Symbol:
Fyn
Name:
FYN proto-oncogene, Src family tyrosine kinase
RGD ID:
2641
Description:
Enables several functions, including phosphatidylinositol 3-kinase binding activity; protein tyrosine kinase activity; and signaling receptor binding activity. Involved in several processes, including cellular response to amino acid stimulus; negative regulation of apoptotic process; and protein phosphorylation. Located in several cellular components, including mitochondrion; perinuclear endoplasmic reticulum; and postsynaptic density. Is active in dendrite; glutamatergic synapse; and postsynaptic density, intracellular component. Biomarker of temporal lobe epilepsy. Human ortholog(s) of this gene implicated in Alzheimer's disease; alcohol dependence; and schizophrenia. Orthologous to human FYN (FYN proto-oncogene, Src family tyrosine kinase); PARTICIPATES IN altered Reelin signaling pathway; E-cadherin signaling pathway; eicosanoid signaling pathway; INTERACTS WITH 17beta-estradiol; 17beta-estradiol 3-benzoate; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
FYN oncogene related to SRC, FGR, YES; fyn proto-oncogene; p59-Fyn; proto-oncogene c-Fyn; proto-oncogene tyrosine-protein kinase Fyn; tyrosine-protein kinase Fyn
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
FYN (FYN proto-oncogene, Src family tyrosine kinase) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Fyn (Fyn proto-oncogene) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Fyn (FYN proto-oncogene, Src family tyrosine kinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
FYN (FYN proto-oncogene, Src family tyrosine kinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
FYN (FYN proto-oncogene, Src family tyrosine kinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Fyn (FYN proto-oncogene, Src family tyrosine kinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
FYN (FYN proto-oncogene, Src family tyrosine kinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
FYN (FYN proto-oncogene, Src family tyrosine kinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Fyn (FYN proto-oncogene, Src family tyrosine kinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
ZSCAN12 (zinc finger and SCAN domain containing 12) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
FYN (FYN proto-oncogene, Src family tyrosine kinase)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Fyn (Fyn proto-oncogene)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
fyna (FYN proto-oncogene, Src family tyrosine kinase a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
fynb (FYN proto-oncogene, Src family tyrosine kinase b)
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
Src64B
Alliance
DIOPT (Hieranoid|OrthoFinder|PANTHER)
Caenorhabditis elegans (roundworm):
src-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
Src42A
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA)
Caenorhabditis elegans (roundworm):
src-2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoInspector|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
fyn
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Allele / Splice:
Fynem6Mcwi
Fynem1Mcwi
Genetic Models:
SS-Fynem6Mcwi
SS-Fynem1Mcwi
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 44,322,635 - 44,514,498 (+) NCBI GRCr8 mRatBN7.2 20 42,767,733 - 42,960,903 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 42,766,369 - 42,959,911 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 44,517,354 - 44,708,655 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 44,176,580 - 44,367,880 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 44,909,156 - 45,110,016 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 44,436,354 - 44,630,316 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 44,436,403 - 44,630,317 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 46,160,734 - 46,353,456 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 43,501,853 - 43,695,567 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 43,524,863 - 43,718,578 (+) NCBI Celera 20 43,482,980 - 43,675,123 (+) NCBI Celera Cytogenetic Map 20 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Fyn Rat (-)-epigallocatechin 3-gallate multiple interactions ISO FYN (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of FYN mRNA CTD PMID:22079256 Fyn Rat (R,R,R)-alpha-tocopherol multiple interactions ISO FYN (Homo sapiens) 6480464 alpha-Tocopherol inhibits the reaction [bis(2-hydroxy-2-ethylbutanoato)oxochromate(V) results in increased phosphorylation of FYN protein] and alpha-Tocopherol inhibits the reaction [Potassium Dichromate results in increased phosphorylation of FYN protein] CTD PMID:14572611 Fyn Rat (S)-nicotine multiple interactions ISO FYN (Homo sapiens) 6480464 LCK protein promotes the reaction [Nicotine results in increased phosphorylation of and results in increased activity of FYN protein] and Nicotine results in increased phosphorylation of and results in increased activity of FYN protein CTD PMID:17709503 Fyn Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine multiple interactions ISO Fyn (Mus musculus) 6480464 [Caffeine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Fyn Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine decreases expression ISO Fyn (Mus musculus) 6480464 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Fyn Rat 17beta-estradiol multiple interactions ISO FYN (Homo sapiens) 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in decreased expression of FYN mRNA CTD PMID:19619570 Fyn Rat 17beta-estradiol multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of FYN mRNA CTD PMID:32741896 Fyn Rat 17beta-estradiol increases expression ISO FYN (Homo sapiens) 6480464 Estradiol results in increased expression of FYN mRNA CTD PMID:19619570 Fyn Rat 17beta-estradiol decreases expression ISO FYN (Homo sapiens) 6480464 Estradiol results in decreased expression of FYN mRNA CTD PMID:20106945 Fyn Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of FYN mRNA CTD PMID:32741896 Fyn Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO FYN (Homo sapiens) 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in decreased expression of FYN mRNA CTD PMID:19619570 Fyn Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of FYN mRNA CTD PMID:33387578 and PMID:34747641 Fyn Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Fyn (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of FYN mRNA CTD PMID:25975270 Fyn Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Fyn (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of FYN mRNA CTD PMID:24680724 Fyn Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of FYN mRNA CTD PMID:22298810 Fyn Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO FYN (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of FYN mRNA CTD PMID:19619570 Fyn Rat 2-arachidonoylglycerol multiple interactions EXP 6480464 FYN gene mutant form inhibits the reaction [glyceryl 2-arachidonate results in increased phosphorylation of and results in increased activity of MAPK1 protein] and FYN gene mutant form inhibits the reaction [glyceryl 2-arachidonate results in increased phosphorylation of and results in increased activity of MAPK3 protein] CTD PMID:12657697 Fyn Rat 2-methylcholine affects expression ISO FYN (Homo sapiens) 6480464 beta-methylcholine affects the expression of FYN mRNA CTD PMID:21179406 Fyn Rat 3,3',4,4',5-pentachlorobiphenyl multiple interactions ISO FYN (Homo sapiens) 6480464 3 more ... CTD PMID:24709675 Fyn Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression ISO FYN (Homo sapiens) 6480464 3 more ... CTD PMID:24709675 Fyn Rat 3-methylcholanthrene multiple interactions ISO Fyn (Mus musculus) 6480464 [Methylcholanthrene co-treated with Tetradecanoylphorbol Acetate] results in increased expression of FYN mRNA CTD PMID:23519560 Fyn Rat 4,4'-diaminodiphenylmethane increases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of FYN mRNA CTD PMID:25380136 Fyn Rat 4,4'-sulfonyldiphenol decreases methylation ISO FYN (Homo sapiens) 6480464 bisphenol S results in decreased methylation of FYN gene CTD PMID:31601247 Fyn Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of FYN mRNA CTD PMID:36041667 Fyn Rat 4-hydroxyphenyl retinamide increases expression ISO Fyn (Mus musculus) 6480464 Fenretinide results in increased expression of FYN mRNA CTD PMID:28973697 Fyn Rat 5-aza-2'-deoxycytidine affects expression ISO FYN (Homo sapiens) 6480464 Decitabine affects the expression of FYN mRNA and Decitabine affects the expression of FYN protein CTD PMID:18337055 Fyn Rat 5-aza-2'-deoxycytidine increases expression ISO FYN (Homo sapiens) 6480464 Decitabine results in increased expression of FYN mRNA CTD PMID:16367923 and PMID:19151715 Fyn Rat 5-azacytidine increases expression ISO FYN (Homo sapiens) 6480464 Azacitidine results in increased expression of FYN mRNA CTD PMID:21245298 Fyn Rat 5-fluorouracil affects response to substance ISO FYN (Homo sapiens) 6480464 FYN protein affects the susceptibility to Fluorouracil CTD PMID:16217747 Fyn Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of FYN mRNA CTD PMID:31881176 Fyn Rat acrolein affects expression EXP 6480464 Acrolein affects the expression of FYN mRNA CTD PMID:38090360 Fyn Rat aflatoxin B1 affects expression ISO FYN (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of FYN protein CTD PMID:20106945 Fyn Rat aflatoxin B1 decreases expression ISO FYN (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of FYN mRNA CTD PMID:22100608 Fyn Rat aflatoxin B1 decreases expression ISO Fyn (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of FYN mRNA CTD PMID:19770486 Fyn Rat alachlor increases expression EXP 6480464 alachlor results in increased expression of FYN mRNA CTD PMID:12419858 Fyn Rat all-trans-retinoic acid decreases expression ISO FYN (Homo sapiens) 6480464 Tretinoin results in decreased expression of FYN mRNA CTD PMID:15498508 more ... Fyn Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of FYN mRNA CTD PMID:30047161 Fyn Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of FYN mRNA CTD PMID:16483693 Fyn Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of FYN mRNA CTD PMID:30779732 Fyn Rat antigen increases activity ISO Fyn (Mus musculus) 6480464 Antigens results in increased activity of FYN protein CTD PMID:21958720 Fyn Rat antigen multiple interactions ISO Fyn (Mus musculus) 6480464 Quinoxalines analog inhibits the reaction [Antigens results in increased activity of FYN protein] CTD PMID:21958720 Fyn Rat antimycin A decreases expression ISO FYN (Homo sapiens) 6480464 Antimycin A results in decreased expression of FYN mRNA CTD PMID:33512557 Fyn Rat arsane affects methylation ISO FYN (Homo sapiens) 6480464 Arsenic affects the methylation of FYN gene CTD PMID:25304211 Fyn Rat arsane multiple interactions ISO FYN (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of FYN mRNA CTD PMID:39836092 Fyn Rat arsenic atom affects methylation ISO FYN (Homo sapiens) 6480464 Arsenic affects the methylation of FYN gene CTD PMID:25304211 Fyn Rat arsenic atom multiple interactions ISO FYN (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of FYN mRNA CTD PMID:39836092 Fyn Rat Azoxymethane multiple interactions ISO Fyn (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of FYN mRNA CTD PMID:29950665 Fyn Rat benzo[a]pyrene decreases expression ISO Fyn (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of FYN mRNA CTD PMID:19770486 Fyn Rat benzo[a]pyrene increases expression ISO Fyn (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of FYN mRNA CTD PMID:32417428 Fyn Rat benzo[a]pyrene increases methylation ISO Fyn (Mus musculus) 6480464 Benzo(a)pyrene results in increased methylation of FYN 3' UTR more ... CTD PMID:27901495 Fyn Rat benzo[a]pyrene affects methylation ISO FYN (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of FYN 5' UTR and Benzo(a)pyrene affects the methylation of FYN promoter CTD PMID:27901495 Fyn Rat benzo[a]pyrene decreases expression ISO FYN (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of FYN mRNA CTD PMID:20064835 more ... Fyn Rat benzo[a]pyrene diol epoxide I multiple interactions ISO Fyn (Mus musculus) 6480464 7 more ... CTD PMID:21501596 Fyn Rat benzo[a]pyrene diol epoxide I decreases expression ISO FYN (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 and PMID:20018196 Fyn Rat bis(2-chloroethyl) sulfide decreases expression ISO Fyn (Mus musculus) 6480464 Mustard Gas results in decreased expression of FYN mRNA CTD PMID:15674843 Fyn Rat bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in increased expression of FYN mRNA and [Diethylhexyl Phthalate co-treated with Genistein] results in increased expression of FYN mRNA CTD PMID:25607892 and PMID:32533902 Fyn Rat bis(2-ethylhexyl) phthalate decreases expression ISO Fyn (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of FYN mRNA CTD PMID:34319233 Fyn Rat bisphenol A decreases expression ISO Fyn (Mus musculus) 6480464 bisphenol A results in decreased expression of FYN mRNA CTD PMID:26063408 Fyn Rat bisphenol A multiple interactions ISO FYN (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of FYN gene CTD PMID:31601247 Fyn Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of FYN mRNA CTD PMID:25181051 more ... Fyn Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of FYN mRNA and [bisphenol A co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with butylparaben] affects the expression of FYN mRNA CTD PMID:25607892 and PMID:36041667 Fyn Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of FYN mRNA CTD PMID:36041667 Fyn Rat butanal increases expression ISO FYN (Homo sapiens) 6480464 butyraldehyde results in increased expression of FYN mRNA CTD PMID:26079696 Fyn Rat Butylparaben multiple interactions EXP 6480464 [bisphenol A co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with butylparaben] affects the expression of FYN mRNA CTD PMID:25607892 Fyn Rat caffeine multiple interactions ISO Fyn (Mus musculus) 6480464 [Caffeine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Fyn Rat calcium dichloride increases expression ISO FYN (Homo sapiens) 6480464 Calcium Chloride results in increased expression of FYN protein CTD PMID:25824407 Fyn Rat captan decreases expression ISO Fyn (Mus musculus) 6480464 Captan results in decreased expression of FYN mRNA CTD PMID:31558096 Fyn Rat carmustine decreases expression ISO FYN (Homo sapiens) 6480464 Carmustine results in decreased expression of FYN mRNA CTD PMID:15980968 Fyn Rat CGP 52608 multiple interactions ISO FYN (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to FYN gene] CTD PMID:28238834 Fyn Rat chlorpyrifos increases expression ISO Fyn (Mus musculus) 6480464 Chlorpyrifos results in increased expression of FYN mRNA CTD PMID:37019170 Fyn Rat chromium(6+) multiple interactions ISO FYN (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [chromium hexavalent ion results in increased activity of FYN protein] more ... CTD PMID:12902192 and PMID:19994902 Fyn Rat chromium(6+) increases activity ISO FYN (Homo sapiens) 6480464 [chromium hexavalent ion results in increased activity of FYN protein] which results in increased activity of STAT1 protein and chromium hexavalent ion results in increased activity of FYN protein CTD PMID:12902192 and PMID:19994902 Fyn Rat cisplatin decreases expression ISO FYN (Homo sapiens) 6480464 Cisplatin results in decreased expression of FYN mRNA CTD PMID:19561079 Fyn Rat cisplatin multiple interactions ISO FYN (Homo sapiens) 6480464 Cisplatin promotes the reaction [jinfukang results in decreased expression of FYN mRNA] and jinfukang promotes the reaction [Cisplatin results in decreased expression of FYN mRNA] CTD PMID:27392435 Fyn Rat cobalt dichloride multiple interactions ISO Fyn (Mus musculus) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [cobaltous chloride results in increased phosphorylation of FYN protein] more ... CTD PMID:20850416 Fyn Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of FYN mRNA CTD PMID:24386269 Fyn Rat cobalt dichloride increases phosphorylation ISO Fyn (Mus musculus) 6480464 cobaltous chloride results in increased phosphorylation of FYN protein CTD PMID:20850416 Fyn Rat copper atom increases phosphorylation ISO Fyn (Mus musculus) 6480464 Copper results in increased phosphorylation of FYN protein CTD PMID:21172064 Fyn Rat copper atom multiple interactions ISO Fyn (Mus musculus) 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in increased expression of FYN mRNA CTD PMID:15467011 Fyn Rat copper atom multiple interactions ISO FYN (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of FYN mRNA CTD PMID:20971185 Fyn Rat copper(0) increases phosphorylation ISO Fyn (Mus musculus) 6480464 Copper results in increased phosphorylation of FYN protein CTD PMID:21172064 Fyn Rat copper(0) multiple interactions ISO Fyn (Mus musculus) 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in increased expression of FYN mRNA CTD PMID:15467011 Fyn Rat copper(0) multiple interactions ISO FYN (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of FYN mRNA CTD PMID:20971185 Fyn Rat copper(II) sulfate increases expression ISO FYN (Homo sapiens) 6480464 Copper Sulfate results in increased expression of FYN mRNA CTD PMID:19549813 Fyn Rat cyclophosphamide increases expression ISO FYN (Homo sapiens) 6480464 Cyclophosphamide results in increased expression of FYN mRNA CTD PMID:17403535 Fyn Rat cyclosporin A decreases expression ISO FYN (Homo sapiens) 6480464 Cyclosporine results in decreased expression of FYN mRNA CTD PMID:20106945 Fyn Rat cyclosporin A increases expression ISO Fyn (Mus musculus) 6480464 Cyclosporine results in increased expression of FYN mRNA CTD PMID:19770486 Fyn Rat cytarabine increases expression ISO FYN (Homo sapiens) 6480464 Cytarabine results in increased expression of FYN mRNA CTD PMID:21198554 Fyn Rat D-gluconic acid decreases expression EXP 6480464 gluconic acid results in decreased expression of FYN mRNA CTD PMID:16556975 Fyn Rat DDE multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in increased expression of FYN mRNA CTD PMID:25607892 Fyn Rat DDE decreases expression ISO FYN (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of FYN mRNA CTD PMID:38568856 Fyn Rat deguelin decreases expression ISO FYN (Homo sapiens) 6480464 deguelin results in decreased expression of FYN mRNA CTD PMID:33512557 Fyn Rat dexamethasone increases phosphorylation EXP 6480464 Dexamethasone results in increased phosphorylation of FYN protein CTD PMID:15187100 Fyn Rat dextran sulfate multiple interactions ISO Fyn (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of FYN mRNA CTD PMID:29950665 Fyn Rat diazinon affects expression EXP 6480464 Diazinon affects the expression of FYN mRNA CTD PMID:22546817 Fyn Rat diazinon increases methylation ISO FYN (Homo sapiens) 6480464 Diazinon results in increased methylation of FYN gene CTD PMID:22964155 Fyn Rat dibutyl phthalate multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in increased expression of FYN mRNA CTD PMID:25607892 Fyn Rat dieldrin increases activity EXP 6480464 Dieldrin results in increased activity of FYN protein CTD PMID:21801747 Fyn Rat dieldrin affects expression EXP 6480464 Dieldrin affects the expression of FYN mRNA CTD PMID:22546817 Fyn Rat dieldrin multiple interactions EXP 6480464 FYN protein promotes the reaction [Dieldrin promotes the reaction [CASP3 protein results in increased cleavage of and results in increased activity of PRKCD protein]] and FYN protein promotes the reaction [Dieldrin results in increased phosphorylation of PRKCD protein] CTD PMID:21801747 Fyn Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of FYN mRNA CTD PMID:25152437 Fyn Rat dorsomorphin multiple interactions ISO FYN (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Fyn Rat doxorubicin decreases expression ISO FYN (Homo sapiens) 6480464 Doxorubicin results in decreased expression of FYN mRNA CTD PMID:29803840 Fyn Rat enzacamene multiple interactions EXP 6480464 [bisphenol A co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with butylparaben] affects the expression of FYN mRNA CTD PMID:25607892 Fyn Rat epoxiconazole multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in increased expression of FYN mRNA CTD PMID:25607892 Fyn Rat ethanol increases phosphorylation ISO FYN (Homo sapiens) 6480464 Ethanol results in increased phosphorylation of FYN protein CTD PMID:18182400 Fyn Rat ethanol multiple interactions ISO Fyn (Mus musculus) 6480464 Ethanol affects the expression of and affects the splicing of FYN mRNA CTD PMID:30319688 Fyn Rat ethanol multiple interactions ISO FYN (Homo sapiens) 6480464 sodium arsenite promotes the reaction [Ethanol results in increased phosphorylation of FYN protein] CTD PMID:18182400 Fyn Rat etoposide affects response to substance ISO FYN (Homo sapiens) 6480464 FYN protein affects the susceptibility to Etoposide CTD PMID:16217747 Fyn Rat etoposide decreases expression ISO Fyn (Mus musculus) 6480464 Etoposide results in decreased expression of FYN mRNA CTD PMID:25270620 Fyn Rat folpet decreases expression ISO Fyn (Mus musculus) 6480464 folpet results in decreased expression of FYN mRNA CTD PMID:31558096 Fyn Rat FR900359 affects phosphorylation ISO FYN (Homo sapiens) 6480464 FR900359 affects the phosphorylation of FYN protein CTD PMID:37730182 Fyn Rat fulvestrant multiple interactions ISO FYN (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of FYN gene CTD PMID:31601247 Fyn Rat genistein multiple interactions EXP 6480464 [Diethylhexyl Phthalate co-treated with Genistein] results in increased expression of FYN mRNA CTD PMID:32533902 Fyn Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of FYN mRNA CTD PMID:22061828 and PMID:33387578 Fyn Rat glutathione multiple interactions ISO FYN (Homo sapiens) 6480464 Glutathione inhibits the reaction [bis(2-hydroxy-2-ethylbutanoato)oxochromate(V) results in increased phosphorylation of FYN protein] and Glutathione inhibits the reaction [Potassium Dichromate results in increased phosphorylation of FYN protein] CTD PMID:14572611 Fyn Rat haloperidol multiple interactions ISO Fyn (Mus musculus) 6480464 FYN gene mutant form inhibits the reaction [Haloperidol results in increased phosphorylation of GRIN2B protein] CTD PMID:16407246 Fyn Rat haloperidol increases phosphorylation ISO Fyn (Mus musculus) 6480464 Haloperidol results in increased phosphorylation of FYN protein CTD PMID:16407246 Fyn Rat haloperidol affects response to substance ISO Fyn (Mus musculus) 6480464 FYN protein affects the susceptibility to Haloperidol CTD PMID:16407246 Fyn Rat inulin multiple interactions ISO Fyn (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of FYN mRNA CTD PMID:36331819 Fyn Rat L-ascorbic acid multiple interactions ISO FYN (Homo sapiens) 6480464 Ascorbic Acid inhibits the reaction [bis(2-hydroxy-2-ethylbutanoato)oxochromate(V) results in increased phosphorylation of FYN protein] and Ascorbic Acid inhibits the reaction [Potassium Dichromate results in increased phosphorylation of FYN protein] CTD PMID:14572611 Fyn Rat lead diacetate multiple interactions EXP 6480464 FYN protein affects the reaction [lead acetate results in decreased expression of PDGFRA protein] CTD PMID:17298174 Fyn Rat lead diacetate increases activity EXP 6480464 lead acetate results in increased activity of FYN protein CTD PMID:17298174 Fyn Rat lead(0) multiple interactions EXP 6480464 FYN protein affects the reaction [Lead results in decreased expression of PDGFRA protein] CTD PMID:17298174 Fyn Rat lead(0) increases activity EXP 6480464 Lead results in increased activity of FYN protein CTD PMID:17298174 Fyn Rat linuron multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in increased expression of FYN mRNA CTD PMID:25607892 Fyn Rat lithium chloride multiple interactions EXP 6480464 Lithium Chloride inhibits the reaction [[1-Methyl-4-phenylpyridinium co-treated with puerarin] results in decreased phosphorylation of FYN protein] and Lithium Chloride inhibits the reaction [triptolide results in increased expression of FYN protein] CTD PMID:30926361 and PMID:32763437 Fyn Rat LY294002 multiple interactions ISO Fyn (Mus musculus) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [cobaltous chloride results in increased phosphorylation of FYN protein] CTD PMID:20850416 Fyn Rat methamphetamine increases expression ISO Fyn (Mus musculus) 6480464 Methamphetamine results in increased expression of FYN mRNA CTD PMID:26307267 Fyn Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of FYN mRNA CTD PMID:30047161 Fyn Rat methoxychlor decreases expression EXP 6480464 Methoxychlor results in decreased expression of FYN mRNA CTD PMID:21782745 Fyn Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of FYN gene CTD PMID:35440735 Fyn Rat methylmercury chloride decreases expression EXP 6480464 methylmercuric chloride results in decreased expression of FYN mRNA CTD PMID:28736149 Fyn Rat methylmercury chloride affects localization EXP 6480464 methylmercuric chloride affects the localization of FYN protein CTD PMID:28736149 Fyn Rat methylparaben increases expression ISO FYN (Homo sapiens) 6480464 methylparaben results in increased expression of FYN mRNA CTD PMID:31745603 Fyn Rat methylseleninic acid increases expression ISO FYN (Homo sapiens) 6480464 methylselenic acid results in increased expression of FYN mRNA CTD PMID:18548127 Fyn Rat mitomycin C affects response to substance ISO FYN (Homo sapiens) 6480464 FYN protein affects the susceptibility to Mitomycin CTD PMID:16217747 Fyn Rat mitoxantrone affects response to substance ISO FYN (Homo sapiens) 6480464 FYN protein affects the susceptibility to Mitoxantrone CTD PMID:16217747 Fyn Rat N(gamma)-nitro-L-arginine methyl ester multiple interactions EXP 6480464 NG-Nitroarginine Methyl Ester inhibits the reaction [Quinolinic Acid results in decreased activity of FYN protein] CTD PMID:17265464 Fyn Rat N-acetyl-L-cysteine multiple interactions ISO FYN (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [chromium hexavalent ion results in increased activity of FYN protein] CTD PMID:12902192 Fyn Rat N-acetyl-L-cysteine multiple interactions ISO Fyn (Mus musculus) 6480464 Acetylcysteine inhibits the reaction [cobaltous chloride results in increased phosphorylation of FYN protein] CTD PMID:20850416 Fyn Rat N-methyl-4-phenylpyridinium multiple interactions ISO Fyn (Mus musculus) 6480464 [1-Methyl-4-phenylpyridinium co-treated with puerarin] results in decreased phosphorylation of FYN protein CTD PMID:32763437 Fyn Rat N-methyl-4-phenylpyridinium multiple interactions EXP 6480464 [1-Methyl-4-phenylpyridinium co-treated with puerarin] results in decreased phosphorylation of FYN protein more ... CTD PMID:32763437 Fyn Rat N-methyl-D-aspartic acid multiple interactions ISO Fyn (Mus musculus) 6480464 N-Methylaspartate inhibits the reaction [gelsenicine results in increased phosphorylation of FYN protein] CTD PMID:34389372 Fyn Rat N-methyl-N'-nitro-N-nitrosoguanidine increases expression ISO FYN (Homo sapiens) 6480464 Methylnitronitrosoguanidine results in increased expression of FYN mRNA CTD PMID:12634122 Fyn Rat N-nitrosodimethylamine increases expression EXP 6480464 Dimethylnitrosamine results in increased expression of FYN mRNA CTD PMID:25380136 Fyn Rat N-Nitrosopyrrolidine decreases expression ISO FYN (Homo sapiens) 6480464 N-Nitrosopyrrolidine results in decreased expression of FYN mRNA CTD PMID:32234424 Fyn Rat nickel atom increases expression ISO FYN (Homo sapiens) 6480464 Nickel results in increased expression of FYN mRNA CTD PMID:24768652 and PMID:25583101 Fyn Rat nickel sulfate increases expression ISO FYN (Homo sapiens) 6480464 nickel sulfate results in increased expression of FYN mRNA CTD PMID:16780908 Fyn Rat nicotine multiple interactions ISO FYN (Homo sapiens) 6480464 LCK protein promotes the reaction [Nicotine results in increased phosphorylation of and results in increased activity of FYN protein] and Nicotine results in increased phosphorylation of and results in increased activity of FYN protein CTD PMID:17709503 Fyn Rat nitrates multiple interactions ISO Fyn (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of FYN mRNA CTD PMID:35964746 Fyn Rat O-methyleugenol decreases expression ISO FYN (Homo sapiens) 6480464 methyleugenol results in decreased expression of FYN mRNA CTD PMID:32234424 Fyn Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of FYN mRNA CTD PMID:25729387 Fyn Rat ozone multiple interactions ISO Fyn (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of FYN mRNA and [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of FYN mRNA CTD PMID:34911549 Fyn Rat paracetamol affects expression ISO Fyn (Mus musculus) 6480464 Acetaminophen affects the expression of FYN mRNA CTD PMID:17562736 Fyn Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of FYN mRNA CTD PMID:33387578 Fyn Rat paracetamol decreases expression ISO FYN (Homo sapiens) 6480464 Acetaminophen results in decreased expression of FYN mRNA CTD PMID:29067470 Fyn Rat paracetamol increases expression ISO FYN (Homo sapiens) 6480464 Acetaminophen results in increased expression of FYN mRNA CTD PMID:22230336 Fyn Rat paraquat multiple interactions EXP 6480464 FYN protein affects the reaction [Paraquat results in decreased expression of PDGFRA protein] CTD PMID:17298174 Fyn Rat paraquat affects expression EXP 6480464 Paraquat affects the expression of FYN mRNA CTD PMID:15206577 Fyn Rat paraquat increases activity EXP 6480464 Paraquat results in increased activity of FYN protein CTD PMID:17298174 Fyn Rat pentanal increases expression ISO FYN (Homo sapiens) 6480464 pentanal results in increased expression of FYN mRNA CTD PMID:26079696 Fyn Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Fyn (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of FYN mRNA CTD PMID:36331819 Fyn Rat phenobarbital multiple interactions ISO Fyn (Mus musculus) 6480464 NR1I3 protein affects the reaction [Phenobarbital results in decreased expression of FYN mRNA] CTD PMID:19482888 Fyn Rat phenobarbital decreases expression ISO Fyn (Mus musculus) 6480464 Phenobarbital results in decreased expression of FYN mRNA CTD PMID:19482888 Fyn Rat phenylarsine oxide affects localization ISO FYN (Homo sapiens) 6480464 oxophenylarsine affects the localization of FYN protein CTD PMID:9546377 Fyn Rat phorbol 13-acetate 12-myristate multiple interactions ISO Fyn (Mus musculus) 6480464 [Methylcholanthrene co-treated with Tetradecanoylphorbol Acetate] results in increased expression of FYN mRNA CTD PMID:23519560 Fyn Rat picoxystrobin decreases expression ISO FYN (Homo sapiens) 6480464 picoxystrobin results in decreased expression of FYN mRNA CTD PMID:33512557 Fyn Rat pinostrobin increases expression ISO FYN (Homo sapiens) 6480464 pinostrobin results in increased expression of FYN mRNA CTD PMID:37777166 Fyn Rat pirinixic acid multiple interactions ISO Fyn (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of FYN mRNA CTD PMID:19710929 Fyn Rat piroxicam decreases expression ISO FYN (Homo sapiens) 6480464 Piroxicam results in decreased expression of FYN mRNA CTD PMID:21858171 Fyn Rat ponatinib decreases activity ISO FYN (Homo sapiens) 6480464 ponatinib results in decreased activity of FYN protein CTD PMID:19878872 Fyn Rat potassium chromate decreases expression ISO FYN (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of FYN mRNA CTD PMID:22079256 Fyn Rat potassium chromate multiple interactions ISO FYN (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of FYN mRNA CTD PMID:22079256 Fyn Rat potassium dichromate increases phosphorylation ISO FYN (Homo sapiens) 6480464 Potassium Dichromate results in increased phosphorylation of FYN protein CTD PMID:14572611 Fyn Rat potassium dichromate multiple interactions ISO FYN (Homo sapiens) 6480464 AG 1879 inhibits the reaction [Potassium Dichromate results in increased phosphorylation of FYN protein] more ... CTD PMID:14572611 Fyn Rat prochloraz multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in increased expression of FYN mRNA CTD PMID:25607892 Fyn Rat procymidone multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in increased expression of FYN mRNA CTD PMID:25607892 Fyn Rat propanal increases expression ISO FYN (Homo sapiens) 6480464 propionaldehyde results in increased expression of FYN mRNA CTD PMID:26079696 Fyn Rat puerarin multiple interactions ISO Fyn (Mus musculus) 6480464 [1-Methyl-4-phenylpyridinium co-treated with puerarin] results in decreased phosphorylation of FYN protein CTD PMID:32763437 Fyn Rat puerarin multiple interactions EXP 6480464 [1-Methyl-4-phenylpyridinium co-treated with puerarin] results in decreased phosphorylation of FYN protein more ... CTD PMID:32763437 Fyn Rat quinolinic acid multiple interactions EXP 6480464 NG-Nitroarginine Methyl Ester inhibits the reaction [Quinolinic Acid results in decreased activity of FYN protein] CTD PMID:17265464 Fyn Rat quinolinic acid decreases activity EXP 6480464 Quinolinic Acid results in decreased activity of FYN protein CTD PMID:17265464 Fyn Rat resveratrol affects localization ISO FYN (Homo sapiens) 6480464 resveratrol affects the localization of FYN protein CTD PMID:21467134 Fyn Rat resveratrol multiple interactions ISO FYN (Homo sapiens) 6480464 resveratrol promotes the reaction [[ITGAV protein binds to ITGB3 protein] which affects the localization of FYN protein] CTD PMID:21467134 Fyn Rat rotenone decreases expression ISO FYN (Homo sapiens) 6480464 Rotenone results in decreased expression of FYN mRNA CTD PMID:33512557 Fyn Rat Salinomycin decreases expression ISO FYN (Homo sapiens) 6480464 salinomycin results in decreased expression of FYN mRNA CTD PMID:19682730 Fyn Rat SB 431542 multiple interactions ISO FYN (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Fyn Rat silicon dioxide multiple interactions ISO Fyn (Mus musculus) 6480464 MIR125A mRNA inhibits the reaction [Silicon Dioxide results in increased expression of FYN mRNA] CTD PMID:30658076 Fyn Rat silicon dioxide increases expression ISO Fyn (Mus musculus) 6480464 Silicon Dioxide results in increased expression of FYN mRNA CTD PMID:30658076 Fyn Rat silver atom multiple interactions ISO Fyn (Mus musculus) 6480464 Silver inhibits the reaction [GDNF protein results in increased activity of FYN protein] CTD PMID:20488942 Fyn Rat silver(0) multiple interactions ISO Fyn (Mus musculus) 6480464 Silver inhibits the reaction [GDNF protein results in increased activity of FYN protein] CTD PMID:20488942 Fyn Rat sodium arsenite increases expression ISO Fyn (Mus musculus) 6480464 sodium arsenite results in increased expression of FYN mRNA CTD PMID:16014739 Fyn Rat sodium arsenite decreases expression ISO FYN (Homo sapiens) 6480464 sodium arsenite results in decreased expression of FYN mRNA CTD PMID:29301061 and PMID:34032870 Fyn Rat sodium arsenite increases phosphorylation ISO Fyn (Mus musculus) 6480464 sodium arsenite results in increased phosphorylation of FYN protein CTD PMID:18407307 Fyn Rat sodium arsenite multiple interactions ISO FYN (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of FYN mRNA and sodium arsenite promotes the reaction [Ethanol results in increased phosphorylation of FYN protein] CTD PMID:18182400 and PMID:39836092 Fyn Rat sodium arsenite increases expression ISO FYN (Homo sapiens) 6480464 sodium arsenite results in increased expression of FYN mRNA CTD PMID:12016162 and PMID:38568856 Fyn Rat sodium dichromate decreases expression ISO Fyn (Mus musculus) 6480464 sodium bichromate results in decreased expression of FYN mRNA CTD PMID:31558096 Fyn Rat Soman increases expression EXP 6480464 Soman results in increased expression of FYN mRNA CTD PMID:19281266 Fyn Rat succimer multiple interactions ISO FYN (Homo sapiens) 6480464 [Succimer co-treated with Magnetite Nanoparticles] results in decreased expression of FYN mRNA CTD PMID:26378955 Fyn Rat sunitinib increases expression ISO FYN (Homo sapiens) 6480464 Sunitinib results in increased expression of FYN mRNA CTD PMID:31533062 Fyn Rat tamibarotene decreases expression ISO FYN (Homo sapiens) 6480464 tamibarotene results in decreased expression of FYN mRNA CTD PMID:15498508 Fyn Rat tebufenpyrad decreases expression ISO FYN (Homo sapiens) 6480464 4-chloro-N-((4-(1 and 1-dimethylethyl)phenyl)methyl)-3-ethyl-1-methyl-1H-pyrazole-5-carboxamide results in decreased expression of FYN mRNA CTD PMID:33512557 Fyn Rat testosterone multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of FYN mRNA CTD PMID:32741896 Fyn Rat thiram increases expression ISO FYN (Homo sapiens) 6480464 Thiram results in increased expression of FYN mRNA CTD PMID:38568856 Fyn Rat titanium dioxide multiple interactions ISO Fyn (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of FYN mRNA CTD PMID:29950665 Fyn Rat titanium dioxide decreases methylation ISO Fyn (Mus musculus) 6480464 titanium dioxide results in decreased methylation of FYN gene and titanium dioxide results in decreased methylation of FYN promoter CTD PMID:35295148 Fyn Rat tolonium chloride decreases expression ISO Fyn (Mus musculus) 6480464 Tolonium Chloride results in decreased expression of FYN protein CTD PMID:36027949 Fyn Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of FYN mRNA CTD PMID:25729387 Fyn Rat tremolite asbestos decreases expression ISO Fyn (Mus musculus) 6480464 tremolite results in decreased expression of FYN mRNA CTD PMID:29279043 Fyn Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of FYN mRNA CTD PMID:33387578 Fyn Rat trichostatin A increases expression ISO FYN (Homo sapiens) 6480464 trichostatin A results in increased expression of FYN mRNA CTD PMID:24935251 and PMID:26272509 Fyn Rat trichostatin A affects expression ISO FYN (Homo sapiens) 6480464 trichostatin A affects the expression of FYN mRNA CTD PMID:28542535 Fyn Rat trichostatin A multiple interactions ISO FYN (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of FYN mRNA CTD PMID:27188386 Fyn Rat triphenyl phosphate affects expression ISO FYN (Homo sapiens) 6480464 triphenyl phosphate affects the expression of FYN mRNA CTD PMID:37042841 Fyn Rat Triptolide multiple interactions EXP 6480464 Lithium Chloride inhibits the reaction [triptolide results in increased expression of FYN protein] CTD PMID:30926361 Fyn Rat Triptolide increases expression EXP 6480464 triptolide results in increased expression of FYN protein CTD PMID:30926361 Fyn Rat triptonide affects expression ISO Fyn (Mus musculus) 6480464 triptonide affects the expression of FYN mRNA CTD PMID:33045310 Fyn Rat urethane increases expression ISO FYN (Homo sapiens) 6480464 Urethane results in increased expression of FYN mRNA CTD PMID:28818685 Fyn Rat valproic acid affects expression ISO Fyn (Mus musculus) 6480464 Valproic Acid affects the expression of FYN mRNA CTD PMID:17292431 Fyn Rat valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of FYN mRNA CTD PMID:33150595 Fyn Rat valproic acid increases methylation EXP 6480464 Valproic Acid results in increased methylation of FYN promoter CTD PMID:33150595 Fyn Rat valproic acid decreases palmitoylation ISO Fyn (Mus musculus) 6480464 Valproic Acid results in decreased palmitoylation of FYN protein CTD PMID:26348896 Fyn Rat valproic acid increases expression ISO FYN (Homo sapiens) 6480464 Valproic Acid results in increased expression of FYN mRNA CTD PMID:23179753 more ... Fyn Rat valproic acid multiple interactions ISO FYN (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of FYN mRNA CTD PMID:27188386 Fyn Rat valproic acid increases methylation ISO FYN (Homo sapiens) 6480464 Valproic Acid results in increased methylation of FYN gene CTD PMID:29154799 Fyn Rat vinclozolin multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in increased expression of FYN mRNA CTD PMID:25607892 Fyn Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of FYN mRNA CTD PMID:19015723 and PMID:23034163
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(-)-epigallocatechin 3-gallate (ISO) (R,R,R)-alpha-tocopherol (ISO) (S)-nicotine (ISO) 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO) 17beta-estradiol (EXP,ISO) 17beta-estradiol 3-benzoate (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-arachidonoylglycerol (EXP) 2-methylcholine (ISO) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3-methylcholanthrene (ISO) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (EXP,ISO) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) 5-azacytidine (ISO) 5-fluorouracil (ISO) acetamide (EXP) acrolein (EXP) aflatoxin B1 (ISO) alachlor (EXP) all-trans-retinoic acid (ISO) amitrole (EXP) ammonium chloride (EXP) amphetamine (EXP) antigen (ISO) antimycin A (ISO) arsane (ISO) arsenic atom (ISO) Azoxymethane (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bisphenol F (EXP) butanal (ISO) Butylparaben (EXP) caffeine (ISO) calcium dichloride (ISO) captan (ISO) carmustine (ISO) CGP 52608 (ISO) chlorpyrifos (ISO) chromium(6+) (ISO) cisplatin (ISO) cobalt dichloride (EXP,ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) cyclophosphamide (ISO) cyclosporin A (ISO) cytarabine (ISO) D-gluconic acid (EXP) DDE (EXP,ISO) deguelin (ISO) dexamethasone (EXP) dextran sulfate (ISO) diazinon (EXP,ISO) dibutyl phthalate (EXP) dieldrin (EXP) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) enzacamene (EXP) epoxiconazole (EXP) ethanol (ISO) etoposide (ISO) folpet (ISO) FR900359 (ISO) fulvestrant (ISO) genistein (EXP) gentamycin (EXP) glutathione (ISO) haloperidol (ISO) inulin (ISO) L-ascorbic acid (ISO) lead diacetate (EXP) lead(0) (EXP) linuron (EXP) lithium chloride (EXP) LY294002 (ISO) methamphetamine (ISO) methimazole (EXP) methoxychlor (EXP) methylmercury chloride (EXP) methylparaben (ISO) methylseleninic acid (ISO) mitomycin C (ISO) mitoxantrone (ISO) N(gamma)-nitro-L-arginine methyl ester (EXP) N-acetyl-L-cysteine (ISO) N-methyl-4-phenylpyridinium (EXP,ISO) N-methyl-D-aspartic acid (ISO) N-methyl-N'-nitro-N-nitrosoguanidine (ISO) N-nitrosodimethylamine (EXP) N-Nitrosopyrrolidine (ISO) nickel atom (ISO) nickel sulfate (ISO) nicotine (ISO) nitrates (ISO) O-methyleugenol (ISO) oxaliplatin (EXP) ozone (ISO) paracetamol (EXP,ISO) paraquat (EXP) pentanal (ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) phenylarsine oxide (ISO) phorbol 13-acetate 12-myristate (ISO) picoxystrobin (ISO) pinostrobin (ISO) pirinixic acid (ISO) piroxicam (ISO) ponatinib (ISO) potassium chromate (ISO) potassium dichromate (ISO) prochloraz (EXP) procymidone (EXP) propanal (ISO) puerarin (EXP,ISO) quinolinic acid (EXP) resveratrol (ISO) rotenone (ISO) Salinomycin (ISO) SB 431542 (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) sodium dichromate (ISO) Soman (EXP) succimer (ISO) sunitinib (ISO) tamibarotene (ISO) tebufenpyrad (ISO) testosterone (EXP) thiram (ISO) titanium dioxide (ISO) tolonium chloride (ISO) topotecan (EXP) tremolite asbestos (ISO) trichloroethene (EXP) trichostatin A (ISO) triphenyl phosphate (ISO) Triptolide (EXP) triptonide (ISO) urethane (ISO) valproic acid (EXP,ISO) vinclozolin (EXP)
Biological Process
activated T cell proliferation (IEA,ISO) cell differentiation (IBA) cell surface receptor protein tyrosine kinase signaling pathway (IBA) cell surface receptor signaling pathway (IEA,ISO) cellular response to amyloid-beta (IEA,ISO) cellular response to glycine (IMP) cellular response to growth factor stimulus (IEP) cellular response to hydrogen peroxide (IDA) cellular response to L-glutamate (IMP) cellular response to peptide hormone stimulus (IEP) cellular response to platelet-derived growth factor stimulus (IEA,ISO) cellular response to transforming growth factor beta stimulus (IEA,ISO) dendrite morphogenesis (IEA,ISO) detection of mechanical stimulus involved in sensory perception of pain (IEA,ISO) forebrain development (IEA,ISO) G protein-coupled glutamate receptor signaling pathway (IEA,ISO) gene expression (IEA,ISO) heart process (IEA,ISO) intracellular signal transduction (IEA,IMP,ISO) ionotropic glutamate receptor signaling pathway (TAS) modulation of chemical synaptic transmission (IEA,ISO) natural killer cell activation (IEA,ISO) negative regulation of angiogenesis (IEA,ISO) negative regulation of dendritic spine maintenance (IEA,ISO) negative regulation of extrinsic apoptotic signaling pathway in absence of ligand (IMP) negative regulation of gene expression (IEA,ISO) negative regulation of hydrogen peroxide biosynthetic process (IMP) negative regulation of neuron apoptotic process (IMP) negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway (IMP) negative regulation of protein catabolic process (IEA,ISO) negative regulation of protein ubiquitination (IEA,ISO) neuron migration (IEA,ISO) neuron projection development (IEA,ISO) peptidyl-tyrosine phosphorylation (IDA,IMP,ISO) positive regulation of neuron projection development (IEA,ISO) positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction (IMP) positive regulation of protein localization to nucleus (IEA,ISO) positive regulation of protein targeting to membrane (IEA,ISO) positive regulation of tyrosine phosphorylation of STAT protein (ISO) protein autophosphorylation (IDA,ISO) protein catabolic process (IEA,ISO) protein phosphorylation (ISO) protein ubiquitination (IEA,ISO) reelin-mediated signaling pathway (IEA,ISO,ISS) regulation of calcium ion import across plasma membrane (IEA,ISO) regulation of cell shape (IEA,ISO) regulation of glutamate receptor signaling pathway (IEA,ISO) response to amyloid-beta (IEA,ISO) response to cocaine (IEP) response to ethanol (IEA,ISO) response to singlet oxygen (IDA) response to xenobiotic stimulus (IEP) T cell receptor signaling pathway (IBA,IEA,ISO)
Cellular Component
actin filament (IEA,ISO) cell body (IEA,ISO) cell periphery (IEA,ISO) cytoplasm (IEA) cytosol (IEA,ISO,TAS) dendrite (IDA,IEA,ISO) endosome (IEA,ISO) glial cell projection (IEA,ISO) glutamatergic synapse (IDA,IEP) membrane (IEA) membrane raft (IEA,ISO) mitochondrion (IDA) nucleus (IDA,IEA) perikaryon (IEA) perinuclear endoplasmic reticulum (IDA) perinuclear region of cytoplasm (IDA) plasma membrane (IBA,IEA,ISO,TAS) postsynaptic density (IDA,IEA,ISO) postsynaptic density, intracellular component (IDA,IEP) Schaffer collateral - CA1 synapse (IEA,ISO)
Molecular Function
alpha-tubulin binding (IEA,ISO) ATP binding (IEA) CD4 receptor binding (IPI) CD8 receptor binding (IPI) disordered domain specific binding (IEA,ISO) enzyme binding (IEA,IPI,ISO) ephrin receptor binding (IEA,ISO) G protein-coupled receptor binding (IEA,ISO) growth factor receptor binding (IEA,ISO) identical protein binding (IEA,ISO) kinase activity (IEA) metal ion binding (IEA) non-membrane spanning protein tyrosine kinase activity (IBA,IEA,ISO) nucleotide binding (IEA) peptide hormone receptor binding (IPI) phosphatidylinositol 3-kinase binding (IDA) phospholipase activator activity (IEA,ISO) phospholipase binding (IEA,ISO) protein binding (IPI,ISO) protein kinase activity (IDA,IEA,ISO) protein tyrosine kinase activity (IDA,IEA,IMP,ISO,TAS) protein-containing complex binding (IPI) scaffold protein binding (IEA,ISO) signaling receptor binding (IBA,IPI) T cell receptor binding (IDA) tau protein binding (IEA,ISO) transferase activity (IEA) transmembrane transporter binding (IEA,ISO) tubulin binding (IEA,ISO) type 5 metabotropic glutamate receptor binding (IPI)
1.
Prolactin induced tyrosine phosphorylation of p59fyn may mediate phosphatidylinositol 3-kinase activation in Nb2 cells.
al-Sakkaf KA, etal., J Mol Endocrinol. 1997 Dec;19(3):347-50.
2.
Association of Src-like protein tyrosine kinases with the CD2 cell surface molecule in rat T lymphocytes and natural killer cells.
Bell GM, etal., Mol Cell Biol. 1992 Dec;12(12):5548-54.
3.
Molecular associations between the T-lymphocyte antigen receptor complex and the surface antigens CD2, CD4, or CD8 and CD5.
Beyers AD, etal., Proc Natl Acad Sci U S A. 1992 Apr 1;89(7):2945-9.
4.
Phosphatidylinositol 3-kinase interacts with the adaptor protein Dab1 in response to Reelin signaling and is required for normal cortical lamination.
Bock HH, etal., J Biol Chem 2003 Oct 3;278(40):38772-9. Epub 2003 Jul 25.
5.
Physical association of the cytoplasmic domain of CD2 with the tyrosine kinases p56lck and p59fyn.
Carmo AM, etal., Eur J Immunol. 1993 Sep;23(9):2196-201.
6.
Tyrosine kinase and tyrosine phosphatase participate in regulation of interactions of NMDA receptor subunit 2A with Src and Fyn mediated by PSD-95 after transient brain ischemia.
Chen M, etal., Neurosci Lett. 2003 Mar 13;339(1):29-32.
7.
Activation of RBL-2H3 mast cells is dependent on tyrosine phosphorylation of phospholipase D2 by Fyn and Fgr.
Choi WS, etal., Mol Cell Biol 2004 Aug;24(16):6980-92.
8.
Prostaglandin E2 modulation of p59fyn tyrosine kinase in T lymphocytes during sepsis.
Choudhry MA, etal., J Immunol. 1998 Jan 15;160(2):929-35.
9.
TGF-beta abrogates TCR-mediated signaling by upregulating tyrosine phosphatases in T cells.
Choudhry MA, etal., Shock. 2001 Mar;15(3):193-9.
10.
Role of NFAT and AP-1 in PGE2-mediated T cell suppression in burn injury.
Choudhry MA, etal., Shock. 2002 Sep;18(3):212-6.
11.
Identification of a novel protein complex containing annexin VI, Fyn, Pyk2, and the p120(GAP) C2 domain.
Chow A, etal., FEBS Lett. 2000 Mar 3;469(1):88-92.
12.
The protein tyrosine kinase P59fyn is associated with prolactin (PRL) receptor and is activated by PRL stimulation of T-lymphocytes.
Clevenger CV and Medaglia MV, Mol Endocrinol. 1994 Jun;8(6):674-81.
13.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
14.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
15.
Impaired long-term potentiation, spatial learning, and hippocampal development in fyn mutant mice.
Grant SG, etal., Science 1992 Dec 18;258(5090):1903-10.
16.
Altered p59Fyn kinase expression accompanies disease progression in Alzheimer's disease: implications for its functional role.
Ho GJ, etal., Neurobiol Aging 2005 May;26(5):625-35.
17.
Vascular endothelial growth factor receptor-2: structure, function, intracellular signalling and therapeutic inhibition.
Holmes K, etal., Cell Signal. 2007 Oct;19(10):2003-12. Epub 2007 Jun 12.
18.
Activation of NMDA receptors and L-type voltage-gated calcium channels mediates enhanced formation of Fyn-PSD95-NR2A complex after transient brain ischemia.
Hou XY, etal., Brain Res 2002 Nov 15;955(1-2):123-32.
19.
Effects of pentoxyfylline on mesenteric lymph node T-cells in a rat model of thermal injury.
Kotadia BK, etal., Shock. 2003 Dec;20(6):517-20.
20.
Phosphorylation of tau by fyn: implications for Alzheimer's disease.
Lee G, etal., J Neurosci 2004 Mar 3;24(9):2304-12.
21.
The Src-Kinase Fyn is Required for Cocaine-Associated Memory Through Regulation of Tau.
Li H, etal., Front Pharmacol. 2022 Feb 3;13:769827. doi: 10.3389/fphar.2022.769827. eCollection 2022.
22.
Tyrosine kinase FYN negatively regulates NOX4 in cardiac remodeling.
Matsushima S, etal., J Clin Invest. 2016 Sep 1;126(9):3403-16. doi: 10.1172/JCI85624. Epub 2016 Aug 15.
23.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
24.
Thy-1 molecule associates with protein tyrosine kinase(s) in rat mesangial cells.
Narisawa-Saito M, etal., Clin Exp Immunol. 1996 Oct;106(1):86-90.
25.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
26.
Phosphorylation of c-Cbl protooncogene product following ethanol administration in rat cerebellum: possible involvement of Fyn kinase.
Nishio H, etal., Brain Res 2002 Sep 20;950(1-2):203-9.
27.
Expression of Fyn, a non-receptor tyrosine kinase in prefrontal cortex from patients with schizophrenia and its correlation with clinical onset.
Ohnuma T, etal., Brain Res Mol Brain Res 2003 Apr 10;112(1-2):90-4.
28.
CSK: a protein-tyrosine kinase involved in regulation of src family kinases.
Okada M, etal., J Biol Chem. 1991 Dec 25;266(36):24249-52.
29.
Online Mendelian Inheritance in Man, OMIM (TM).
Online Mendelian Inheritance in Man, OMIM (TM).
30.
Genetic association between -93A/G polymorphism in the Fyn kinase gene and alcohol dependence in Spanish men.
Pastor IJ, etal., Eur Psychiatry. 2009 Apr;24(3):191-4. doi: 10.1016/j.eurpsy.2008.08.007. Epub 2008 Oct 11.
31.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
32.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
33.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
34.
PKC-interacting proteins: from function to pharmacology.
Poole AW, etal., Trends Pharmacol Sci. 2004 Oct;25(10):528-35.
35.
GOA pipeline
RGD automated data pipeline
36.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
37.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
38.
Characterization and location of Src-dependent tyrosine phosphorylation in rat brain mitochondria.
Salvi M, etal., Biochim Biophys Acta 2002 Apr 3;1589(2):181-95.
39.
Opioid addiction and pregnancy: perinatal exposure to buprenorphine affects myelination in the developing brain.
Sanchez ES, etal., Glia. 2008 Jul;56(9):1017-27. doi: 10.1002/glia.20675.
40.
Analysis of genetic variations of protein tyrosine kinase fyn and their association with alcohol dependence in two independent cohorts.
Schumann G, etal., Biol Psychiatry. 2003 Dec 15;54(12):1422-6. doi: 10.1016/s0006-3223(03)00635-8.
41.
Src-protein tyrosine kinases are required for cocaine-induced increase in the expression and function of the NMDA receptor in the ventral tegmental area.
Schumann J, etal., J Neurochem. 2009 Feb;108(3):697-706. doi: 10.1111/j.1471-4159.2008.05794.x. Epub 2008 Nov 27.
42.
Caveolin-1 facilitates mechanosensitive protein kinase B (Akt) signaling in vitro and in vivo.
Sedding DG, etal., Circ Res. 2005 Apr 1;96(6):635-42. Epub 2005 Feb 24.
43.
A unique role for Fyn in CNS myelination.
Sperber BR, etal., J Neurosci 2001 Mar 15;21(6):2039-47.
44.
Netrin-1 mediates neuronal survival through PIKE-L interaction with the dependence receptor UNC5B.
Tang X, etal., Nat Cell Biol. 2008 Jun;10(6):698-706. doi: 10.1038/ncb1732. Epub 2008 May 11.
45.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
46.
Reelin and brain development.
Tissir F and Goffinet AM, Nat Rev Neurosci. 2003 Jun;4(6):496-505.
47.
Alzheimer amyloid-ß oligomer bound to postsynaptic prion protein activates Fyn to impair neurons.
Um JW, etal., Nat Neurosci. 2012 Sep;15(9):1227-35. doi: 10.1038/nn.3178. Epub 2012 Jul 22.
48.
Metabotropic glutamate receptor 5 is a coreceptor for Alzheimer abeta oligomer bound to cellular prion protein.
Um JW, etal., Neuron. 2013 Sep 4;79(5):887-902. doi: 10.1016/j.neuron.2013.06.036.
49.
PSD-95 stabilizes NMDA receptors by inducing the degradation of STEP61.
Won S, etal., Proc Natl Acad Sci U S A. 2016 Aug 9;113(32):E4736-44. doi: 10.1073/pnas.1609702113. Epub 2016 Jul 25.
50.
Fyn-mediated phosphorylation of NR2B Tyr-1336 controls calpain-mediated NR2B cleavage in neurons and heterologous systems.
Wu HY, etal., J Biol Chem. 2007 Jul 13;282(28):20075-87. doi: 10.1074/jbc.M700624200. Epub 2007 May 25.
51.
Kainate-induced seizures alter protein composition and N-methyl-D-aspartate receptor function of rat forebrain postsynaptic densities.
Wyneken U, etal., Neuroscience. 2001;102(1):65-74.
52.
A role for Fyn tyrosine kinase in the suckling behaviour of neonatal mice.
Yagi T, etal., Nature 1993 Dec 23-30;366(6457):742-5.
53.
Pituitary adenylate cyclase-activating polypeptide (PACAP(1-38)) enhances N-methyl-D-aspartate receptor function and brain-derived neurotrophic factor expression via RACK1.
Yaka R, etal., J Biol Chem 2003 Mar 14;278(11):9630-8.
54.
Scaffolding of Fyn kinase to the NMDA receptor determines brain region sensitivity to ethanol.
Yaka R, etal., J Neurosci 2003 May 1;23(9):3623-32.
55.
NMDA receptor function is regulated by the inhibitory scaffolding protein, RACK1.
Yaka R, etal., Proc Natl Acad Sci U S A 2002 Apr 16;99(8):5710-5. Epub 2002 Apr 9.
56.
Src-dependent phosphorylation of μ-opioid receptor at Tyr336 modulates opiate withdrawal.
Zhang L, etal., EMBO Mol Med. 2017 Nov;9(11):1521-1536. doi: 10.15252/emmm.201607324.
Fyn Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 44,322,635 - 44,514,498 (+) NCBI GRCr8 mRatBN7.2 20 42,767,733 - 42,960,903 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 42,766,369 - 42,959,911 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 44,517,354 - 44,708,655 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 44,176,580 - 44,367,880 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 44,909,156 - 45,110,016 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 44,436,354 - 44,630,316 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 44,436,403 - 44,630,317 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 46,160,734 - 46,353,456 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 43,501,853 - 43,695,567 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 43,524,863 - 43,718,578 (+) NCBI Celera 20 43,482,980 - 43,675,123 (+) NCBI Celera Cytogenetic Map 20 q12 NCBI
FYN Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 111,660,332 - 111,873,452 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 111,660,332 - 111,873,452 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 111,981,535 - 112,194,655 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 112,089,178 - 112,301,320 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 112,089,179 - 112,186,978 NCBI Celera 6 112,729,071 - 112,941,209 (-) NCBI Celera Cytogenetic Map 6 q21 NCBI HuRef 6 109,554,123 - 109,767,060 (-) NCBI HuRef CHM1_1 6 112,244,349 - 112,457,405 (-) NCBI CHM1_1 T2T-CHM13v2.0 6 112,843,350 - 113,056,537 (-) NCBI T2T-CHM13v2.0
Fyn Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 39,245,735 - 39,441,377 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 39,244,851 - 39,441,377 (+) Ensembl GRCm39 Ensembl GRCm38 10 39,369,743 - 39,565,381 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 39,368,855 - 39,565,381 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 39,089,605 - 39,285,187 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 39,059,502 - 39,254,797 (+) NCBI MGSCv36 mm8 Celera 10 40,254,667 - 40,450,960 (+) NCBI Celera Cytogenetic Map 10 B1 NCBI cM Map 10 20.51 NCBI
Fyn Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955411 36,401,842 - 36,512,054 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955411 36,403,156 - 36,597,660 (-) NCBI ChiLan1.0 ChiLan1.0
FYN Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 131,675,357 - 131,889,692 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 129,561,361 - 129,775,652 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 109,469,750 - 109,684,086 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 113,545,944 - 113,732,893 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 113,545,944 - 113,604,451 (-) Ensembl panpan1.1 panPan2
FYN Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 12 68,105,060 - 68,316,630 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 12 68,075,184 - 68,316,541 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 12 67,924,675 - 68,136,151 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 12 68,986,784 - 69,198,525 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 12 68,987,778 - 69,174,188 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 12 68,338,226 - 68,549,311 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 12 68,184,783 - 68,396,306 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 12 68,510,644 - 68,722,405 (-) NCBI UU_Cfam_GSD_1.0
Fyn
FYN Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 77,585,439 - 77,810,581 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 77,584,675 - 77,810,605 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 87,249,062 - 87,253,260 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3 Sscrofa10.2 1 87,146,809 - 87,191,215 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3 Pig Cytomap 1 p13 NCBI
FYN Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 13 61,988,265 - 62,218,756 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 13 62,159,874 - 62,219,672 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666040 34,319,593 - 34,528,593 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Fyn
.
Predicted Target Of
Count of predictions: 98 Count of miRNA genes: 81 Interacting mature miRNAs: 87 Transcripts: ENSRNOT00000000733 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
4889610 Pancm3 Pancreatic morphology QTL 3 3.75 0.001 pancreas mass (VT:0010144) pancreas wet weight (CMO:0000626) 20 17617832 47606836 Rat 2303587 Bw93 Body weight QTL 93 13 body mass (VT:0001259) body weight (CMO:0000012) 20 25106722 54435887 Rat 1641915 Colcr9 Colorectal carcinoma resistance QTL 9 2.97 0.0024 intestine integrity trait (VT:0010554) benign colorectal tumor number (CMO:0001795) 20 1530655 46530655 Rat 2305926 Iddm37 Insulin dependent diabetes mellitus QTL 37 6 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 20 1527842 46527842 Rat 2303626 Vencon10 Ventilatory control QTL 10 0.001 respiration trait (VT:0001943) respiration rate (CMO:0000289) 20 19190721 54435887 Rat 1598869 Memor6 Memory QTL 6 3.1 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 20 29244388 54435887 Rat 70158 Bp60 Blood pressure QTL 60 3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 20 31614284 44396023 Rat 7411652 Foco24 Food consumption QTL 24 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 11757515 54435887 Rat 1331747 Hrtrt16 Heart rate QTL 16 3.163 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 20 25209734 54435887 Rat 1598816 Memor12 Memory QTL 12 2.4 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 20 2606836 47606836 Rat 2303578 Gluco50 Glucose level QTL 50 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 20 25106722 54435887 Rat 2317880 Alcrsp25 Alcohol response QTL 25 2.3 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 20 17697550 54435887 Rat 9590092 Insglur9 Insulin/glucose ratio QTL 9 18.38 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 20 11757515 54435887 Rat 2300188 Bmd68 Bone mineral density QTL 68 6.4 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 20 25106722 54435887 Rat
D20Rat55
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 20 42,886,819 - 42,887,012 (+) MAPPER mRatBN7.2 Rnor_6.0 20 44,555,562 - 44,555,754 NCBI Rnor6.0 Rnor_5.0 20 46,279,994 - 46,280,186 UniSTS Rnor5.0 RGSC_v3.4 20 43,622,153 - 43,622,346 RGD RGSC3.4 RGSC_v3.4 20 43,622,154 - 43,622,346 UniSTS RGSC3.4 RGSC_v3.1 20 43,645,165 - 43,645,357 RGD Celera 20 43,601,937 - 43,602,129 UniSTS RH 3.4 Map 20 456.5 RGD RH 3.4 Map 20 456.5 UniSTS RH 2.0 Map 20 505.7 RGD SHRSP x BN Map 20 34.4 RGD Cytogenetic Map 20 q13 UniSTS
RH137616
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 20 42,953,267 - 42,953,470 (+) MAPPER mRatBN7.2 Rnor_6.0 20 44,622,917 - 44,623,119 NCBI Rnor6.0 Rnor_5.0 20 46,346,156 - 46,346,358 UniSTS Rnor5.0 RGSC_v3.4 20 43,690,007 - 43,690,209 UniSTS RGSC3.4 Celera 20 43,668,270 - 43,668,472 UniSTS Cytogenetic Map 20 q13 UniSTS
BE113818
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 20 42,929,193 - 42,929,354 (+) MAPPER mRatBN7.2 Rnor_6.0 20 44,599,140 - 44,599,300 NCBI Rnor6.0 Rnor_5.0 20 46,322,955 - 46,323,115 UniSTS Rnor5.0 RGSC_v3.4 20 43,665,213 - 43,665,373 UniSTS RGSC3.4 RH 3.4 Map 20 464.21 UniSTS Cytogenetic Map 20 q13 UniSTS
BF405827
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 20 42,813,674 - 42,813,840 (+) MAPPER mRatBN7.2 Rnor_6.0 20 44,482,223 - 44,482,388 NCBI Rnor6.0 Rnor_5.0 20 46,206,603 - 46,206,768 UniSTS Rnor5.0 RGSC_v3.4 20 43,547,466 - 43,547,631 UniSTS RGSC3.4 Celera 20 43,528,623 - 43,528,788 UniSTS RH 3.4 Map 20 452.8 UniSTS Cytogenetic Map 20 q13 UniSTS
FYN_1578
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 20 42,959,298 - 42,959,937 (+) MAPPER mRatBN7.2 Rnor_6.0 20 44,628,711 - 44,629,349 NCBI Rnor6.0 Rnor_5.0 20 46,351,851 - 46,352,489 UniSTS Rnor5.0 RGSC_v3.4 20 43,695,391 - 43,696,029 UniSTS RGSC3.4 Celera 20 43,674,947 - 43,675,585 UniSTS Cytogenetic Map 20 q13 UniSTS
This gene Fyn is modified in the following models/strains:
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000000733 ⟹ ENSRNOP00000000733
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 42,792,180 - 42,959,911 (+) Ensembl Rnor_6.0 Ensembl 20 44,436,403 - 44,630,317 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000075922 ⟹ ENSRNOP00000068462
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 42,910,988 - 42,959,475 (+) Ensembl Rnor_6.0 Ensembl 20 44,580,632 - 44,596,045 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000076859 ⟹ ENSRNOP00000068458
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 42,792,180 - 42,959,833 (+) Ensembl Rnor_6.0 Ensembl 20 44,436,408 - 44,629,323 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000085987 ⟹ ENSRNOP00000072210
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 42,792,180 - 42,959,911 (+) Ensembl Rnor_6.0 Ensembl 20 44,521,279 - 44,630,294 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000118910 ⟹ ENSRNOP00000088889
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 42,766,369 - 42,959,911 (+) Ensembl
RefSeq Acc Id:
NM_012755 ⟹ NP_036887
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 44,322,664 - 44,514,062 (+) NCBI mRatBN7.2 20 42,768,059 - 42,959,475 (+) NCBI Rnor_6.0 20 44,436,680 - 44,628,887 (+) NCBI Rnor_5.0 20 46,160,734 - 46,353,456 (+) NCBI RGSC_v3.4 20 43,501,853 - 43,695,567 (+) RGD Celera 20 43,482,980 - 43,675,123 (+) RGD
Sequence:
GAGCTCCTGGGCCCGGCCGCGGACCACCGGAGCCGCCAGGGCCTCGCCGGAGGAGGGCGGGGAGAGGACCATGTGAATGTGCTCCGGAACCGAGCGCCACGCCACGCAGTGTTTGAAAGGAACACAAT
hide sequence
RefSeq Acc Id:
XM_006256522 ⟹ XP_006256584
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 44,322,635 - 44,514,498 (+) NCBI mRatBN7.2 20 42,767,733 - 42,960,903 (+) NCBI Rnor_6.0 20 44,436,354 - 44,630,316 (+) NCBI Rnor_5.0 20 46,160,734 - 46,353,456 (+) NCBI
Sequence:
CCCTCTCGAACCCCTCGGGATCCGGAGCAGCCCGAGCATCAGCGAGAGTAGCTGCGAGAAGCCG
hide sequence
RefSeq Acc Id:
XM_017601549 ⟹ XP_017457038
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 44,322,635 - 44,514,498 (+) NCBI mRatBN7.2 20 42,767,733 - 42,960,903 (+) NCBI Rnor_6.0 20 44,577,312 - 44,630,316 (+) NCBI
Sequence:
GAGCTTGGATAATGGGCTGTGTGCAATGTAAGGATAAAGAAGCAGCGAAACTGACGGAGGAGAG
hide sequence
RefSeq Acc Id:
XM_039098436 ⟹ XP_038954364
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 44,322,675 - 44,514,498 (+) NCBI mRatBN7.2 20 42,767,733 - 42,960,903 (+) NCBI
RefSeq Acc Id:
NP_036887 ⟸ NM_012755
- UniProtKB:
Q62844 (UniProtKB/Swiss-Prot), A0A096MKC1 (UniProtKB/TrEMBL)
- Sequence:
MGCVQCKDKEAAKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQGLTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWWEARSLTTG
hide sequence
RefSeq Acc Id:
XP_006256584 ⟸ XM_006256522
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6A612 (UniProtKB/TrEMBL), A0A096MKC1 (UniProtKB/TrEMBL)
- Sequence:
MCSGTERHATQGQSYCWFRRHVVYITFVIVGGNLGAWIMGCVQCKDKEAAKLTEERDGSLNQSS
hide sequence
RefSeq Acc Id:
XP_017457038 ⟸ XM_017601549
- Peptide Label:
isoform X2
- UniProtKB:
A0A096MKC1 (UniProtKB/TrEMBL)
- Sequence:
MGCVQCKDKEAAKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQGLTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWWEARSLTTG
hide sequence
Ensembl Acc Id:
ENSRNOP00000000733 ⟸ ENSRNOT00000000733
Ensembl Acc Id:
ENSRNOP00000068462 ⟸ ENSRNOT00000075922
Ensembl Acc Id:
ENSRNOP00000072210 ⟸ ENSRNOT00000085987
Ensembl Acc Id:
ENSRNOP00000068458 ⟸ ENSRNOT00000076859
RefSeq Acc Id:
XP_038954364 ⟸ XM_039098436
- Peptide Label:
isoform X3
- UniProtKB:
Q62844 (UniProtKB/Swiss-Prot), A0A096MKC1 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000088889 ⟸ ENSRNOT00000118910
RGD ID: 13701650 Promoter ID: EPDNEW_R12174 Type: initiation region Name: Fyn_1 Description: FYN proto-oncogene, Src family tyrosine kinase SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 20 44,436,397 - 44,436,457 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-09-18
Fyn
FYN oncogene related to SRC, FGR, YES
Fyn
fyn proto-oncogene
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Fyn
Fyn proto-oncogene
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_physical_interaction
coexpressed with and binds to Cbl protein in the cerebellum
632732
