Rat
PMC164521P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 86,830,299 - 86,831,706 (+) MAPPER mRatBN7.2 Rnor_6.0 1 90,065,500 - 90,066,906 NCBI Rnor6.0 Rnor_5.0 1 91,209,103 - 91,210,509 UniSTS Rnor5.0 RGSC_v3.4 1 86,660,925 - 86,662,331 UniSTS RGSC3.4 Celera 1 81,196,529 - 81,197,935 UniSTS Cytogenetic Map 1 q21 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000032613 ⟹ ENSRNOP00000029515
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 86,828,216 - 86,856,086 (-) Ensembl Rnor_6.0 Ensembl 1 90,063,411 - 90,091,287 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000097410 ⟹ ENSRNOP00000087782
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 86,828,216 - 86,856,086 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000101765 ⟹ ENSRNOP00000085356
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 86,828,216 - 86,856,086 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000112795 ⟹ ENSRNOP00000080691
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 86,828,216 - 86,855,568 (-) Ensembl
RefSeq Acc Id:
NM_207592 ⟹ NP_997475
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 95,965,393 - 95,993,261 (-) NCBI mRatBN7.2 1 86,828,211 - 86,856,077 (-) NCBI Rnor_6.0 1 90,063,411 - 90,091,287 (-) NCBI Rnor_5.0 1 91,207,014 - 91,234,890 (-) NCBI RGSC_v3.4 1 86,658,836 - 86,686,712 (-) RGD Celera 1 81,194,482 - 81,222,306 (-) RGD
Sequence:
CGCTGCCGCTCCTCTTTCCTTCCTCTTCCGTGCACGTACTGCTCCGTGTACTTCTCGGGTCCCGCCATGGCTGCGCTCACCCGGAACCCGGAGTTCCAGAAGCTGCTGGAGTGGCACCGGGCGAACTC
hide sequence
RefSeq Acc Id:
XM_063283685 ⟹ XP_063139755
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 95,965,389 - 95,996,883 (-) NCBI
RefSeq Acc Id:
XM_063283691 ⟹ XP_063139761
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 95,965,389 - 95,996,932 (-) NCBI
RefSeq Acc Id:
NP_997475 ⟸ NM_207592
- UniProtKB:
Q6P6V0 (UniProtKB/Swiss-Prot), A0A8I6A243 (UniProtKB/TrEMBL)
- Sequence:
MAALTRNPEFQKLLEWHRANSANLKLRELFEADPERFNHFSLNLNTNHGHILLDYSKNLVNKEVLHMLVDLAKSRGVEAARDNMFSGLKINSTEDRAVLHVALRNRSNRSIMMDGKDVMPEVNKVLDK
hide sequence
Ensembl Acc Id:
ENSRNOP00000029515 ⟸ ENSRNOT00000032613
Ensembl Acc Id:
ENSRNOP00000080691 ⟸ ENSRNOT00000112795
Ensembl Acc Id:
ENSRNOP00000085356 ⟸ ENSRNOT00000101765
Ensembl Acc Id:
ENSRNOP00000087782 ⟸ ENSRNOT00000097410
RefSeq Acc Id:
XP_063139761 ⟸ XM_063283691
- Peptide Label:
isoform X1
- UniProtKB:
Q6P6V0 (UniProtKB/Swiss-Prot), A0A8I6A243 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063139755 ⟸ XM_063283685
- Peptide Label:
isoform X1
- UniProtKB:
Q6P6V0 (UniProtKB/Swiss-Prot), A0A8I6A243 (UniProtKB/TrEMBL)
RGD ID: 13689949 Promoter ID: EPDNEW_R473 Type: multiple initiation site Name: Gpi_1 Description: glucose-6-phosphate isomerase SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 90,091,293 - 90,091,353 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2011-08-02
Gpi
glucose-6-phosphate isomerase
Gpi
glucose phosphate isomerase
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-11-06
Gpi
glucose phosphate isomerase
Glucose phosphate isomerase
Name updated
625702 APPROVED
2002-06-10
Gpi
Glucose phosphate isomerase
Symbol and Name status set to approved
70586 APPROVED
