Symbol:
Fmo1
Name:
flavin containing dimethylaniline monoxygenase 1
RGD ID:
2622
Description:
Enables N,N-dimethylaniline monooxygenase activity and trimethylamine monooxygenase activity. Involved in response to lipopolysaccharide. Predicted to be located in endoplasmic reticulum membrane. Orthologous to human FMO1 (flavin containing dimethylaniline monoxygenase 1); PARTICIPATES IN tamoxifen pharmacodynamics pathway; tamoxifen pharmacokinetics pathway; phase I biotransformation pathway via cytochrome P450; INTERACTS WITH (+)-schisandrin B; (R,R,R)-alpha-tocopherol; 1-naphthyl isothiocyanate.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
dimethylaniline monooxygenase [N-oxide-forming] 1; dimethylaniline oxidase 1; flavin containing monooxygenase 1; Flavin-containing monooxygenase 1; FMO 1; hepatic flavin-containing monooxygenase 1; RFMO1A; trimethylamine monooxygenase
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 77,715,405 - 77,747,666 (-) NCBI GRCr8 mRatBN7.2 13 75,182,184 - 75,214,439 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 75,182,176 - 75,214,647 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 77,760,307 - 77,792,478 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 79,060,879 - 79,093,009 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 76,320,740 - 76,352,870 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 80,712,885 - 80,745,095 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 80,712,882 - 80,745,347 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 85,607,539 - 85,639,778 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 78,503,770 - 78,536,359 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 78,517,957 - 78,550,547 (-) NCBI Celera 13 74,919,415 - 74,951,610 (-) NCBI Celera Cytogenetic Map 13 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Fmo1 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of FMO1 mRNA] CTD PMID:31150632 Fmo1 Rat (R,R,R)-alpha-tocopherol increases expression EXP 6480464 alpha-Tocopherol results in increased expression of FMO1 mRNA CTD PMID:16908007 Fmo1 Rat 1,1-dichloroethene decreases expression ISO Fmo1 (Mus musculus) 6480464 vinylidene chloride results in decreased expression of FMO1 mRNA CTD PMID:26682919 Fmo1 Rat 1,2-dimethylhydrazine decreases expression ISO Fmo1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of FMO1 mRNA CTD PMID:22206623 Fmo1 Rat 1-naphthyl isothiocyanate decreases expression EXP 6480464 1-Naphthylisothiocyanate results in decreased expression of FMO1 mRNA CTD PMID:17522070 more ... Fmo1 Rat 1-naphthyl isothiocyanate decreases expression ISO Fmo1 (Mus musculus) 6480464 1-Naphthylisothiocyanate results in decreased expression of FMO1 mRNA CTD PMID:15913567 Fmo1 Rat 17alpha-ethynylestradiol affects expression ISO Fmo1 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of FMO1 mRNA CTD PMID:17555576 Fmo1 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of FMO1 mRNA and Estradiol results in decreased expression of FMO1 protein CTD PMID:21966433 and PMID:24894866 Fmo1 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of FMO1 mRNA CTD PMID:32145629 Fmo1 Rat 17beta-estradiol decreases expression ISO Fmo1 (Mus musculus) 6480464 Estradiol results in decreased expression of FMO1 mRNA CTD PMID:14664709 and PMID:39298647 Fmo1 Rat 17beta-estradiol multiple interactions EXP 6480464 resveratrol inhibits the reaction [Estradiol results in decreased expression of FMO1 mRNA] and resveratrol inhibits the reaction [Estradiol results in decreased expression of FMO1] CTD PMID:24894866 Fmo1 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions EXP 6480464 [3 more ... CTD PMID:16984957 Fmo1 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression EXP 6480464 2 more ... CTD PMID:21394737 Fmo1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Fmo1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin binds to AHR protein] which results in increased expression of FMO1 mRNA and [TIPARP gene mutant form results in increased susceptibility to Tetrachlorodibenzodioxin] which results in increased expression of FMO1 mRNA CTD PMID:16214954 and PMID:25975270 Fmo1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Fmo1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of FMO1 mRNA CTD PMID:21570461 and PMID:26377647 Fmo1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of FMO1 mRNA CTD PMID:11752688 more ... Fmo1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of FMO1 mRNA CTD PMID:22298810 Fmo1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Fmo1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of FMO1 mRNA CTD PMID:18765683 more ... Fmo1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Fmo1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of FMO1 mRNA CTD PMID:19933214 and PMID:28922406 Fmo1 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of FMO1 mRNA CTD PMID:21346803 Fmo1 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of FMO1 mRNA CTD PMID:21346803 Fmo1 Rat 3,3',4,4',5-pentachlorobiphenyl multiple interactions EXP 6480464 [3 more ... CTD PMID:16984957 Fmo1 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO Fmo1 (Mus musculus) 6480464 tetrabromobisphenol A results in decreased expression of FMO1 mRNA CTD PMID:25172293 Fmo1 Rat 3-chloropropane-1,2-diol decreases expression EXP 6480464 alpha-Chlorohydrin results in decreased expression of FMO1 protein CTD PMID:34915118 Fmo1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO Fmo1 (Mus musculus) 6480464 [Dexamethasone co-treated with rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in increased expression of FMO1 mRNA CTD PMID:16054899 Fmo1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO FMO1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of FMO1 mRNA CTD PMID:28628672 Fmo1 Rat 3H-1,2-dithiole-3-thione decreases expression EXP 6480464 1 and 2-dithiol-3-thione results in decreased expression of FMO1 mRNA CTD PMID:19162173 Fmo1 Rat 4,4'-diaminodiphenylmethane decreases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of FMO1 mRNA CTD PMID:25380136 Fmo1 Rat 4,4'-diaminodiphenylmethane increases expression ISO Fmo1 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of FMO1 mRNA CTD PMID:18648102 Fmo1 Rat 4,4'-sulfonyldiphenol decreases expression ISO Fmo1 (Mus musculus) 6480464 bisphenol S results in decreased expression of FMO1 mRNA CTD PMID:39298647 Fmo1 Rat 4-aminophenol multiple interactions ISO FMO1 (Homo sapiens) 6480464 [[FMO1 protein co-treated with NADP] results in increased metabolism of 4-fluoro-N-methylaniline] which results in increased chemical synthesis of 4-aminophenol CTD PMID:20369854 Fmo1 Rat 4-fluoroaniline multiple interactions ISO FMO1 (Homo sapiens) 6480464 [[FMO1 protein co-treated with NADP] results in increased metabolism of 4-fluoro-N-methylaniline] which results in increased chemical synthesis of 4-fluoroaniline CTD PMID:20369854 Fmo1 Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole affects expression EXP 6480464 Omeprazole affects the expression of FMO1 mRNA CTD PMID:19483382 Fmo1 Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of FMO1 mRNA CTD PMID:19483382 Fmo1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of FMO1 mRNA CTD PMID:30047161 Fmo1 Rat Actein increases expression EXP 6480464 actein results in increased expression of FMO1 protein CTD PMID:29969672 Fmo1 Rat aminoguanidine multiple interactions EXP 6480464 pimagedine inhibits the reaction [Lipopolysaccharides results in decreased expression of FMO1 mRNA] and pimagedine inhibits the reaction [Lipopolysaccharides results in decreased expression of FMO1 protein] CTD PMID:10462538 Fmo1 Rat amiodarone affects expression EXP 6480464 Amiodarone affects the expression of FMO1 mRNA CTD PMID:19483382 Fmo1 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of FMO1 mRNA CTD PMID:30047161 Fmo1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of FMO1 mRNA CTD PMID:16483693 Fmo1 Rat amphibole asbestos decreases expression ISO FMO1 (Homo sapiens) 6480464 Asbestos and Amphibole results in decreased expression of FMO1 protein CTD PMID:20855422 Fmo1 Rat Aroclor 1254 increases expression ISO FMO1 (Homo sapiens) 6480464 Chlorodiphenyl (54% Chlorine) results in increased expression of FMO1 mRNA CTD PMID:17851650 Fmo1 Rat atazanavir sulfate decreases expression ISO FMO1 (Homo sapiens) 6480464 Atazanavir Sulfate results in decreased expression of FMO1 mRNA CTD PMID:32152650 Fmo1 Rat Azoxymethane multiple interactions ISO Fmo1 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of FMO1 mRNA CTD PMID:29950665 Fmo1 Rat benzbromarone affects expression EXP 6480464 Benzbromarone affects the expression of FMO1 mRNA CTD PMID:19483382 Fmo1 Rat benzo[a]pyrene increases expression ISO Fmo1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of FMO1 mRNA CTD PMID:19770486 Fmo1 Rat benzo[a]pyrene decreases expression ISO FMO1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of FMO1 mRNA CTD PMID:32234424 Fmo1 Rat benzo[a]pyrene increases methylation ISO FMO1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of FMO1 3' UTR more ... CTD PMID:27901495 Fmo1 Rat benzo[a]pyrene multiple interactions ISO Fmo1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of FMO1 mRNA and AHR protein affects the reaction [Benzo(a)pyrene affects the expression of FMO1 mRNA] CTD PMID:22228805 and PMID:27858113 Fmo1 Rat benzo[a]pyrene decreases expression ISO Fmo1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of FMO1 mRNA CTD PMID:21569818 Fmo1 Rat benzo[a]pyrene increases expression ISO FMO1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of FMO1 mRNA CTD PMID:17879257 Fmo1 Rat benzo[b]fluoranthene decreases expression ISO Fmo1 (Mus musculus) 6480464 benzo(b)fluoranthene results in decreased expression of FMO1 mRNA CTD PMID:26377693 Fmo1 Rat benzo[b]fluoranthene multiple interactions ISO Fmo1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of FMO1 mRNA CTD PMID:27858113 Fmo1 Rat benzydamine multiple interactions ISO FMO1 (Homo sapiens) 6480464 Benzydamine inhibits the reaction [FMO1 protein results in increased chemical synthesis of clozapine N-oxide] CTD PMID:18809730 Fmo1 Rat benzydamine increases oxidation ISO FMO1 (Homo sapiens) 6480464 FMO1 protein results in increased oxidation of Benzydamine CTD PMID:21435388 Fmo1 Rat beta-naphthoflavone decreases expression ISO FMO1 (Homo sapiens) 6480464 beta-Naphthoflavone results in decreased expression of FMO1 mRNA CTD PMID:22258563 Fmo1 Rat bexarotene decreases expression EXP 6480464 bexarotene results in decreased expression of FMO1 mRNA CTD PMID:16648578 Fmo1 Rat bis(2-ethylhexyl) phthalate increases expression ISO Fmo1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of FMO1 mRNA CTD PMID:32235866 Fmo1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Fmo1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of FMO1 mRNA CTD PMID:34319233 Fmo1 Rat bis(2-ethylhexyl) phthalate decreases expression EXP 6480464 Diethylhexyl Phthalate results in decreased expression of FMO1 mRNA CTD PMID:35970509 Fmo1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of FMO1 mRNA CTD PMID:25181051 more ... Fmo1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of FMO1 mRNA CTD PMID:32145629 Fmo1 Rat bisphenol A decreases expression ISO Fmo1 (Mus musculus) 6480464 bisphenol A results in decreased expression of FMO1 mRNA CTD PMID:30951980 and PMID:33221593 Fmo1 Rat bisphenol A affects methylation ISO Fmo1 (Mus musculus) 6480464 bisphenol A affects the methylation of FMO1 promoter CTD PMID:27334623 Fmo1 Rat bisphenol A increases expression ISO FMO1 (Homo sapiens) 6480464 bisphenol A results in increased expression of FMO1 mRNA CTD PMID:27685785 Fmo1 Rat bisphenol F multiple interactions ISO FMO1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of FMO1 mRNA CTD PMID:28628672 Fmo1 Rat bisphenol F decreases expression ISO Fmo1 (Mus musculus) 6480464 bisphenol F results in decreased expression of FMO1 mRNA CTD PMID:30951980 Fmo1 Rat bromoacetate decreases expression ISO FMO1 (Homo sapiens) 6480464 bromoacetate results in decreased expression of FMO1 mRNA CTD PMID:19753638 Fmo1 Rat bromobenzene increases expression EXP 6480464 bromobenzene results in increased expression of FMO1 mRNA CTD PMID:15056800 Fmo1 Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of FMO1 mRNA CTD PMID:25993096 Fmo1 Rat carbon nanotube decreases expression ISO Fmo1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Fmo1 Rat CGP 52608 multiple interactions ISO FMO1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to FMO1 gene] CTD PMID:28238834 Fmo1 Rat chenodeoxycholic acid multiple interactions ISO FMO1 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in decreased expression of FMO1 mRNA more ... CTD PMID:32152650 and PMID:33819548 Fmo1 Rat chloroform decreases expression EXP 6480464 Chloroform results in decreased expression of FMO1 mRNA CTD PMID:17522070 Fmo1 Rat chrysene multiple interactions ISO Fmo1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of FMO1 mRNA CTD PMID:27858113 Fmo1 Rat clofibrate multiple interactions ISO Fmo1 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of FMO1 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of FMO1 mRNA] CTD PMID:17585979 Fmo1 Rat clofibrate affects expression EXP 6480464 Clofibrate affects the expression of FMO1 mRNA CTD PMID:19483382 Fmo1 Rat clofibric acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of FMO1 mRNA CTD PMID:17602206 Fmo1 Rat clozapine increases metabolic processing ISO FMO1 (Homo sapiens) 6480464 FMO1 protein results in increased metabolism of Clozapine CTD PMID:18809730 Fmo1 Rat Clozapine N-oxide increases chemical synthesis ISO FMO1 (Homo sapiens) 6480464 FMO1 protein results in increased chemical synthesis of clozapine N-oxide CTD PMID:18809730 Fmo1 Rat Clozapine N-oxide multiple interactions ISO FMO1 (Homo sapiens) 6480464 Benzydamine inhibits the reaction [FMO1 protein results in increased chemical synthesis of clozapine N-oxide] CTD PMID:18809730 Fmo1 Rat copper atom multiple interactions EXP 6480464 [Copper co-treated with Dietary Sucrose] results in decreased expression of FMO1 mRNA CTD PMID:26033743 Fmo1 Rat copper(0) multiple interactions EXP 6480464 [Copper co-treated with Dietary Sucrose] results in decreased expression of FMO1 mRNA CTD PMID:26033743 Fmo1 Rat corticosterone increases expression EXP 6480464 Corticosterone results in increased expression of FMO1 mRNA CTD PMID:15755911 Fmo1 Rat coumarin decreases expression EXP 6480464 coumarin results in decreased expression of FMO1 mRNA CTD PMID:18480146 Fmo1 Rat crocidolite asbestos decreases expression ISO Fmo1 (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of FMO1 mRNA CTD PMID:29279043 Fmo1 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of FMO1 mRNA CTD PMID:26577399 and PMID:27523638 Fmo1 Rat cyclosporin A decreases expression ISO Fmo1 (Mus musculus) 6480464 Cyclosporine results in decreased expression of FMO1 mRNA CTD PMID:19770486 Fmo1 Rat cyclosporin A multiple interactions ISO FMO1 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in decreased expression of FMO1 mRNA CTD PMID:32152650 Fmo1 Rat cyclosporin A decreases expression ISO FMO1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of FMO1 mRNA CTD PMID:27989131 and PMID:32152650 Fmo1 Rat cytarabine decreases expression ISO FMO1 (Homo sapiens) 6480464 Cytarabine results in decreased expression of FMO1 mRNA CTD PMID:21198554 Fmo1 Rat D-penicillamine increases expression ISO FMO1 (Homo sapiens) 6480464 Penicillamine results in increased expression of FMO1 mRNA CTD PMID:22843330 Fmo1 Rat deoxycholic acid multiple interactions ISO FMO1 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in decreased expression of FMO1 mRNA more ... CTD PMID:32152650 and PMID:33819548 Fmo1 Rat dexamethasone affects expression EXP 6480464 Dexamethasone affects the expression of FMO1 mRNA CTD PMID:15102944 Fmo1 Rat dexamethasone multiple interactions ISO FMO1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of FMO1 mRNA CTD PMID:28628672 Fmo1 Rat dexamethasone increases expression ISO Fmo1 (Mus musculus) 6480464 Dexamethasone results in increased expression of FMO1 mRNA CTD PMID:22733784 Fmo1 Rat dexamethasone multiple interactions ISO Fmo1 (Mus musculus) 6480464 [Dexamethasone co-treated with rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in increased expression of FMO1 mRNA CTD PMID:16054899 Fmo1 Rat dextran sulfate multiple interactions ISO Fmo1 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of FMO1 mRNA CTD PMID:29950665 Fmo1 Rat dibenz[a,h]anthracene affects expression ISO Fmo1 (Mus musculus) 6480464 1 more ... CTD PMID:26377693 Fmo1 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of FMO1 mRNA CTD PMID:21266533 Fmo1 Rat diethylstilbestrol increases expression ISO Fmo1 (Mus musculus) 6480464 Diethylstilbestrol results in increased expression of FMO1 mRNA CTD PMID:15171707 Fmo1 Rat diethylstilbestrol decreases expression ISO Fmo1 (Mus musculus) 6480464 Diethylstilbestrol results in decreased expression of FMO1 mRNA CTD PMID:16636312 Fmo1 Rat dihydroxyacetone decreases expression ISO FMO1 (Homo sapiens) 6480464 Dihydroxyacetone results in decreased expression of FMO1 mRNA CTD PMID:32506039 Fmo1 Rat dioxygen multiple interactions ISO Fmo1 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of FMO1 mRNA CTD PMID:30529165 Fmo1 Rat dorsomorphin multiple interactions ISO FMO1 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Fmo1 Rat endosulfan decreases expression ISO Fmo1 (Mus musculus) 6480464 Endosulfan results in decreased expression of FMO1 mRNA CTD PMID:22515965 Fmo1 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of FMO1 mRNA CTD PMID:29391264 Fmo1 Rat erythromycin estolate decreases expression EXP 6480464 Erythromycin Estolate results in decreased expression of FMO1 mRNA CTD PMID:17522070 Fmo1 Rat ethanol increases expression EXP 6480464 Ethanol results in increased expression of FMO1 mRNA CTD PMID:16946407 Fmo1 Rat ethanol affects expression ISO Fmo1 (Mus musculus) 6480464 Ethanol affects the expression of FMO1 mRNA CTD PMID:30319688 Fmo1 Rat ethanol increases expression ISO Fmo1 (Mus musculus) 6480464 Ethanol results in increased expression of FMO1 mRNA CTD PMID:19167417 Fmo1 Rat fenofibrate multiple interactions EXP 6480464 [Fenofibrate co-treated with Diethylnitrosamine] results in decreased expression of FMO1 mRNA CTD PMID:18253720 Fmo1 Rat fenthion increases oxidation ISO FMO1 (Homo sapiens) 6480464 FMO1 protein results in increased oxidation of Fenthion CTD PMID:14976351 Fmo1 Rat fentin chloride increases expression EXP 6480464 triphenyltin chloride results in increased expression of FMO1 mRNA CTD PMID:37156404 Fmo1 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of FMO1 mRNA CTD PMID:24136188 Fmo1 Rat folic acid decreases expression ISO Fmo1 (Mus musculus) 6480464 Folic Acid results in decreased expression of FMO1 mRNA CTD PMID:25629700 Fmo1 Rat genistein decreases expression ISO Fmo1 (Mus musculus) 6480464 Genistein results in decreased expression of FMO1 mRNA CTD PMID:32186404 Fmo1 Rat glafenine decreases expression EXP 6480464 Glafenine results in decreased expression of FMO1 mRNA CTD PMID:24136188 Fmo1 Rat glycidol decreases expression EXP 6480464 glycidol results in decreased expression of FMO1 mRNA CTD PMID:24915197 Fmo1 Rat glycochenodeoxycholic acid multiple interactions ISO FMO1 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in decreased expression of FMO1 mRNA more ... CTD PMID:32152650 and PMID:33819548 Fmo1 Rat glycocholic acid multiple interactions ISO FMO1 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in decreased expression of FMO1 mRNA more ... CTD PMID:32152650 and PMID:33819548 Fmo1 Rat glycodeoxycholic acid multiple interactions ISO FMO1 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in decreased expression of FMO1 mRNA more ... CTD PMID:32152650 and PMID:33819548 Fmo1 Rat glyphosate decreases expression ISO Fmo1 (Mus musculus) 6480464 Glyphosate results in decreased expression of FMO1 protein CTD PMID:36173347 Fmo1 Rat glyphosate affects methylation EXP 6480464 Glyphosate affects the methylation of FMO1 gene CTD PMID:35440735 Fmo1 Rat glyphosate decreases expression EXP 6480464 Glyphosate results in decreased expression of FMO1 mRNA CTD PMID:26302742 Fmo1 Rat Heptachlor epoxide decreases expression ISO Fmo1 (Mus musculus) 6480464 Heptachlor Epoxide results in decreased expression of FMO1 mRNA CTD PMID:25270620 Fmo1 Rat hydrogen peroxide decreases expression ISO FMO1 (Homo sapiens) 6480464 Hydrogen Peroxide results in decreased expression of FMO1 mRNA CTD PMID:12419474 Fmo1 Rat indometacin multiple interactions ISO FMO1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of FMO1 mRNA CTD PMID:28628672 Fmo1 Rat isoprenaline increases expression ISO Fmo1 (Mus musculus) 6480464 Isoproterenol results in increased expression of FMO1 mRNA CTD PMID:20003209 Fmo1 Rat kojic acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with kojic acid co-treated with Diethylnitrosamine] results in decreased expression of FMO1 mRNA and [Diethylnitrosamine co-treated with kojic acid] results in increased expression of FMO1 mRNA CTD PMID:18544905 Fmo1 Rat L-ascorbic acid multiple interactions ISO FMO1 (Homo sapiens) 6480464 [Quercetin co-treated with Ascorbic Acid] results in decreased expression of FMO1 mRNA CTD PMID:17639512 Fmo1 Rat L-ethionine affects expression EXP 6480464 Ethionine affects the expression of FMO1 mRNA CTD PMID:19483382 Fmo1 Rat lipopolysaccharide decreases expression EXP 6480464 Lipopolysaccharides results in decreased expression of FMO1 mRNA and Lipopolysaccharides results in decreased expression of FMO1 protein CTD PMID:10462538 Fmo1 Rat lipopolysaccharide multiple interactions EXP 6480464 pimagedine inhibits the reaction [Lipopolysaccharides results in decreased expression of FMO1 mRNA] and pimagedine inhibits the reaction [Lipopolysaccharides results in decreased expression of FMO1 protein] CTD PMID:10462538 Fmo1 Rat lipopolysaccharide multiple interactions ISO FMO1 (Homo sapiens) 6480464 [usnic acid co-treated with Lipopolysaccharides] results in decreased expression of FMO1 mRNA CTD PMID:22777745 Fmo1 Rat maleic acid increases expression ISO FMO1 (Homo sapiens) 6480464 maleic acid results in increased expression of FMO1 mRNA CTD PMID:28392987 Fmo1 Rat methimazole increases oxidation ISO FMO1 (Homo sapiens) 6480464 FMO1 protein results in increased oxidation of Methimazole CTD PMID:14976351 Fmo1 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of FMO1 mRNA CTD PMID:30047161 Fmo1 Rat methimazole multiple interactions EXP 6480464 Methimazole inhibits the reaction [[[FMO1 protein co-treated with NADP] results in increased metabolism of 4-fluoro-N-methylaniline] which results in increased chemical synthesis of N-methyl-4-aminophenol] CTD PMID:20369854 Fmo1 Rat methiocarb multiple interactions ISO FMO1 (Homo sapiens) 6480464 [FMO1 protein results in increased metabolism of Methiocarb] which results in increased abundance of methiocarb sulfoxide CTD PMID:27665777 Fmo1 Rat methiocarb increases metabolic processing ISO FMO1 (Homo sapiens) 6480464 FMO1 protein results in increased metabolism of Methiocarb CTD PMID:27665777 Fmo1 Rat methiocarb-sulfoxide increases abundance ISO FMO1 (Homo sapiens) 6480464 FMO1 protein results in increased abundance of methiocarb sulfoxide CTD PMID:27665777 Fmo1 Rat methiocarb-sulfoxide multiple interactions ISO FMO1 (Homo sapiens) 6480464 [FMO1 protein results in increased metabolism of Methiocarb] which results in increased abundance of methiocarb sulfoxide CTD PMID:27665777 Fmo1 Rat methylmercury chloride decreases expression ISO FMO1 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of FMO1 mRNA CTD PMID:23179753 Fmo1 Rat monocrotaline multiple interactions ISO Fmo1 (Mus musculus) 6480464 [Monocrotaline co-treated with Rifampin co-treated with Phenytoin co-treated with PRKDC] results in decreased expression of FMO1 mRNA CTD PMID:21224054 Fmo1 Rat Muraglitazar decreases expression EXP 6480464 muraglitazar results in decreased expression of FMO1 mRNA CTD PMID:21515302 Fmo1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of FMO1 mRNA more ... CTD PMID:17602206 more ... Fmo1 Rat N-nitrosodiethylamine decreases expression EXP 6480464 Diethylnitrosamine results in decreased expression of FMO1 mRNA CTD PMID:19638242 Fmo1 Rat N-nitrosodimethylamine decreases expression EXP 6480464 Dimethylnitrosamine results in decreased expression of FMO1 mRNA CTD PMID:17072980 and PMID:25380136 Fmo1 Rat NADP zwitterion multiple interactions ISO FMO1 (Homo sapiens) 6480464 [[FMO1 protein co-treated with NADP] results in increased metabolism of 4-fluoro-N-methylaniline] which results in increased chemical synthesis of 4-aminophenol more ... CTD PMID:20369854 Fmo1 Rat NADP zwitterion multiple interactions EXP 6480464 [[FMO1 protein co-treated with NADP] results in increased metabolism of 4-fluoro-N-methylaniline] which results in increased chemical synthesis of N-methyl-4-aminophenol more ... CTD PMID:20369854 Fmo1 Rat NADP(+) multiple interactions ISO FMO1 (Homo sapiens) 6480464 [[FMO1 protein co-treated with NADP] results in increased metabolism of 4-fluoro-N-methylaniline] which results in increased chemical synthesis of 4-aminophenol more ... CTD PMID:20369854 Fmo1 Rat NADP(+) multiple interactions EXP 6480464 [[FMO1 protein co-treated with NADP] results in increased metabolism of 4-fluoro-N-methylaniline] which results in increased chemical synthesis of N-methyl-4-aminophenol more ... CTD PMID:20369854 Fmo1 Rat nefazodone multiple interactions ISO FMO1 (Homo sapiens) 6480464 [nefazodone co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in decreased expression of FMO1 mRNA CTD PMID:32152650 Fmo1 Rat nefazodone decreases expression ISO FMO1 (Homo sapiens) 6480464 nefazodone results in decreased expression of FMO1 mRNA CTD PMID:32152650 Fmo1 Rat nevirapine decreases expression EXP 6480464 Nevirapine metabolite results in decreased expression of FMO1 mRNA CTD PMID:23947594 Fmo1 Rat nickel atom decreases expression ISO FMO1 (Homo sapiens) 6480464 Nickel results in decreased expression of FMO1 mRNA CTD PMID:24768652 and PMID:25583101 Fmo1 Rat nimesulide decreases expression EXP 6480464 nimesulide results in decreased expression of FMO1 mRNA CTD PMID:24136188 Fmo1 Rat nitroglycerin decreases expression EXP 6480464 Nitroglycerin results in decreased expression of FMO1 mRNA CTD PMID:12102619 Fmo1 Rat O-methyleugenol decreases expression ISO FMO1 (Homo sapiens) 6480464 methyleugenol results in decreased expression of FMO1 mRNA CTD PMID:32234424 Fmo1 Rat omeprazole affects expression EXP 6480464 Omeprazole affects the expression of FMO1 mRNA CTD PMID:19483382 Fmo1 Rat orphenadrine affects expression EXP 6480464 Orphenadrine affects the expression of FMO1 mRNA CTD PMID:23665939 Fmo1 Rat oxaliplatin increases expression EXP 6480464 oxaliplatin results in increased expression of FMO1 mRNA CTD PMID:25729387 Fmo1 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of FMO1 mRNA CTD PMID:25729387 Fmo1 Rat oxycodone affects expression EXP 6480464 Oxycodone affects the expression of FMO1 mRNA CTD PMID:20487198 Fmo1 Rat oxycodone increases expression EXP 6480464 Oxycodone results in increased expression of FMO1 mRNA CTD PMID:23439660 Fmo1 Rat ozone decreases expression ISO Fmo1 (Mus musculus) 6480464 Ozone results in decreased expression of FMO1 mRNA CTD PMID:12763052 Fmo1 Rat ozone multiple interactions ISO Fmo1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of FMO1 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of FMO1 mRNA CTD PMID:34911549 Fmo1 Rat paracetamol multiple interactions ISO Fmo1 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of FMO1 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of FMO1 mRNA] CTD PMID:17585979 Fmo1 Rat paracetamol multiple interactions ISO FMO1 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Acetaminophen] results in decreased expression of FMO1 mRNA CTD PMID:33819548 Fmo1 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of FMO1 mRNA CTD PMID:17202762 more ... Fmo1 Rat paracetamol affects expression ISO Fmo1 (Mus musculus) 6480464 Acetaminophen affects the expression of FMO1 mRNA CTD PMID:17562736 Fmo1 Rat paracetamol increases expression ISO Fmo1 (Mus musculus) 6480464 Acetaminophen results in increased expression of FMO1 mRNA CTD PMID:11264010 Fmo1 Rat parathion increases expression ISO Fmo1 (Mus musculus) 6480464 Parathion results in increased expression of FMO1 mRNA CTD PMID:34813904 Fmo1 Rat pentachlorophenol increases expression ISO Fmo1 (Mus musculus) 6480464 Pentachlorophenol results in increased expression of FMO1 mRNA CTD PMID:23892564 Fmo1 Rat perfluorohexanesulfonic acid increases expression ISO Fmo1 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of FMO1 mRNA CTD PMID:37995155 Fmo1 Rat perfluorooctanoic acid decreases expression EXP 6480464 perfluorooctanoic acid results in decreased expression of FMO1 mRNA and perfluorooctanoic acid results in decreased expression of FMO1 protein CTD PMID:19162173 and PMID:34958885 Fmo1 Rat perfluorooctanoic acid decreases expression ISO FMO1 (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of FMO1 mRNA CTD PMID:36326898 Fmo1 Rat phenobarbital increases expression ISO Fmo1 (Mus musculus) 6480464 Phenobarbital results in increased expression of FMO1 mRNA CTD PMID:19482888 Fmo1 Rat phenobarbital multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Phenobarbital] results in increased expression of FMO1 mRNA and [Diethylnitrosamine co-treated with Phenobarbital] results in increased methylation of FMO1 promoter CTD PMID:25374375 Fmo1 Rat phenobarbital multiple interactions ISO Fmo1 (Mus musculus) 6480464 NR1I3 protein affects the reaction [Phenobarbital results in increased expression of FMO1 mRNA] CTD PMID:19482888 Fmo1 Rat phenobarbital decreases expression EXP 6480464 Phenobarbital results in decreased expression of FMO1 mRNA CTD PMID:19162173 Fmo1 Rat phenytoin multiple interactions ISO Fmo1 (Mus musculus) 6480464 [Monocrotaline co-treated with Rifampin co-treated with Phenytoin co-treated with PRKDC] results in decreased expression of FMO1 mRNA CTD PMID:21224054 Fmo1 Rat phlorizin decreases expression ISO Fmo1 (Mus musculus) 6480464 Phlorhizin results in decreased expression of FMO1 mRNA CTD PMID:22538082 Fmo1 Rat phosgene affects expression ISO Fmo1 (Mus musculus) 6480464 Phosgene affects the expression of FMO1 mRNA CTD PMID:16300373 Fmo1 Rat piperonyl butoxide decreases expression EXP 6480464 Piperonyl Butoxide results in decreased expression of FMO1 mRNA CTD PMID:22484513 Fmo1 Rat pirinixic acid increases expression ISO Fmo1 (Mus musculus) 6480464 pirinixic acid results in increased expression of FMO1 mRNA CTD PMID:15375163 more ... Fmo1 Rat pirinixic acid decreases expression ISO Fmo1 (Mus musculus) 6480464 pirinixic acid results in decreased expression of FMO1 mRNA CTD PMID:25270620 Fmo1 Rat pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of FMO1 mRNA CTD PMID:19162173 Fmo1 Rat pirinixic acid affects expression EXP 6480464 pirinixic acid affects the expression of FMO1 mRNA CTD PMID:19483382 Fmo1 Rat pregnenolone 16alpha-carbonitrile decreases expression EXP 6480464 Pregnenolone Carbonitrile results in decreased expression of FMO1 mRNA CTD PMID:19162173 Fmo1 Rat pregnenolone 16alpha-carbonitrile decreases expression ISO Fmo1 (Mus musculus) 6480464 Pregnenolone Carbonitrile results in decreased expression of FMO1 mRNA CTD PMID:27413110 and PMID:28903501 Fmo1 Rat pyrazinecarboxamide increases expression EXP 6480464 Pyrazinamide results in increased expression of FMO1 mRNA CTD PMID:22431067 Fmo1 Rat pyrimidin-2-amine affects binding EXP 6480464 2-aminopyrimidine analog binds to FMO1 protein CTD PMID:19317514 Fmo1 Rat quercetin multiple interactions ISO FMO1 (Homo sapiens) 6480464 [Quercetin co-treated with Ascorbic Acid] results in decreased expression of FMO1 mRNA CTD PMID:17639512 Fmo1 Rat resveratrol multiple interactions EXP 6480464 resveratrol inhibits the reaction [Estradiol results in decreased expression of FMO1 mRNA] and resveratrol inhibits the reaction [Estradiol results in decreased expression of FMO1] CTD PMID:24894866 Fmo1 Rat rifampicin multiple interactions ISO Fmo1 (Mus musculus) 6480464 [Monocrotaline co-treated with Rifampin co-treated with Phenytoin co-treated with PRKDC] results in decreased expression of FMO1 mRNA CTD PMID:21224054 Fmo1 Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of FMO1 mRNA CTD PMID:28374803 Fmo1 Rat SB 431542 multiple interactions ISO FMO1 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Fmo1 Rat sodium arsenite increases expression ISO FMO1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of FMO1 mRNA CTD PMID:38568856 Fmo1 Rat sodium chloride increases expression EXP 6480464 Sodium Chloride results in increased expression of FMO1 mRNA and Sodium Chloride results in increased expression of FMO1 protein CTD PMID:19429252 Fmo1 Rat sodium dichromate decreases expression ISO Fmo1 (Mus musculus) 6480464 sodium bichromate results in decreased expression of FMO1 mRNA CTD PMID:22155349 Fmo1 Rat sodium dichromate decreases expression EXP 6480464 sodium bichromate results in decreased expression of FMO1 mRNA CTD PMID:25993096 Fmo1 Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of FMO1 mRNA CTD PMID:12325037 Fmo1 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of FMO1 mRNA CTD PMID:30047161 Fmo1 Rat Sunset Yellow FCF multiple interactions ISO FMO1 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with 6-hydroxy-5-((p- sulfophenyl)azo)-2-naphthalenesulfonic acid disodium salt] results in decreased expression of FMO1 mRNA CTD PMID:33819548 Fmo1 Rat tamoxifen affects expression ISO Fmo1 (Mus musculus) 6480464 Tamoxifen affects the expression of FMO1 mRNA CTD PMID:17555576 Fmo1 Rat tartrazine multiple interactions ISO FMO1 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Tartrazine] results in decreased expression of FMO1 mRNA CTD PMID:33819548 Fmo1 Rat tert-butyl hydroperoxide decreases expression ISO FMO1 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of FMO1 mRNA CTD PMID:12419474 Fmo1 Rat Tesaglitazar decreases expression EXP 6480464 tesaglitazar results in decreased expression of FMO1 mRNA CTD PMID:21515302 Fmo1 Rat testosterone decreases expression ISO Fmo1 (Mus musculus) 6480464 Testosterone results in decreased expression of FMO1 mRNA CTD PMID:20600201 and PMID:21669218 Fmo1 Rat tetrachloromethane affects expression EXP 6480464 Carbon Tetrachloride affects the expression of FMO1 mRNA CTD PMID:12734012 and PMID:15963342 Fmo1 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of FMO1 mRNA] CTD PMID:31150632 Fmo1 Rat tetrachloromethane decreases expression ISO Fmo1 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of FMO1 mRNA CTD PMID:27339419 and PMID:31919559 Fmo1 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of FMO1 mRNA and Carbon Tetrachloride results in decreased expression of FMO1 protein CTD PMID:12629582 more ... Fmo1 Rat tetracycline decreases expression EXP 6480464 Tetracycline results in decreased expression of FMO1 mRNA CTD PMID:17522070 Fmo1 Rat tetraphene multiple interactions ISO Fmo1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of FMO1 mRNA CTD PMID:27858113 Fmo1 Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of FMO1 mRNA CTD PMID:19483382 Fmo1 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of FMO1 mRNA CTD PMID:34492290 Fmo1 Rat thioacetamide multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in decreased expression of FMO1 mRNA CTD PMID:28943392 Fmo1 Rat titanium dioxide decreases expression ISO Fmo1 (Mus musculus) 6480464 titanium dioxide results in decreased expression of FMO1 mRNA CTD PMID:23557971 Fmo1 Rat titanium dioxide multiple interactions ISO Fmo1 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of FMO1 mRNA CTD PMID:29950665 Fmo1 Rat topotecan increases expression EXP 6480464 Topotecan results in increased expression of FMO1 mRNA CTD PMID:25729387 Fmo1 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of FMO1 mRNA CTD PMID:25729387 Fmo1 Rat tremolite asbestos decreases expression ISO Fmo1 (Mus musculus) 6480464 tremolite results in decreased expression of FMO1 mRNA CTD PMID:29279043 Fmo1 Rat trichostatin A increases expression ISO FMO1 (Homo sapiens) 6480464 trichostatin A results in increased expression of FMO1 mRNA CTD PMID:24935251 and PMID:26272509 Fmo1 Rat trichostatin A multiple interactions ISO FMO1 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of FMO1 mRNA CTD PMID:27188386 Fmo1 Rat triclosan increases expression ISO FMO1 (Homo sapiens) 6480464 Triclosan results in increased expression of FMO1 mRNA CTD PMID:30510588 Fmo1 Rat triclosan multiple interactions ISO FMO1 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Triclosan] results in decreased expression of FMO1 mRNA CTD PMID:33819548 Fmo1 Rat trimellitic anhydride decreases expression ISO Fmo1 (Mus musculus) 6480464 trimellitic anhydride results in decreased expression of FMO1 mRNA CTD PMID:19042947 Fmo1 Rat triphenyl phosphate affects expression EXP 6480464 triphenyl phosphate affects the expression of FMO1 mRNA CTD PMID:30589522 Fmo1 Rat triptonide affects expression ISO Fmo1 (Mus musculus) 6480464 triptonide affects the expression of FMO1 mRNA CTD PMID:33045310 Fmo1 Rat troglitazone decreases expression ISO FMO1 (Homo sapiens) 6480464 troglitazone results in decreased expression of FMO1 mRNA CTD PMID:19631733 Fmo1 Rat troglitazone decreases expression EXP 6480464 troglitazone results in decreased expression of FMO1 mRNA CTD PMID:21515302 Fmo1 Rat troglitazone increases expression ISO FMO1 (Homo sapiens) 6480464 troglitazone results in increased expression of FMO1 mRNA CTD PMID:19631733 Fmo1 Rat tunicamycin decreases expression ISO Fmo1 (Mus musculus) 6480464 Tunicamycin results in decreased expression of FMO1 mRNA CTD PMID:17127020 Fmo1 Rat usnic acid multiple interactions ISO FMO1 (Homo sapiens) 6480464 [usnic acid co-treated with Lipopolysaccharides] results in decreased expression of FMO1 mRNA CTD PMID:22777745 Fmo1 Rat valdecoxib decreases expression EXP 6480464 valdecoxib results in decreased expression of FMO1 mRNA CTD PMID:24136188 Fmo1 Rat valproic acid decreases expression ISO FMO1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of FMO1 mRNA CTD PMID:29154799 Fmo1 Rat valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of FMO1 mRNA CTD PMID:29427782 Fmo1 Rat valproic acid multiple interactions ISO FMO1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of FMO1 mRNA CTD PMID:27188386 Fmo1 Rat valproic acid increases expression ISO FMO1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of FMO1 mRNA CTD PMID:23179753 more ... Fmo1 Rat valproic acid affects expression ISO Fmo1 (Mus musculus) 6480464 Valproic Acid affects the expression of FMO1 mRNA CTD PMID:17963808 Fmo1 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of FMO1 mRNA CTD PMID:19015723 Fmo1 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of FMO1 mRNA CTD PMID:22570695 Fmo1 Rat zinc pyrithione increases expression ISO FMO1 (Homo sapiens) 6480464 pyrithione zinc results in increased expression of FMO1 mRNA CTD PMID:21424779
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(+)-schisandrin B (EXP) (R,R,R)-alpha-tocopherol (EXP) 1,1-dichloroethene (ISO) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (EXP,ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (EXP) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3,3',5,5'-tetrabromobisphenol A (ISO) 3-chloropropane-1,2-diol (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3H-1,2-dithiole-3-thione (EXP) 4,4'-diaminodiphenylmethane (EXP,ISO) 4,4'-sulfonyldiphenol (ISO) 4-aminophenol (ISO) 4-fluoroaniline (ISO) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP) 6-propyl-2-thiouracil (EXP) Actein (EXP) aminoguanidine (EXP) amiodarone (EXP) amitrole (EXP) ammonium chloride (EXP) amphibole asbestos (ISO) Aroclor 1254 (ISO) atazanavir sulfate (ISO) Azoxymethane (ISO) benzbromarone (EXP) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) benzydamine (ISO) beta-naphthoflavone (ISO) bexarotene (EXP) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) bromoacetate (ISO) bromobenzene (EXP) cadmium dichloride (EXP) carbon nanotube (ISO) CGP 52608 (ISO) chenodeoxycholic acid (ISO) chloroform (EXP) chrysene (ISO) clofibrate (EXP,ISO) clofibric acid (EXP) clozapine (ISO) Clozapine N-oxide (ISO) copper atom (EXP) copper(0) (EXP) corticosterone (EXP) coumarin (EXP) crocidolite asbestos (ISO) Cuprizon (EXP) cyclosporin A (ISO) cytarabine (ISO) D-penicillamine (ISO) deoxycholic acid (ISO) dexamethasone (EXP,ISO) dextran sulfate (ISO) dibenz[a,h]anthracene (ISO) dibutyl phthalate (EXP) diethylstilbestrol (ISO) dihydroxyacetone (ISO) dioxygen (ISO) dorsomorphin (ISO) endosulfan (EXP,ISO) erythromycin estolate (EXP) ethanol (EXP,ISO) fenofibrate (EXP) fenthion (ISO) fentin chloride (EXP) flutamide (EXP) folic acid (ISO) genistein (ISO) glafenine (EXP) glycidol (EXP) glycochenodeoxycholic acid (ISO) glycocholic acid (ISO) glycodeoxycholic acid (ISO) glyphosate (EXP,ISO) Heptachlor epoxide (ISO) hydrogen peroxide (ISO) indometacin (ISO) isoprenaline (ISO) kojic acid (EXP) L-ascorbic acid (ISO) L-ethionine (EXP) lipopolysaccharide (EXP,ISO) maleic acid (ISO) methimazole (EXP,ISO) methiocarb (ISO) methiocarb-sulfoxide (ISO) methylmercury chloride (ISO) monocrotaline (ISO) Muraglitazar (EXP) N-nitrosodiethylamine (EXP) N-nitrosodimethylamine (EXP) NADP zwitterion (EXP,ISO) NADP(+) (EXP,ISO) nefazodone (ISO) nevirapine (EXP) nickel atom (ISO) nimesulide (EXP) nitroglycerin (EXP) O-methyleugenol (ISO) omeprazole (EXP) orphenadrine (EXP) oxaliplatin (EXP) oxycodone (EXP) ozone (ISO) paracetamol (EXP,ISO) parathion (ISO) pentachlorophenol (ISO) perfluorohexanesulfonic acid (ISO) perfluorooctanoic acid (EXP,ISO) phenobarbital (EXP,ISO) phenytoin (ISO) phlorizin (ISO) phosgene (ISO) piperonyl butoxide (EXP) pirinixic acid (EXP,ISO) pregnenolone 16alpha-carbonitrile (EXP,ISO) pyrazinecarboxamide (EXP) pyrimidin-2-amine (EXP) quercetin (ISO) resveratrol (EXP) rifampicin (ISO) rotenone (EXP) SB 431542 (ISO) sodium arsenite (ISO) sodium chloride (EXP) sodium dichromate (EXP,ISO) sulfadimethoxine (EXP) Sunset Yellow FCF (ISO) tamoxifen (ISO) tartrazine (ISO) tert-butyl hydroperoxide (ISO) Tesaglitazar (EXP) testosterone (ISO) tetrachloromethane (EXP,ISO) tetracycline (EXP) tetraphene (ISO) thioacetamide (EXP) titanium dioxide (ISO) topotecan (EXP) tremolite asbestos (ISO) trichostatin A (ISO) triclosan (ISO) trimellitic anhydride (ISO) triphenyl phosphate (EXP) triptonide (ISO) troglitazone (EXP,ISO) tunicamycin (ISO) usnic acid (ISO) valdecoxib (EXP) valproic acid (EXP,ISO) vinclozolin (EXP) zinc pyrithione (ISO)
1.
Lipopolysaccharide-induced epithelial monoamine oxidase mediates alveolar bone loss in a rat chronic wound model.
Ekuni D, etal., Am J Pathol. 2009 Oct;175(4):1398-409. Epub 2009 Sep 24.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
4.
Rat liver flavin-containing monooxygenase (FMO): cDNA cloning and expression in yeast.
Itoh K, etal., Biochim Biophys Acta 1993 May 28;1173(2):165-71.
5.
Physiological factors affecting the expression of FMO1 and FMO3 in the rat liver and kidney.
Lattard V, etal., Biochem Pharmacol 2002 Apr 15;63(8):1453-64.
6.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
7.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.
Differential localization of flavin-containing monooxygenase (FMO) isoforms 1, 3, and 4 in rat liver and kidney and evidence for expression of FMO4 in mouse, rat, and human liver and kidney microsomes.
Novick RM, etal., J Pharmacol Exp Ther. 2009 Jun;329(3):1148-55. Epub 2009 Mar 23.
9.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
10.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
11.
GOA pipeline
RGD automated data pipeline
12.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
14.
Effect of hyperosmotic conditions on flavin-containing monooxygenase activity, protein and mRNA expression in rat kidney.
Rodriguez-Fuentes G, etal., Toxicol Lett. 2009 Jun 1;187(2):115-8. Epub 2009 Feb 20.
15.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
16.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
Fmo1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 77,715,405 - 77,747,666 (-) NCBI GRCr8 mRatBN7.2 13 75,182,184 - 75,214,439 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 75,182,176 - 75,214,647 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 77,760,307 - 77,792,478 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 79,060,879 - 79,093,009 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 76,320,740 - 76,352,870 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 80,712,885 - 80,745,095 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 80,712,882 - 80,745,347 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 85,607,539 - 85,639,778 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 78,503,770 - 78,536,359 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 78,517,957 - 78,550,547 (-) NCBI Celera 13 74,919,415 - 74,951,610 (-) NCBI Celera Cytogenetic Map 13 q22 NCBI
FMO1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 171,248,494 - 171,285,978 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 171,248,471 - 171,285,978 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 171,217,633 - 171,255,117 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 169,484,287 - 169,521,737 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 167,949,320 - 167,986,769 NCBI Celera 1 144,327,502 - 144,364,465 (+) NCBI Celera Cytogenetic Map 1 q24.3 NCBI HuRef 1 142,440,949 - 142,478,265 (+) NCBI HuRef CHM1_1 1 172,639,801 - 172,677,227 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 170,604,793 - 170,642,278 (+) NCBI T2T-CHM13v2.0
Fmo1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 162,657,130 - 162,694,170 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 162,657,130 - 162,694,179 (-) Ensembl GRCm39 Ensembl GRCm38 1 162,829,561 - 162,866,610 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 162,829,561 - 162,866,610 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 164,759,692 - 164,796,679 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 164,666,236 - 164,703,223 (-) NCBI MGSCv36 mm8 Celera 1 165,273,712 - 165,303,556 (-) NCBI Celera Cytogenetic Map 1 H2.1 NCBI cM Map 1 70.34 NCBI
Fmo1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955406 11,881,882 - 11,916,323 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955406 11,882,656 - 11,915,875 (+) NCBI ChiLan1.0 ChiLan1.0
FMO1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 78,472,277 - 78,498,941 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 78,146,459 - 78,173,131 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 146,742,505 - 146,778,560 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 150,456,729 - 150,492,527 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 150,456,729 - 150,492,527 (+) Ensembl panpan1.1 panPan2
FMO1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 7 27,599,230 - 27,623,081 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 7 27,599,267 - 27,618,237 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 7 27,120,190 - 27,139,165 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 7 27,400,502 - 27,424,539 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 7 27,400,510 - 27,424,542 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 7 27,251,218 - 27,270,180 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 7 27,285,744 - 27,304,928 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 7 27,528,093 - 27,546,971 (-) NCBI UU_Cfam_GSD_1.0
FMO1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 63,868,064 - 63,895,076 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 63,860,957 - 63,895,086 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 70,137,610 - 70,171,700 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
FMO1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 25 57,781,273 - 57,819,787 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 25 57,782,085 - 57,819,408 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666055 59,419,669 - 59,462,141 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Fmo1
.
Predicted Target Of
Count of predictions: 74 Count of miRNA genes: 60 Interacting mature miRNAs: 72 Transcripts: ENSRNOT00000041908 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1298066 Bp159 Blood pressure QTL 159 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 46088046 91088046 Rat 10755495 Bp387 Blood pressure QTL 387 3.78 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 34663461 87525369 Rat 1354655 Bp241 Blood pressure QTL 241 3.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 56056920 101056920 Rat 8655951 Rf63 Renal function QTL 63 12.2 blood urea nitrogen amount (VT:0005265) plasma urea nitrogen level (CMO:0000586) 13 69060519 77046890 Rat 70220 Bp55 Blood pressure QTL 55 5.75 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 13 37374509 82374509 Rat 8655945 Rf61 Renal function QTL 61 3.6 blood creatinine amount (VT:0005328) creatinine clearance (CMO:0000765) 13 69060519 86800898 Rat 71119 Thym2 Thymus enlargement QTL 2 3.8 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 13 46197976 84753113 Rat 4889861 Pur29 Proteinuria QTL 29 13.8 0.005 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 13 37415584 80753406 Rat 1331783 Bp221 Blood pressure QTL 221 3.72886 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 69060519 86800898 Rat 8655959 Pur32 Proteinuria QTL 32 8.4 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 13 74023918 97213863 Rat 12879441 Bp396 Blood pressure QTL 396 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 45699983 90699983 Rat 2293687 Bss26 Bone structure and strength QTL 26 4.6 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 13 65103704 106807694 Rat 1300166 Kidm6 Kidney mass QTL 6 3.93 kidney mass (VT:0002707) single kidney wet weight to body weight ratio (CMO:0000622) 13 69060519 86800898 Rat 619615 Bp80 Blood pressure QTL 80 0.0354 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 39754544 84754544 Rat 1581570 Eae17 Experimental allergic encephalomyelitis QTL 17 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 13 8897350 101631289 Rat 61340 Bp25 Blood pressure QTL 25 4.2 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 34535218 79535218 Rat 1581573 Uae36 Urinary albumin excretion QTL 36 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 5994833 77046787 Rat 1549897 Stresp12 Stress response QTL 12 3.35 stress-related behavior trait (VT:0010451) number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960) 13 38433408 83433408 Rat 724564 Uae11 Urinary albumin excretion QTL 11 5.7 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 13 59492522 77046890 Rat 7207885 Glom27 Glomerulus QTL 27 3.9 kidney glomerulus integrity trait (VT:0010546) kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139) 13 20605871 101339738 Rat 7387280 Uae43 Urinary albumin excretion QTL 43 5.69 0.4174 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 66451204 106807694 Rat 738027 Lnnr6 Liver neoplastic nodule remodeling QTL 6 3.3 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number (CMO:0001461) 13 74862117 85581182 Rat 738026 Lnnr5 Liver neoplastic nodule remodeling QTL 5 3.29 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number (CMO:0001461) 13 59874408 85581182 Rat 70181 BpQTLcluster11 Blood pressure QTL cluster 11 6.922 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 13 31241331 93395974 Rat 2293702 Bss34 Bone structure and strength QTL 34 4.61 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 13 65103704 106807694 Rat 61349 Bp31 Blood pressure QTL 31 5.75 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 13 37374509 82374509 Rat 2303563 Bw89 Body weight QTL 89 6 body mass (VT:0001259) body weight (CMO:0000012) 13 32284471 77284471 Rat 1354621 Rf47 Renal function QTL 47 3.7 kidney renin amount (VT:0010559) kidney renin level (CMO:0002166) 13 30395351 101056920 Rat 1581554 Pur11 Proteinuria QTL 11 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 5994833 77046787 Rat 12879477 Bp401 Blood pressure QTL 401 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 37262092 82262092 Rat 1331750 Bp220 Blood pressure QTL 220 2.98 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 13 37415584 82415584 Rat 1641901 Alcrsp6 Alcohol response QTL 6 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 13 52362171 97362171 Rat 12879475 Bp400 Blood pressure QTL 400 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 61825626 106807694 Rat 11530006 Niddm72 Non-insulin dependent diabetes mellitus QTL 72 0.001 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 13 74023918 80753406 Rat 1354666 Bp244 Blood pressure QTL 244 4.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 1 101056920 Rat 2293341 Glom15 Glomerulus QTL 15 9.1 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 13 74862117 101339893 Rat
RH128136
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 75,182,238 - 75,182,438 (+) MAPPER mRatBN7.2 Rnor_6.0 13 80,712,940 - 80,713,139 NCBI Rnor6.0 Rnor_5.0 13 85,607,599 - 85,607,798 UniSTS Rnor5.0 RGSC_v3.4 13 78,503,823 - 78,504,022 UniSTS RGSC3.4 Celera 13 74,919,468 - 74,919,667 UniSTS Cytogenetic Map 13 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
43
113
91
90
59
25
59
6
212
91
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000041908 ⟹ ENSRNOP00000044613
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 75,182,176 - 75,214,647 (-) Ensembl Rnor_6.0 Ensembl 13 80,712,882 - 80,745,347 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000081551 ⟹ ENSRNOP00000073105
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 75,182,176 - 75,214,647 (-) Ensembl Rnor_6.0 Ensembl 13 80,712,885 - 80,738,634 (-) Ensembl
RefSeq Acc Id:
NM_012792 ⟹ NP_036924
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 77,715,412 - 77,747,666 (-) NCBI mRatBN7.2 13 75,182,186 - 75,214,439 (-) NCBI Rnor_6.0 13 80,712,887 - 80,745,095 (-) NCBI Rnor_5.0 13 85,607,539 - 85,639,778 (-) NCBI RGSC_v3.4 13 78,503,770 - 78,536,359 (-) RGD Celera 13 74,919,415 - 74,951,610 (-) RGD
Sequence:
GAACATAAAGTCAGATTGCTAAACTTCTGTGTCGACTGAAAAACATGGTGAAGCGAGTTGCAATTGTGGGAGCTGGGGTCAGTGGCCTGGCCTCCATCAAGTGCTGCCTGGAAGAAGGACTAGAACCC
hide sequence
RefSeq Acc Id:
XM_006250145 ⟹ XP_006250207
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 77,715,405 - 77,741,334 (-) NCBI mRatBN7.2 13 75,182,184 - 75,208,111 (-) NCBI Rnor_6.0 13 80,713,286 - 80,738,763 (-) NCBI Rnor_5.0 13 85,607,539 - 85,639,778 (-) NCBI
Sequence:
TCCTGTCTGCTCTGGGATTGGAGCCTGGAGGATGGAGGCAAGCCAGTTCAGAATACAAGACTCTGCCCACCGAAGGGTCTGGTTTCAGCCACTCTGCCAGAAACTACAATTGCGTTAAAGACCACAAA
hide sequence
RefSeq Acc Id:
NP_036924 ⟸ NM_012792
- UniProtKB:
A0A8L2R702 (UniProtKB/TrEMBL)
- Sequence:
MVKRVAIVGAGVSGLASIKCCLEEGLEPTCFERSCDLGGLWRFTEHVEEGRASLYNSVVSNSSKEMSCYSDFPFPEDYPNFVPNSLFLEYLQLYATQFNLLRCIYFNTKVCSITKRPDFAVSGQWEVV
hide sequence
RefSeq Acc Id:
XP_006250207 ⟸ XM_006250145
- Peptide Label:
isoform X1
- UniProtKB:
Q6P7Q5 (UniProtKB/Swiss-Prot), P36365 (UniProtKB/Swiss-Prot), A6IDA3 (UniProtKB/TrEMBL), A0A8L2R702 (UniProtKB/TrEMBL)
- Sequence:
MVKRVAIVGAGVSGLASIKCCLEEGLEPTCFERSCDLGGLWRFTEHVEEGRASLYNSVVSNSSK
hide sequence
Ensembl Acc Id:
ENSRNOP00000044613 ⟸ ENSRNOT00000041908
Ensembl Acc Id:
ENSRNOP00000073105 ⟸ ENSRNOT00000081551
RGD ID: 13698943 Promoter ID: EPDNEW_R9468 Type: initiation region Name: Fmo1_1 Description: flavin containing monooxygenase 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 13 80,745,300 - 80,745,360 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2019-05-09
Fmo1
flavin containing dimethylaniline monoxygenase 1
Fmo1
flavin containing monooxygenase 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Fmo1
Flavin-containing monooxygenase 1
Symbol and Name status set to approved
70586 APPROVED
