Symbol:
Ephx1
Name:
epoxide hydrolase 1
RGD ID:
2557
Description:
Enables cis-stilbene-oxide hydrolase activity and enzyme binding activity. Involved in several processes, including cellular response to glucocorticoid stimulus; diol biosynthetic process; and liver development. Located in intracellular membrane-bounded organelle and membrane. Biomarker of aflatoxins-related hepatocellular carcinoma. Human ortholog(s) of this gene implicated in several diseases, including Leber hereditary optic neuropathy; anemia (multiple); hematologic cancer (multiple); respiratory system disease (multiple); and toxic encephalopathy. Orthologous to human EPHX1 (epoxide hydrolase 1); PARTICIPATES IN carbamazepine pharmacokinetics pathway; phenytoin pharmacodynamics pathway; bile acid transport pathway; INTERACTS WITH 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane; 1-naphthyl isothiocyanate; 1-nitropropane.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
epoxide hydratase; Epoxide hydrolase 1 (microsomal xenobiotic hydrolase; Epoxide hydrolase 1 (microsomal xenobiotic hydrolase); epoxide hydrolase 1, microsomal; epoxide hydrolase 1, microsomal (xenobiotic); liver microsomal xenobiotic epoxide hydrolase; mEH; MEH8; microsomal epoxide hydrolase
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
EPHX1 (epoxide hydrolase 1)
HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Ephx1 (epoxide hydrolase 1, microsomal)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ephx1 (epoxide hydrolase 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
EPHX1 (epoxide hydrolase 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
EPHX1 (epoxide hydrolase 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ephx1 (epoxide hydrolase 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
EPHX1 (epoxide hydrolase 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
EPHX1 (epoxide hydrolase 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ephx1 (epoxide hydrolase 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Ephx1 (epoxide hydrolase 1, microsomal)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
EPHX1 (epoxide hydrolase 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ephx1 (epoxide hydrolase 1, microsomal (xenobiotic))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|SonicParanoid)
Drosophila melanogaster (fruit fly):
Jheh1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Jheh2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Jheh3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
W01A11.1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
ephx1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoInspector|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 95,246,079 - 95,275,852 (-) NCBI GRCr8 mRatBN7.2 13 92,714,315 - 92,744,105 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 92,714,315 - 92,790,235 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 95,219,628 - 95,249,435 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 96,619,561 - 96,649,355 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 93,794,258 - 93,824,062 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 99,271,390 - 99,300,580 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 99,271,366 - 99,300,579 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 104,268,704 - 104,297,617 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 96,722,973 - 96,752,940 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 96,912,126 - 96,925,415 (-) NCBI Celera 13 92,256,740 - 92,285,424 (-) NCBI Celera RH 3.4 Map 13 631.9 RGD Cytogenetic Map 13 q26 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ephx1 Rat (1->4)-beta-D-glucan multiple interactions ISO Ephx1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of EPHX1 mRNA CTD PMID:36331819 Ephx1 Rat (2,4,5-trichlorophenoxy)acetic acid increases activity ISO Ephx1 (Mus musculus) 6480464 2 more ... CTD PMID:3032197 Ephx1 Rat (9R,10S)-9,10-epoxy-9,10-dihydrophenanthrene increases metabolic processing ISO Ephx1 (Mus musculus) 6480464 EPHX1 protein mutant form results in increased metabolism of 9 more ... CTD PMID:26838043 Ephx1 Rat (S)-mandelic acid multiple interactions ISO EPHX1 (Homo sapiens) 6480464 EPHX1 polymorphism affects the metabolism of [mandelic acid co-treated with phenylglyoxylic acid] CTD PMID:25562543 Ephx1 Rat 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane affects expression EXP 6480464 o and p'-DDT affects the expression of EPHX1 mRNA CTD PMID:17984292 Ephx1 Rat 1,1-dichloroethene increases expression ISO Ephx1 (Mus musculus) 6480464 vinylidene chloride results in increased expression of EPHX1 mRNA CTD PMID:26682919 Ephx1 Rat 1,2-dibromoethane decreases expression ISO Ephx1 (Mus musculus) 6480464 Ethylene Dibromide results in decreased expression of EPHX1 mRNA CTD PMID:17311802 Ephx1 Rat 1,2-dihydronaphthalene-1,2-diol multiple interactions ISO Ephx1 (Mus musculus) 6480464 [EPHX1 protein results in increased metabolism of naphthalene] which results in increased chemical synthesis of 1 more ... CTD PMID:18363382 and PMID:26840748 Ephx1 Rat 1,2-dimethylhydrazine increases expression ISO Ephx1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of EPHX1 mRNA CTD PMID:22206623 Ephx1 Rat 1,3,5-trimethylbenzene increases expression ISO EPHX1 (Homo sapiens) 6480464 mesitylene results in increased expression of EPHX1 mRNA CTD PMID:33269480 Ephx1 Rat 1,4-dioxane increases expression ISO Ephx1 (Mus musculus) 6480464 1 and 4-dioxane results in increased expression of EPHX1 mRNA CTD PMID:33693819 Ephx1 Rat 1-benzofuran increases expression ISO Ephx1 (Mus musculus) 6480464 benzofuran results in increased expression of EPHX1 mRNA CTD PMID:17311802 Ephx1 Rat 1-benzofuran affects expression ISO Ephx1 (Mus musculus) 6480464 benzofuran affects the expression of EPHX1 mRNA CTD PMID:17114358 Ephx1 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of EPHX1 mRNA CTD PMID:30723492 Ephx1 Rat 1-nitropropane decreases expression EXP 6480464 1-nitropropane results in decreased expression of EPHX1 mRNA CTD PMID:17070881 Ephx1 Rat 17alpha-ethynylestradiol affects expression ISO Ephx1 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of EPHX1 mRNA CTD PMID:17555576 Ephx1 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of EPHX1 mRNA CTD PMID:16926038 Ephx1 Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of EPHX1 mRNA CTD PMID:16174780 and PMID:29097150 Ephx1 Rat 17alpha-ethynylestradiol multiple interactions ISO Ephx1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in decreased expression of EPHX1 mRNA CTD PMID:17942748 Ephx1 Rat 17alpha-ethynylestradiol decreases expression ISO Ephx1 (Mus musculus) 6480464 Ethinyl Estradiol results in decreased expression of EPHX1 mRNA CTD PMID:16174780 Ephx1 Rat 17alpha-ethynylestradiol increases expression ISO Ephx1 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of EPHX1 mRNA CTD PMID:17942748 Ephx1 Rat 17beta-estradiol affects expression ISO EPHX1 (Homo sapiens) 6480464 Estradiol affects the expression of EPHX1 mRNA CTD PMID:14699072 Ephx1 Rat 17beta-estradiol affects expression ISO Ephx1 (Mus musculus) 6480464 Estradiol affects the expression of EPHX1 mRNA CTD PMID:39298647 Ephx1 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of EPHX1 protein CTD PMID:32145629 Ephx1 Rat 17beta-estradiol multiple interactions ISO EPHX1 (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of EPHX1 mRNA CTD PMID:30165855 Ephx1 Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of EPHX1 mRNA CTD PMID:26496021 Ephx1 Rat 17beta-estradiol 3-benzoate decreases expression EXP 6480464 estradiol 3-benzoate results in decreased expression of EPHX1 protein CTD PMID:24752506 Ephx1 Rat 1H-pyrazole increases expression ISO Ephx1 (Mus musculus) 6480464 pyrazole results in increased expression of EPHX1 mRNA CTD PMID:17945193 Ephx1 Rat 2,2',4,4',5,5'-hexachlorobiphenyl increases activity EXP 6480464 2 more ... CTD PMID:1372805 Ephx1 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Ephx1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with 2 more ... CTD PMID:28433925 Ephx1 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression EXP 6480464 2 more ... CTD PMID:31826744 and PMID:32679240 Ephx1 Rat 2,2,2-tetramine multiple interactions EXP 6480464 Trientine inhibits the reaction [Streptozocin results in increased expression of EPHX1 protein] CTD PMID:19634143 Ephx1 Rat 2,2-Bis(bromomethyl)propane-1,3-diol increases expression ISO Ephx1 (Mus musculus) 6480464 2 more ... CTD PMID:17311802 Ephx1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Ephx1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with 2 more ... CTD PMID:17942748 more ... Ephx1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Ephx1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of EPHX1 mRNA CTD PMID:33956508 Ephx1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Ephx1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of EPHX1 mRNA and Tetrachlorodibenzodioxin results in increased expression of EPHX1 protein CTD PMID:15328365 more ... Ephx1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Ephx1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of EPHX1 mRNA CTD PMID:20702594 and PMID:21570461 Ephx1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of EPHX1 mRNA CTD PMID:16960034 more ... Ephx1 Rat 2,3,7,8-Tetrachlorodibenzofuran affects expression ISO Ephx1 (Mus musculus) 6480464 2 more ... CTD PMID:20702594 Ephx1 Rat 2,3-dimethoxynaphthalene-1,4-dione decreases expression ISO EPHX1 (Homo sapiens) 6480464 2 more ... CTD PMID:17547211 Ephx1 Rat 2,4,6-tribromophenol increases expression ISO EPHX1 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Ephx1 Rat 2,4,6-trinitrotoluene affects expression EXP 6480464 Trinitrotoluene affects the expression of EPHX1 mRNA CTD PMID:21346803 Ephx1 Rat 2,4-D increases activity ISO Ephx1 (Mus musculus) 6480464 2 and 4-Dichlorophenoxyacetic Acid results in increased activity of EPHX1 protein CTD PMID:3032197 Ephx1 Rat 2,4-diaminotoluene increases expression EXP 6480464 2 and 4-diaminotoluene results in increased expression of EPHX1 mRNA CTD PMID:17070881 Ephx1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Ephx1 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Ephx1 Rat 2,4-dinitrotoluene increases activity ISO Ephx1 (Mus musculus) 6480464 2 and 4-dinitrotoluene results in increased activity of EPHX1 protein CTD PMID:3621371 Ephx1 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of EPHX1 mRNA CTD PMID:21346803 Ephx1 Rat 2,6-diaminotoluene decreases expression EXP 6480464 2 and 6-diaminotoluene results in decreased expression of EPHX1 mRNA CTD PMID:17070881 Ephx1 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of EPHX1 mRNA CTD PMID:21346803 Ephx1 Rat 2,8-bis-Trifluoromethyl-4-quinoline carboxylic acid increases expression ISO EPHX1 (Homo sapiens) 6480464 Ro 21-5104 results in increased expression of EPHX1 mRNA CTD PMID:25313206 Ephx1 Rat 2-acetamidofluorene increases expression EXP 6480464 2-Acetylaminofluorene results in increased expression of EPHX1 mRNA CTD PMID:17070881 Ephx1 Rat 2-acetamidofluorene increases expression ISO Ephx1 (Mus musculus) 6480464 2-Acetylaminofluorene results in increased expression of EPHX1 mRNA CTD PMID:17317680 and PMID:21607683 Ephx1 Rat 2-nitro-p-phenylenediamine increases expression EXP 6480464 2-nitro-4-phenylenediamine results in increased expression of EPHX1 mRNA CTD PMID:17070881 Ephx1 Rat 2-nitrofluorene increases expression EXP 6480464 2-nitrofluorene results in increased expression of EPHX1 mRNA CTD PMID:14600272 more ... Ephx1 Rat 2-nitropropane increases expression EXP 6480464 2-nitropropane results in increased expression of EPHX1 mRNA CTD PMID:17070881 Ephx1 Rat 2-Oxohexane increases activity EXP 6480464 Methyl n-Butyl Ketone results in increased activity of EPHX1 protein CTD PMID:1372805 Ephx1 Rat 2-tert-butylhydroquinone increases expression EXP 6480464 2-tert-butylhydroquinone results in increased expression of EPHX1 mRNA CTD PMID:20650352 Ephx1 Rat 2-tert-butylhydroquinone multiple interactions ISO EPHX1 (Homo sapiens) 6480464 NFE2L2 mutant form inhibits the reaction [2-tert-butylhydroquinone results in increased expression of EPHX1 exon] CTD PMID:24704207 Ephx1 Rat 2-tert-butylhydroquinone increases expression ISO EPHX1 (Homo sapiens) 6480464 2-tert-butylhydroquinone results in increased expression of EPHX1 exon and 2-tert-butylhydroquinone results in increased expression of EPHX1 protein alternative form CTD PMID:24704207 Ephx1 Rat 3',4'-dimethoxyflavone multiple interactions ISO EPHX1 (Homo sapiens) 6480464 3' and 4'-dimethoxyflavone inhibits the reaction [Benzo(a)pyrene results in increased activity of EPHX1 protein] CTD PMID:16484233 Ephx1 Rat 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3 more ... CTD PMID:20959002 Ephx1 Rat 3,3',4,4',5-pentachlorobiphenyl increases expression ISO Ephx1 (Mus musculus) 6480464 3 more ... CTD PMID:23994337 Ephx1 Rat 3,4-dihydrocoumarin decreases expression ISO Ephx1 (Mus musculus) 6480464 3 and 4-dihydrocoumarin results in decreased expression of EPHX1 mRNA CTD PMID:22016648 Ephx1 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of EPHX1 mRNA and alpha-Chlorohydrin results in increased expression of EPHX1 protein CTD PMID:28522335 and PMID:34915118 Ephx1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO EPHX1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of EPHX1 mRNA more ... CTD PMID:28628672 Ephx1 Rat 3-methylcholanthrene increases activity ISO Ephx1 (Mus musculus) 6480464 Methylcholanthrene results in increased activity of EPHX1 protein CTD PMID:3621371 Ephx1 Rat 3-methylcholanthrene increases expression EXP 6480464 Methylcholanthrene results in increased expression of EPHX1 mRNA CTD PMID:23273579 Ephx1 Rat 3H-1,2-dithiole-3-thione increases expression EXP 6480464 1 and 2-dithiol-3-thione results in increased expression of EPHX1 mRNA CTD PMID:19162173 and PMID:19695238 Ephx1 Rat 4,4'-sulfonyldiphenol multiple interactions ISO EPHX1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of EPHX1 mRNA CTD PMID:28628672 Ephx1 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of EPHX1 mRNA CTD PMID:36041667 Ephx1 Rat 4,4'-sulfonyldiphenol affects expression ISO Ephx1 (Mus musculus) 6480464 bisphenol S affects the expression of EPHX1 mRNA CTD PMID:39298647 Ephx1 Rat 4,4'-sulfonyldiphenol decreases expression ISO Ephx1 (Mus musculus) 6480464 bisphenol S results in decreased expression of EPHX1 mRNA CTD PMID:30951980 Ephx1 Rat 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one increases expression EXP 6480464 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone results in increased expression of EPHX1 mRNA CTD PMID:14600272 more ... Ephx1 Rat 4-acetylaminofluorene increases expression EXP 6480464 4-acetylaminofluorene results in increased expression of EPHX1 mRNA CTD PMID:17070881 Ephx1 Rat 4-amino-2,6-dinitrotoluene affects expression EXP 6480464 4-amino-2 and 6-dinitrotoluene affects the expression of EPHX1 mRNA CTD PMID:21346803 Ephx1 Rat 4-hydroxynon-2-enal increases expression ISO Ephx1 (Mus musculus) 6480464 4-hydroxy-2-nonenal results in increased expression of EPHX1 mRNA CTD PMID:19191707 Ephx1 Rat 4-hydroxyphenyl retinamide increases expression ISO Ephx1 (Mus musculus) 6480464 Fenretinide results in increased expression of EPHX1 mRNA CTD PMID:28973697 Ephx1 Rat 4-nitro-1,2-phenylenediamine increases expression EXP 6480464 1 and 2-diamino-4-nitrobenzene results in increased expression of EPHX1 mRNA CTD PMID:17070881 Ephx1 Rat 4-vinylcyclohexene dioxide decreases expression EXP 6480464 4-vinyl-1-cyclohexene dioxide results in decreased expression of EPHX1 mRNA CTD PMID:8806858 Ephx1 Rat 4-vinylcyclohexene dioxide increases metabolic processing EXP 6480464 EPHX1 protein results in increased metabolism of 4-vinyl-1-cyclohexene dioxide CTD PMID:22061827 Ephx1 Rat 4-vinylcyclohexene dioxide increases expression ISO Ephx1 (Mus musculus) 6480464 4-vinyl-1-cyclohexene dioxide results in increased expression of EPHX1 mRNA and 4-vinyl-1-cyclohexene dioxide results in increased expression of EPHX1 protein CTD PMID:22061827 Ephx1 Rat 4-vinylcyclohexene dioxide increases expression EXP 6480464 4-vinyl-1-cyclohexene dioxide results in increased expression of EPHX1 mRNA and 4-vinyl-1-cyclohexene dioxide results in increased expression of EPHX1 protein CTD PMID:22061827 and PMID:8806858 Ephx1 Rat 4-vinylcyclohexene dioxide increases metabolic processing ISO Ephx1 (Mus musculus) 6480464 EPHX1 protein results in increased metabolism of 4-vinyl-1-cyclohexene dioxide CTD PMID:22061827 Ephx1 Rat 4-vinylcyclohexene dioxide multiple interactions EXP 6480464 [cyclohexene oxide results in decreased activity of EPHX1 protein] which results in increased susceptibility to 4-vinyl-1-cyclohexene dioxide CTD PMID:22061827 Ephx1 Rat 5,6alpha-epoxy-5alpha-cholestan-3beta-ol increases metabolic processing ISO Ephx1 (Mus musculus) 6480464 EPHX1 protein results in increased metabolism of cholesterol alpha-oxide CTD PMID:2043152 Ephx1 Rat 5,6alpha-epoxy-5alpha-cholestan-3beta-ol multiple interactions ISO Ephx1 (Mus musculus) 6480464 disparlure promotes the reaction [EPHX1 protein results in increased metabolism of cholesterol alpha-oxide] and Lanosterol analog inhibits the reaction [EPHX1 protein results in increased metabolism of cholesterol alpha-oxide] CTD PMID:2043152 Ephx1 Rat 5-aza-2'-deoxycytidine increases expression ISO EPHX1 (Homo sapiens) 6480464 Decitabine results in increased expression of EPHX1 mRNA CTD PMID:19194470 Ephx1 Rat 5-fluorouracil affects response to substance ISO EPHX1 (Homo sapiens) 6480464 EPHX1 protein affects the susceptibility to Fluorouracil CTD PMID:16217747 Ephx1 Rat 5-fluorouracil increases expression ISO EPHX1 (Homo sapiens) 6480464 Fluorouracil results in increased expression of EPHX1 mRNA CTD PMID:15205334 Ephx1 Rat 7,12-dimethyltetraphene multiple interactions ISO EPHX1 (Homo sapiens) 6480464 EPHX1 protein promotes the reaction [CYP1A1 protein results in increased metabolism of 9 more ... CTD PMID:8961944 Ephx1 Rat 7,12-dimethyltetraphene increases expression EXP 6480464 9 more ... CTD PMID:19027032 and PMID:24576726 Ephx1 Rat 7,12-dimethyltetraphene decreases expression EXP 6480464 9 more ... CTD PMID:12376462 Ephx1 Rat 7,12-dimethyltetraphene affects response to substance ISO Ephx1 (Mus musculus) 6480464 EPHX1 protein affects the susceptibility to 9 more ... CTD PMID:15331171 and PMID:17442664 Ephx1 Rat 7,12-dimethyltetraphene increases expression ISO Ephx1 (Mus musculus) 6480464 9 more ... CTD PMID:17204581 and PMID:19027032 Ephx1 Rat 7,12-dimethyltetraphene increases response to substance ISO Ephx1 (Mus musculus) 6480464 EPHX1 protein results in increased susceptibility to 9 more ... CTD PMID:11323178 and PMID:19027032 Ephx1 Rat 7,12-dimethyltetraphene multiple interactions ISO Ephx1 (Mus musculus) 6480464 [cyclohexene oxide results in decreased activity of EPHX1 protein] which results in decreased susceptibility to 9 more ... CTD PMID:17204581 more ... Ephx1 Rat 8,9-EET affects hydrolysis ISO Ephx1 (Mus musculus) 6480464 EPHX1 protein affects the hydrolysis of 8 and 9-epoxyeicosatrienoic acid CTD PMID:28975360 Ephx1 Rat 8-Br-cAMP increases expression ISO EPHX1 (Homo sapiens) 6480464 8-Bromo Cyclic Adenosine Monophosphate results in increased expression of EPHX1 mRNA CTD PMID:22079614 Ephx1 Rat 9,10-epoxy-9,10-dihydrophenanthrene increases metabolic processing ISO Ephx1 (Mus musculus) 6480464 EPHX1 protein mutant form results in increased metabolism of 9 more ... CTD PMID:26838043 Ephx1 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of EPHX1 mRNA CTD PMID:31881176 Ephx1 Rat acrylamide multiple interactions ISO EPHX1 (Homo sapiens) 6480464 [EPHX1 gene polymorphism affects the metabolism of Acrylamide] which affects the chemical synthesis of glycidamide analog CTD PMID:21402133 Ephx1 Rat acrylamide increases expression ISO EPHX1 (Homo sapiens) 6480464 Acrylamide results in increased expression of EPHX1 mRNA CTD PMID:32763439 Ephx1 Rat acrylamide affects metabolic processing ISO EPHX1 (Homo sapiens) 6480464 EPHX1 gene polymorphism affects the metabolism of Acrylamide CTD PMID:21402133 Ephx1 Rat actinomycin D multiple interactions ISO EPHX1 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of EPHX1 protein CTD PMID:38460933 Ephx1 Rat aflatoxin B1 increases response to substance ISO EPHX1 (Homo sapiens) 6480464 EPHX1 gene mutant form results in increased susceptibility to Aflatoxin B1 CTD PMID:7892276 Ephx1 Rat aflatoxin B1 increases activity EXP 152998935 aflatoxin increases Ephx1 enzyme activity in rat liver microsomes RGD Ephx1 Rat aflatoxin B1 decreases methylation ISO EPHX1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of EPHX1 gene CTD PMID:27153756 Ephx1 Rat aflatoxin B1 decreases expression ISO EPHX1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of EPHX1 mRNA CTD PMID:27153756 Ephx1 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of EPHX1 mRNA CTD PMID:14600272 more ... Ephx1 Rat aflatoxin B1 affects response to substance ISO Ephx1 (Mus musculus) 6480464 EPHX1 gene SNP affects the susceptibility to Aflatoxin B1 CTD PMID:12907637 Ephx1 Rat all-trans-retinoic acid multiple interactions ISO Ephx1 (Mus musculus) 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of EPHX1 mRNA CTD PMID:30951980 Ephx1 Rat all-trans-retinoic acid decreases expression ISO EPHX1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of EPHX1 mRNA CTD PMID:33167477 Ephx1 Rat alpha-hexachlorocyclohexane increases expression EXP 6480464 alpha-hexachlorocyclohexane results in increased expression of EPHX1 mRNA CTD PMID:16940010 Ephx1 Rat alpha-hexachlorocyclohexane increases activity EXP 6480464 alpha-hexachlorocyclohexane results in increased activity of EPHX1 protein CTD PMID:1372805 Ephx1 Rat amiodarone affects expression EXP 6480464 Amiodarone affects the expression of EPHX1 mRNA CTD PMID:18355885 Ephx1 Rat amitriptyline affects expression EXP 6480464 Amitriptyline affects the expression of EPHX1 mRNA CTD PMID:18355885 Ephx1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of EPHX1 mRNA CTD PMID:16483693 Ephx1 Rat aniline increases expression ISO Ephx1 (Mus musculus) 6480464 aniline results in increased expression of EPHX1 mRNA CTD PMID:22016648 Ephx1 Rat antimonite multiple interactions ISO EPHX1 (Homo sapiens) 6480464 [Antimony Potassium Tartrate results in increased abundance of antimonite] which results in increased expression of EPHX1 mRNA CTD PMID:32076005 Ephx1 Rat aristolochic acid A increases expression EXP 6480464 aristolochic acid I results in increased expression of EPHX1 mRNA CTD PMID:17483316 Ephx1 Rat aristolochic acid A increases expression ISO EPHX1 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of EPHX1 mRNA CTD PMID:33212167 Ephx1 Rat aristolochic acid A multiple interactions EXP 6480464 [aristolochic acid I co-treated with aristolochic acid II] results in increased expression of EPHX1 mRNA CTD PMID:23912714 Ephx1 Rat Aroclor 1254 increases expression ISO EPHX1 (Homo sapiens) 6480464 Chlorodiphenyl (54% Chlorine) results in increased expression of EPHX1 mRNA CTD PMID:17851650 Ephx1 Rat Aroclor 1254 increases expression EXP 6480464 Chlorodiphenyl (54% Chlorine) results in increased expression of EPHX1 mRNA CTD PMID:18178546 Ephx1 Rat arsenite(3-) multiple interactions ISO Ephx1 (Mus musculus) 6480464 TRP53 protein affects the reaction [arsenite results in increased expression of EPHX1 mRNA] CTD PMID:18929588 Ephx1 Rat arsenite(3-) multiple interactions ISO EPHX1 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of arsenite] which results in increased expression of EPHX1 mRNA CTD PMID:32076005 Ephx1 Rat arsenite(3-) increases expression ISO Ephx1 (Mus musculus) 6480464 arsenite results in increased expression of EPHX1 mRNA CTD PMID:18929588 Ephx1 Rat arsenous acid decreases expression ISO EPHX1 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of EPHX1 mRNA CTD PMID:17547211 Ephx1 Rat asbestos affects response to substance ISO EPHX1 (Homo sapiens) 6480464 EPHX1 gene polymorphism affects the susceptibility to Asbestos and EPHX1 protein affects the susceptibility to Asbestos CTD PMID:15993904 and PMID:17159790 Ephx1 Rat atazanavir sulfate multiple interactions ISO EPHX1 (Homo sapiens) 6480464 [Atazanavir Sulfate co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in decreased expression of EPHX1 mRNA CTD PMID:32152650 Ephx1 Rat atazanavir sulfate decreases expression ISO EPHX1 (Homo sapiens) 6480464 Atazanavir Sulfate results in decreased expression of EPHX1 mRNA CTD PMID:32152650 Ephx1 Rat atrazine increases expression ISO EPHX1 (Homo sapiens) 6480464 Atrazine results in increased expression of EPHX1 mRNA CTD PMID:22378314 Ephx1 Rat azathioprine increases expression ISO EPHX1 (Homo sapiens) 6480464 Azathioprine results in increased expression of EPHX1 mRNA CTD PMID:22623647 Ephx1 Rat barbiturates increases activity EXP 6480464 Barbiturates results in increased activity of EPHX1 protein CTD PMID:1372805 Ephx1 Rat benzene affects response to substance ISO Ephx1 (Mus musculus) 6480464 EPHX1 protein affects the susceptibility to Benzene CTD PMID:12655032 Ephx1 Rat benzene increases expression ISO EPHX1 (Homo sapiens) 6480464 Benzene results in increased expression of EPHX1 mRNA CTD PMID:33269480 Ephx1 Rat benzene affects response to substance ISO EPHX1 (Homo sapiens) 6480464 EPHX1 polymorphism affects the susceptibility to Benzene CTD PMID:18784359 and PMID:18836923 Ephx1 Rat benzene affects metabolic processing ISO EPHX1 (Homo sapiens) 6480464 EPHX1 protein affects the metabolism of Benzene CTD PMID:10511268 Ephx1 Rat benzene multiple interactions ISO EPHX1 (Homo sapiens) 6480464 [EPHX1 protein affects the metabolism of Benzene] which affects the abundance of muconic acid CTD PMID:10511268 Ephx1 Rat benzene multiple interactions EXP 6480464 EPHX1 protein promotes the reaction [[CYP2E1 protein results in increased metabolism of Benzene] which results in increased chemical synthesis of Benzene metabolite] more ... CTD PMID:8211999 Ephx1 Rat benzene increases expression ISO Ephx1 (Mus musculus) 6480464 Benzene results in increased expression of EPHX1 mRNA CTD PMID:17311802 Ephx1 Rat benzene increases metabolic processing ISO EPHX1 (Homo sapiens) 6480464 EPHX1 protein results in increased metabolism of Benzene CTD PMID:17885617 Ephx1 Rat benzene affects expression EXP 6480464 Benzene affects the expression of EPHX1 mRNA CTD PMID:15878777 Ephx1 Rat benzene multiple interactions ISO Ephx1 (Mus musculus) 6480464 EPHX1 protein affects the reaction [Benzene results in increased expression of CDKN1A mRNA] CTD PMID:12655032 Ephx1 Rat benzo[a]pyrene multiple interactions ISO EPHX1 (Homo sapiens) 6480464 3' more ... CTD PMID:15298956 more ... Ephx1 Rat benzo[a]pyrene decreases expression ISO EPHX1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of EPHX1 mRNA CTD PMID:32234424 Ephx1 Rat benzo[a]pyrene increases methylation ISO EPHX1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of EPHX1 3' UTR and Benzo(a)pyrene results in increased methylation of EPHX1 5' UTR CTD PMID:27901495 Ephx1 Rat benzo[a]pyrene decreases methylation ISO EPHX1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of EPHX1 exon and Benzo(a)pyrene results in decreased methylation of EPHX1 promoter CTD PMID:27901495 Ephx1 Rat benzo[a]pyrene multiple interactions EXP 6480464 [[CYP1A1 protein co-treated with POR protein co-treated with EPHX1 protein] results in increased oxidation of Benzo(a)pyrene] which results in increased abundance of benzo(a)pyrene 7 more ... CTD PMID:24025706 and PMID:24530354 Ephx1 Rat benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of EPHX1 mRNA CTD PMID:24025706 Ephx1 Rat benzo[a]pyrene increases activity ISO EPHX1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased activity of EPHX1 protein CTD PMID:16484233 Ephx1 Rat benzo[a]pyrene increases expression ISO Ephx1 (Mus musculus) 6480464 Benzo(a)pyrene metabolite results in increased expression of EPHX1 mRNA more ... CTD PMID:19770486 more ... Ephx1 Rat benzo[a]pyrene increases expression ISO EPHX1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of EPHX1 mRNA CTD PMID:15735009 more ... Ephx1 Rat benzo[a]pyrene multiple interactions ISO Ephx1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of EPHX1 mRNA more ... CTD PMID:22759596 more ... Ephx1 Rat Benzo[a]pyrene-7,8-diol multiple interactions EXP 6480464 [[CYP1A1 protein co-treated with POR protein co-treated with EPHX1 protein] results in increased oxidation of Benzo(a)pyrene] which results in increased abundance of benzo(a)pyrene 7 and 8-dihydrodiol CTD PMID:24530354 Ephx1 Rat Benzo[a]pyrene-7,8-oxide multiple interactions EXP 6480464 CYP2C11 protein promotes the reaction [EPHX1 protein affects the hydrolysis of benzo(a)pyrene 7 and 8-oxide] CTD PMID:12051674 Ephx1 Rat benzo[b]fluoranthene increases expression ISO Ephx1 (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of EPHX1 mRNA CTD PMID:26377693 Ephx1 Rat benzo[b]fluoranthene multiple interactions ISO Ephx1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of EPHX1 mRNA CTD PMID:27858113 Ephx1 Rat benzo[c]phenanthrene multiple interactions ISO Ephx1 (Mus musculus) 6480464 EPHX1 protein promotes the reaction [CYP1A1 protein results in increased metabolism of benzo(c)phenanthrene] and EPHX1 protein promotes the reaction [CYP1A2 protein results in increased metabolism of benzo(c)phenanthrene] CTD PMID:8961944 Ephx1 Rat benzo[c]phenanthrene multiple interactions ISO EPHX1 (Homo sapiens) 6480464 EPHX1 protein promotes the reaction [CYP1A1 protein results in increased metabolism of benzo(c)phenanthrene] and EPHX1 protein promotes the reaction [CYP1A2 protein results in increased metabolism of benzo(c)phenanthrene] CTD PMID:8961944 Ephx1 Rat benzothiazole increases expression EXP 6480464 benzothiazole results in increased expression of EPHX1 mRNA CTD PMID:8951341 Ephx1 Rat beta-naphthoflavone increases expression ISO EPHX1 (Homo sapiens) 6480464 beta-Naphthoflavone results in increased expression of EPHX1 mRNA CTD PMID:22258563 Ephx1 Rat beta-naphthoflavone increases expression ISO Ephx1 (Mus musculus) 6480464 beta-Naphthoflavone results in increased expression of EPHX1 mRNA CTD PMID:23994337 Ephx1 Rat beta-naphthoflavone decreases activity ISO Ephx1 (Mus musculus) 6480464 beta-Naphthoflavone results in decreased activity of EPHX1 protein CTD PMID:3621371 Ephx1 Rat bexarotene increases expression EXP 6480464 bexarotene results in increased expression of EPHX1 mRNA CTD PMID:23292798 Ephx1 Rat bifenthrin increases expression ISO Ephx1 (Mus musculus) 6480464 bifenthrin results in increased expression of EPHX1 mRNA CTD PMID:26071804 Ephx1 Rat bis(2-ethylhexyl) phthalate increases expression ISO Ephx1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of EPHX1 mRNA and Diethylhexyl Phthalate results in increased expression of EPHX1 protein CTD PMID:19850644 more ... Ephx1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Ephx1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of EPHX1 mRNA CTD PMID:34319233 Ephx1 Rat bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of EPHX1 mRNA CTD PMID:35970509 Ephx1 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Ephx1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with 2 more ... CTD PMID:28433925 Ephx1 Rat bis(2-ethylhexyl) phthalate increases activity ISO Ephx1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased activity of EPHX1 protein CTD PMID:3621371 Ephx1 Rat bis(2-ethylhexyl) phthalate decreases activity EXP 6480464 Diethylhexyl Phthalate results in decreased activity of EPHX1 protein CTD PMID:10528994 Ephx1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of EPHX1 mRNA and bisphenol A results in decreased expression of EPHX1 protein CTD PMID:24752506 more ... Ephx1 Rat bisphenol A decreases expression ISO EPHX1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of EPHX1 protein CTD PMID:31675489 and PMID:37567409 Ephx1 Rat bisphenol A increases methylation ISO EPHX1 (Homo sapiens) 6480464 bisphenol A results in increased methylation of EPHX1 gene CTD PMID:31601247 Ephx1 Rat bisphenol A decreases expression ISO Ephx1 (Mus musculus) 6480464 bisphenol A results in decreased expression of EPHX1 mRNA CTD PMID:32156529 and PMID:33221593 Ephx1 Rat bisphenol A increases expression ISO EPHX1 (Homo sapiens) 6480464 bisphenol A results in increased expression of EPHX1 mRNA and bisphenol A results in increased expression of EPHX1 protein CTD PMID:29275510 and PMID:33376534 Ephx1 Rat bisphenol A affects expression ISO EPHX1 (Homo sapiens) 6480464 bisphenol A affects the expression of EPHX1 mRNA CTD PMID:30903817 Ephx1 Rat bisphenol A multiple interactions ISO Ephx1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with 2 more ... CTD PMID:28433925 Ephx1 Rat bisphenol A multiple interactions ISO EPHX1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of EPHX1 gene and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of EPHX1 mRNA CTD PMID:28628672 and PMID:31601247 Ephx1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of EPHX1 mRNA and bisphenol A results in increased expression of EPHX1 protein CTD PMID:27208089 Ephx1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of EPHX1 mRNA and bisphenol A affects the expression of EPHX1 protein CTD PMID:25181051 more ... Ephx1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of EPHX1 mRNA and [bisphenol A co-treated with Estradiol] results in decreased expression of EPHX1 mRNA CTD PMID:26496021 and PMID:36041667 Ephx1 Rat bisphenol A affects response to substance ISO EPHX1 (Homo sapiens) 6480464 EPHX1 polymorphism affects the susceptibility to bisphenol A CTD PMID:26922413 Ephx1 Rat bisphenol AF increases expression ISO EPHX1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of EPHX1 protein CTD PMID:34186270 Ephx1 Rat Bisphenol B increases expression ISO EPHX1 (Homo sapiens) 6480464 bisphenol B results in increased expression of EPHX1 protein CTD PMID:34186270 Ephx1 Rat bisphenol F multiple interactions ISO EPHX1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of EPHX1 mRNA CTD PMID:28628672 Ephx1 Rat bisphenol F increases expression ISO EPHX1 (Homo sapiens) 6480464 bisphenol F results in increased expression of EPHX1 protein CTD PMID:34186270 Ephx1 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of EPHX1 mRNA CTD PMID:36041667 Ephx1 Rat bisphenol F multiple interactions ISO Ephx1 (Mus musculus) 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of EPHX1 mRNA CTD PMID:30951980 Ephx1 Rat bromobenzene increases expression EXP 6480464 bromobenzene results in increased expression of EPHX1 mRNA CTD PMID:12628495 more ... Ephx1 Rat buspirone decreases expression EXP 6480464 Buspirone results in decreased expression of EPHX1 mRNA CTD PMID:24136188 Ephx1 Rat buta-1,3-diene increases response to substance ISO EPHX1 (Homo sapiens) 6480464 EPHX1 5' UTR polymorphism results in increased susceptibility to 1 more ... CTD PMID:11238181 more ... Ephx1 Rat buta-1,3-diene increases response to substance ISO Ephx1 (Mus musculus) 6480464 EPHX1 gene mutant form results in increased susceptibility to 1 and 3-butadiene CTD PMID:12929123 and PMID:16730686 Ephx1 Rat buta-1,3-diene multiple interactions ISO EPHX1 (Homo sapiens) 6480464 GSTM1 gene polymorphism promotes the reaction [EPHX1 gene polymorphism results in increased susceptibility to 1 more ... CTD PMID:11238181 Ephx1 Rat butanal decreases expression ISO EPHX1 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of EPHX1 mRNA CTD PMID:26079696 Ephx1 Rat butylated hydroxyanisole increases activity ISO Ephx1 (Mus musculus) 6480464 Butylated Hydroxyanisole results in increased activity of EPHX1 protein CTD PMID:3621371 Ephx1 Rat butyric acid multiple interactions ISO EPHX1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the reaction [Butyric Acid results in decreased expression of EPHX1 mRNA] CTD PMID:30439556 Ephx1 Rat butyric acid decreases expression ISO EPHX1 (Homo sapiens) 6480464 Butyric Acid results in decreased expression of EPHX1 mRNA CTD PMID:30439556 Ephx1 Rat cadmium acetate affects expression EXP 6480464 cadmium acetate affects the expression of EPHX1 mRNA CTD PMID:16249259 Ephx1 Rat cadmium atom increases expression EXP 6480464 Cadmium results in increased expression of EPHX1 mRNA CTD PMID:17327699 Ephx1 Rat cadmium dichloride decreases expression ISO Ephx1 (Mus musculus) 6480464 Cadmium Chloride results in decreased expression of EPHX1 mRNA CTD PMID:20061341 Ephx1 Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of EPHX1 mRNA CTD PMID:25993096 Ephx1 Rat cadmium dichloride increases expression ISO Ephx1 (Mus musculus) 6480464 Cadmium Chloride results in increased expression of EPHX1 mRNA CTD PMID:24982889 Ephx1 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of EPHX1 mRNA CTD PMID:17327699 Ephx1 Rat cannabidiol increases expression ISO Ephx1 (Mus musculus) 6480464 Cannabidiol results in increased expression of EPHX1 mRNA CTD PMID:27256343 Ephx1 Rat captan increases expression ISO Ephx1 (Mus musculus) 6480464 Captan results in increased expression of EPHX1 mRNA CTD PMID:31558096 Ephx1 Rat carbamazepine increases expression ISO EPHX1 (Homo sapiens) 6480464 Carbamazepine results in increased expression of EPHX1 mRNA CTD PMID:17112801 Ephx1 Rat carbamazepine affects response to substance ISO EPHX1 (Homo sapiens) 6480464 EPHX1 gene SNP affects the susceptibility to Carbamazepine and EPHX1 protein affects the susceptibility to Carbamazepine CTD PMID:19620853 and PMID:26555147 Ephx1 Rat carbamazepine increases expression EXP 6480464 Carbamazepine results in increased expression of EPHX1 mRNA CTD PMID:17381134 Ephx1 Rat carbamazepine-10,11-epoxide multiple interactions ISO EPHX1 (Homo sapiens) 6480464 [EPHX1 gene SNP affects the metabolism of carbamazepine epoxide] which affects the chemical synthesis of 10 more ... CTD PMID:15692831 Ephx1 Rat carbon nanotube decreases expression ISO Ephx1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Ephx1 Rat carmustine decreases expression ISO EPHX1 (Homo sapiens) 6480464 Carmustine results in decreased expression of EPHX1 mRNA CTD PMID:15980968 Ephx1 Rat catechol multiple interactions EXP 6480464 EPHX1 protein promotes the reaction [[CYP2E1 protein results in increased metabolism of Phenol] which results in increased chemical synthesis of catechol] CTD PMID:8211999 Ephx1 Rat CGP 52608 multiple interactions ISO EPHX1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to EPHX1 gene] CTD PMID:28238834 Ephx1 Rat chenodeoxycholic acid decreases expression ISO EPHX1 (Homo sapiens) 6480464 Chenodeoxycholic Acid results in decreased expression of EPHX1 mRNA CTD PMID:27174168 Ephx1 Rat chenodeoxycholic acid multiple interactions ISO EPHX1 (Homo sapiens) 6480464 [Atazanavir Sulfate co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in decreased expression of EPHX1 mRNA more ... CTD PMID:32152650 Ephx1 Rat chlorohydrocarbon multiple interactions EXP 6480464 [Hydrocarbons more ... CTD PMID:30744511 Ephx1 Rat chloroprene increases expression ISO Ephx1 (Mus musculus) 6480464 Chloroprene results in increased expression of EPHX1 mRNA CTD PMID:23125180 Ephx1 Rat chrysene multiple interactions ISO Ephx1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of EPHX1 mRNA more ... CTD PMID:27858113 and PMID:8961944 Ephx1 Rat chrysene multiple interactions ISO EPHX1 (Homo sapiens) 6480464 EPHX1 protein promotes the reaction [CYP1A1 protein results in increased metabolism of chrysene] and EPHX1 protein promotes the reaction [CYP1A2 protein results in increased metabolism of chrysene] CTD PMID:8961944 Ephx1 Rat ciguatoxin CTX1B affects expression ISO Ephx1 (Mus musculus) 6480464 Ciguatoxins affects the expression of EPHX1 mRNA CTD PMID:18353800 Ephx1 Rat cisplatin increases expression EXP 6480464 Cisplatin results in increased expression of EPHX1 mRNA CTD PMID:18246545 Ephx1 Rat cisplatin multiple interactions ISO EPHX1 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of EPHX1 mRNA CTD PMID:27392435 Ephx1 Rat cisplatin increases expression ISO EPHX1 (Homo sapiens) 6480464 Cisplatin results in increased expression of EPHX1 mRNA CTD PMID:27392435 Ephx1 Rat cisplatin increases expression ISO Ephx1 (Mus musculus) 6480464 Cisplatin results in increased expression of EPHX1 mRNA CTD PMID:21151649 and PMID:21382384 Ephx1 Rat cisplatin affects expression EXP 6480464 Cisplatin affects the expression of EPHX1 mRNA CTD PMID:18246545 Ephx1 Rat clofibrate decreases activity EXP 6480464 Clofibrate results in decreased activity of EPHX1 protein CTD PMID:10528994 Ephx1 Rat clofibrate increases activity ISO Ephx1 (Mus musculus) 6480464 Clofibrate results in increased activity of EPHX1 protein CTD PMID:3621371 Ephx1 Rat clofibrate increases expression ISO Ephx1 (Mus musculus) 6480464 Clofibrate results in increased expression of EPHX1 protein CTD PMID:3318844 and PMID:4049385 Ephx1 Rat clomipramine affects expression EXP 6480464 Clomipramine affects the expression of EPHX1 mRNA CTD PMID:18355885 Ephx1 Rat clonazepam increases activity EXP 6480464 Clonazepam results in increased activity of EPHX1 protein CTD PMID:1372805 Ephx1 Rat clotrimazole increases activity EXP 6480464 Clotrimazole results in increased activity of EPHX1 protein CTD PMID:1372805 Ephx1 Rat cobalt dichloride increases expression ISO EPHX1 (Homo sapiens) 6480464 cobaltous chloride results in increased expression of EPHX1 mRNA CTD PMID:19320972 Ephx1 Rat cobalt dichloride decreases expression ISO EPHX1 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of EPHX1 mRNA CTD PMID:19376846 Ephx1 Rat colforsin daropate hydrochloride affects expression ISO EPHX1 (Homo sapiens) 6480464 Colforsin affects the expression of EPHX1 mRNA CTD PMID:20726872 Ephx1 Rat colforsin daropate hydrochloride multiple interactions ISO EPHX1 (Homo sapiens) 6480464 Valproic Acid affects the reaction [Colforsin affects the expression of EPHX1 mRNA] CTD PMID:20726872 Ephx1 Rat copper atom multiple interactions ISO EPHX1 (Homo sapiens) 6480464 [Thiosemicarbazones binds to Copper] which results in decreased expression of EPHX1 protein CTD PMID:20931265 Ephx1 Rat copper(0) multiple interactions ISO EPHX1 (Homo sapiens) 6480464 [Thiosemicarbazones binds to Copper] which results in decreased expression of EPHX1 protein CTD PMID:20931265 Ephx1 Rat copper(II) chloride increases expression ISO EPHX1 (Homo sapiens) 6480464 cupric chloride results in increased expression of EPHX1 mRNA CTD PMID:38568856 Ephx1 Rat copper(II) sulfate decreases expression ISO EPHX1 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of EPHX1 mRNA CTD PMID:19549813 Ephx1 Rat coumarin increases expression ISO Ephx1 (Mus musculus) 6480464 coumarin results in increased expression of EPHX1 mRNA CTD PMID:17311802 Ephx1 Rat CU-O LINKAGE decreases expression ISO EPHX1 (Homo sapiens) 6480464 cupric oxide results in decreased expression of EPHX1 mRNA CTD PMID:32285662 Ephx1 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of EPHX1 mRNA CTD PMID:27523638 Ephx1 Rat cyclophosphamide affects expression EXP 6480464 Cyclophosphamide affects the expression of EPHX1 mRNA CTD PMID:18246545 Ephx1 Rat cyclophosphamide increases expression EXP 6480464 Cyclophosphamide results in increased expression of EPHX1 mRNA CTD PMID:18246545 Ephx1 Rat cyclosporin A decreases expression ISO EPHX1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of EPHX1 mRNA CTD PMID:20106945 and PMID:27989131 Ephx1 Rat cyclosporin A multiple interactions ISO EPHX1 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in decreased expression of EPHX1 mRNA CTD PMID:32152650 Ephx1 Rat cypermethrin increases expression EXP 6480464 cypermethrin results in increased expression of EPHX1 mRNA CTD PMID:22528246 Ephx1 Rat cyproconazole increases expression ISO Ephx1 (Mus musculus) 6480464 cyproconazole results in increased expression of EPHX1 mRNA CTD PMID:22334560 Ephx1 Rat cyproconazole multiple interactions EXP 6480464 [cyproconazole co-treated with epoxiconazole] results in increased expression of EPHX1 mRNA CTD PMID:29038839 Ephx1 Rat cyproconazole increases expression EXP 6480464 cyproconazole results in increased expression of EPHX1 mRNA CTD PMID:29038839 Ephx1 Rat DDE decreases expression ISO EPHX1 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of EPHX1 mRNA CTD PMID:38568856 Ephx1 Rat DDT increases activity EXP 6480464 DDT results in increased activity of EPHX1 protein CTD PMID:1372805 Ephx1 Rat decabromodiphenyl ether increases expression EXP 6480464 decabromobiphenyl ether results in increased expression of EPHX1 mRNA CTD PMID:32679240 Ephx1 Rat decabromodiphenyl ether increases expression ISO EPHX1 (Homo sapiens) 6480464 decabromobiphenyl ether results in increased expression of EPHX1 protein CTD PMID:31675489 Ephx1 Rat deoxycholic acid multiple interactions ISO EPHX1 (Homo sapiens) 6480464 [Atazanavir Sulfate co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in decreased expression of EPHX1 mRNA more ... CTD PMID:32152650 Ephx1 Rat deoxynivalenol decreases expression ISO Ephx1 (Mus musculus) 6480464 deoxynivalenol results in decreased expression of EPHX1 mRNA CTD PMID:15371230 Ephx1 Rat dexamethasone multiple interactions ISO EPHX1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of EPHX1 mRNA more ... CTD PMID:28628672 Ephx1 Rat dextran sulfate decreases expression ISO Ephx1 (Mus musculus) 6480464 Dextran Sulfate results in decreased expression of EPHX1 mRNA CTD PMID:35093514 Ephx1 Rat Diallyl sulfide increases activity EXP 6480464 allyl sulfide results in increased activity of EPHX1 protein CTD PMID:1372805 Ephx1 Rat Diallyl sulfide increases expression EXP 6480464 allyl sulfide results in increased expression of EPHX1 mRNA CTD PMID:19695238 Ephx1 Rat diallyl trisulfide increases expression EXP 6480464 diallyl trisulfide results in increased expression of EPHX1 mRNA CTD PMID:20650352 Ephx1 Rat diarsenic trioxide decreases expression ISO EPHX1 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of EPHX1 mRNA CTD PMID:17547211 Ephx1 Rat diazinon decreases expression ISO Ephx1 (Mus musculus) 6480464 Diazinon results in decreased expression of EPHX1 mRNA CTD PMID:17311802 Ephx1 Rat dibenz[a,h]anthracene multiple interactions ISO EPHX1 (Homo sapiens) 6480464 EPHX1 protein promotes the reaction [CYP1A1 protein results in increased metabolism of 1 more ... CTD PMID:8961944 Ephx1 Rat dibenz[a,h]anthracene increases expression ISO Ephx1 (Mus musculus) 6480464 1 more ... CTD PMID:26377693 Ephx1 Rat dibenz[a,h]anthracene multiple interactions ISO Ephx1 (Mus musculus) 6480464 EPHX1 protein promotes the reaction [CYP1A1 protein results in increased metabolism of 1 more ... CTD PMID:8961944 Ephx1 Rat dibenzofurans increases expression ISO Ephx1 (Mus musculus) 6480464 Dibenzofurans results in increased expression of EPHX1 mRNA CTD PMID:34254344 Ephx1 Rat dibenzoylmethane increases activity ISO Ephx1 (Mus musculus) 6480464 dibenzoylmethane results in increased activity of EPHX1 protein CTD PMID:3621371 Ephx1 Rat dibenzoylmethane multiple interactions ISO Ephx1 (Mus musculus) 6480464 [sulforaphane co-treated with dibenzoylmethane] results in increased expression of EPHX1 mRNA CTD PMID:17942926 Ephx1 Rat dibenzoylmethane increases expression ISO Ephx1 (Mus musculus) 6480464 dibenzoylmethane results in increased expression of EPHX1 mRNA CTD PMID:17942926 Ephx1 Rat Dibutyl phosphate affects expression ISO EPHX1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of EPHX1 mRNA CTD PMID:37042841 Ephx1 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of EPHX1 mRNA CTD PMID:21266533 Ephx1 Rat dibutyl phthalate decreases expression ISO Ephx1 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of EPHX1 mRNA CTD PMID:17361019 Ephx1 Rat dichloroacetic acid increases expression ISO Ephx1 (Mus musculus) 6480464 Dichloroacetic Acid results in increased expression of EPHX1 mRNA CTD PMID:28962523 Ephx1 Rat diclofenac decreases expression EXP 6480464 Diclofenac results in decreased expression of EPHX1 mRNA CTD PMID:17202759 Ephx1 Rat dicyclanil increases expression ISO Ephx1 (Mus musculus) 6480464 dicyclanil results in increased expression of EPHX1 mRNA CTD PMID:15664270 Ephx1 Rat dieldrin multiple interactions ISO Ephx1 (Mus musculus) 6480464 Dieldrin promotes the reaction [EPHX1 protein results in increased metabolism of stilbene oxide] CTD PMID:2043152 Ephx1 Rat diepoxybutane affects response to substance ISO EPHX1 (Homo sapiens) 6480464 EPHX1 gene polymorphism affects the susceptibility to diepoxybutane CTD PMID:15036125 Ephx1 Rat diepoxybutane increases response to substance ISO Ephx1 (Mus musculus) 6480464 EPHX1 gene mutant form results in increased susceptibility to diepoxybutane CTD PMID:12929123 Ephx1 Rat diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of EPHX1 mRNA CTD PMID:15890375 Ephx1 Rat Dihydroxycarbazepine multiple interactions ISO EPHX1 (Homo sapiens) 6480464 [EPHX1 gene SNP affects the metabolism of carbamazepine epoxide] which affects the chemical synthesis of 10 more ... CTD PMID:15692831 Ephx1 Rat dioxygen multiple interactions EXP 6480464 [dan-shen root extract co-treated with Andrographis paniculata extract] inhibits the reaction [[Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in decreased expression of EPHX1 mRNA] and [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in decreased expression of EPHX1 mRNA CTD PMID:33729688 Ephx1 Rat dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate multiple interactions ISO EPHX1 (Homo sapiens) 6480464 [Antimony Potassium Tartrate results in increased abundance of antimonite] which results in increased expression of EPHX1 mRNA CTD PMID:32076005 Ephx1 Rat diuron increases expression EXP 6480464 Diuron results in increased expression of EPHX1 mRNA CTD PMID:21551480 Ephx1 Rat dorsomorphin multiple interactions ISO EPHX1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of EPHX1 mRNA CTD PMID:27188386 Ephx1 Rat doxorubicin increases expression ISO EPHX1 (Homo sapiens) 6480464 Doxorubicin results in increased expression of EPHX1 mRNA CTD PMID:15205334 and PMID:29803840 Ephx1 Rat doxorubicin increases expression ISO Ephx1 (Mus musculus) 6480464 Doxorubicin results in increased expression of EPHX1 mRNA CTD PMID:21382384 and PMID:22016648 Ephx1 Rat doxorubicin increases expression EXP 6480464 Doxorubicin results in increased expression of EPHX1 mRNA CTD PMID:19915844 Ephx1 Rat endosulfan affects expression EXP 6480464 Endosulfan affects the expression of EPHX1 mRNA CTD PMID:29391264 Ephx1 Rat epoxiconazole increases expression EXP 6480464 epoxiconazole results in increased expression of EPHX1 mRNA CTD PMID:25182419 Ephx1 Rat epoxiconazole decreases expression ISO Ephx1 (Mus musculus) 6480464 epoxiconazole results in decreased expression of EPHX1 mRNA CTD PMID:35436446 Ephx1 Rat epoxiconazole multiple interactions EXP 6480464 [cyproconazole co-treated with epoxiconazole] results in increased expression of EPHX1 mRNA CTD PMID:29038839 Ephx1 Rat epoxiconazole increases expression ISO Ephx1 (Mus musculus) 6480464 epoxiconazole results in increased expression of EPHX1 mRNA CTD PMID:22334560 Ephx1 Rat Erucin increases expression EXP 6480464 erucin results in increased expression of EPHX1 protein CTD PMID:21132492 Ephx1 Rat estradiol increases activity EXP 152998935 estradiol increases Ephx1 enzyme activity in rat liver microsomes RGD Ephx1 Rat ethanol increases expression EXP 6480464 Ethanol results in increased expression of EPHX1 mRNA CTD PMID:23273579 Ephx1 Rat ethanol multiple interactions ISO Ephx1 (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in increased expression of EPHX1 mRNA CTD PMID:30517762 Ephx1 Rat ethoxyquin increases expression EXP 6480464 Ethoxyquin results in increased expression of EPHX1 mRNA CTD PMID:19695238 Ephx1 Rat ethylparaben increases expression ISO EPHX1 (Homo sapiens) 6480464 ethyl-p-hydroxybenzoate results in increased expression of EPHX1 mRNA CTD PMID:37690743 Ephx1 Rat etoposide increases expression ISO Ephx1 (Mus musculus) 6480464 Etoposide results in increased expression of EPHX1 mRNA CTD PMID:21382384 and PMID:25270620 Ephx1 Rat felbamate increases expression EXP 6480464 felbamate results in increased expression of EPHX1 mRNA CTD PMID:17381134 Ephx1 Rat fenamidone increases expression ISO Ephx1 (Mus musculus) 6480464 fenamidone results in increased expression of EPHX1 mRNA CTD PMID:27029645 Ephx1 Rat fenvalerate increases activity EXP 6480464 fenvalerate metabolite results in increased activity of EPHX1 protein CTD PMID:10630566 Ephx1 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of EPHX1 mRNA CTD PMID:24136188 Ephx1 Rat fipronil increases expression EXP 6480464 fipronil results in increased expression of EPHX1 mRNA CTD PMID:23962444 Ephx1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of EPHX1 mRNA CTD PMID:24136188 Ephx1 Rat folpet increases expression ISO Ephx1 (Mus musculus) 6480464 folpet results in increased expression of EPHX1 mRNA CTD PMID:31558096 Ephx1 Rat fulvestrant multiple interactions ISO EPHX1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of EPHX1 gene CTD PMID:31601247 Ephx1 Rat fumonisin B1 increases expression ISO Ephx1 (Mus musculus) 6480464 fumonisin B1 results in increased expression of EPHX1 mRNA CTD PMID:16221962 Ephx1 Rat furan increases methylation EXP 6480464 furan results in increased methylation of EPHX1 gene CTD PMID:22079235 Ephx1 Rat furan increases expression EXP 6480464 furan results in increased expression of EPHX1 mRNA CTD PMID:25539665 and PMID:26194646 Ephx1 Rat furan increases expression ISO Ephx1 (Mus musculus) 6480464 furan results in increased expression of EPHX1 mRNA CTD PMID:24183702 and PMID:37517673 Ephx1 Rat genistein increases expression ISO EPHX1 (Homo sapiens) 6480464 Genistein results in increased expression of EPHX1 mRNA CTD PMID:18847459 Ephx1 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of EPHX1 mRNA CTD PMID:33387578 Ephx1 Rat glafenine decreases expression EXP 6480464 Glafenine results in decreased expression of EPHX1 mRNA CTD PMID:24136188 Ephx1 Rat glucoerucin increases expression EXP 6480464 glucoerucin results in increased expression of EPHX1 protein CTD PMID:21132492 Ephx1 Rat glucoerucin(1-) increases expression EXP 6480464 glucoerucin results in increased expression of EPHX1 protein CTD PMID:21132492 Ephx1 Rat glucoraphanin increases expression EXP 6480464 glucoraphanin results in increased expression of EPHX1 protein CTD PMID:21132492 Ephx1 Rat glutathione increases expression EXP 6480464 Glutathione deficiency results in increased expression of EPHX1 mRNA CTD PMID:15345336 Ephx1 Rat glycochenodeoxycholic acid multiple interactions ISO EPHX1 (Homo sapiens) 6480464 [Atazanavir Sulfate co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in decreased expression of EPHX1 mRNA more ... CTD PMID:32152650 Ephx1 Rat glycocholic acid multiple interactions ISO EPHX1 (Homo sapiens) 6480464 [Atazanavir Sulfate co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in decreased expression of EPHX1 mRNA more ... CTD PMID:32152650 Ephx1 Rat glycodeoxycholic acid multiple interactions ISO EPHX1 (Homo sapiens) 6480464 [Atazanavir Sulfate co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in decreased expression of EPHX1 mRNA more ... CTD PMID:32152650 Ephx1 Rat gold atom increases expression ISO EPHX1 (Homo sapiens) 6480464 Gold analog results in increased expression of EPHX1 mRNA CTD PMID:36057382 Ephx1 Rat gold(0) increases expression ISO EPHX1 (Homo sapiens) 6480464 Gold analog results in increased expression of EPHX1 mRNA CTD PMID:36057382 Ephx1 Rat Heliotrine increases expression EXP 6480464 heliotrine results in increased expression of EPHX1 mRNA CTD PMID:32419051 Ephx1 Rat Heptachlor epoxide multiple interactions ISO Ephx1 (Mus musculus) 6480464 Heptachlor Epoxide promotes the reaction [EPHX1 protein results in increased metabolism of stilbene oxide] CTD PMID:2043152 Ephx1 Rat Hexachloro-1,3-butadiene increases expression EXP 6480464 hexachlorobutadiene results in increased expression of EPHX1 mRNA CTD PMID:21905055 Ephx1 Rat hexachlorobenzene increases expression EXP 6480464 Hexachlorobenzene results in increased expression of EPHX1 mRNA CTD PMID:15159207 Ephx1 Rat HT-2 toxin increases expression ISO EPHX1 (Homo sapiens) 6480464 HT-2 toxin results in increased expression of EPHX1 mRNA CTD PMID:22982764 Ephx1 Rat hydrogen peroxide increases expression ISO Ephx1 (Mus musculus) 6480464 Hydrogen Peroxide results in increased expression of EPHX1 mRNA CTD PMID:21382384 Ephx1 Rat hydroquinone multiple interactions EXP 6480464 EPHX1 protein promotes the reaction [[CYP2E1 protein results in increased metabolism of Benzene] which results in increased chemical synthesis of hydroquinone] and EPHX1 protein promotes the reaction [[CYP2E1 protein results in increased metabolism of Phenol] which results in increased chemical synthesis of hydroquinone] CTD PMID:8211999 Ephx1 Rat imipramine affects expression EXP 6480464 Imipramine affects the expression of EPHX1 mRNA CTD PMID:18355885 Ephx1 Rat indole-3-methanol affects expression EXP 6480464 indole-3-carbinol affects the expression of EPHX1 mRNA CTD PMID:21396975 Ephx1 Rat indometacin multiple interactions ISO EPHX1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of EPHX1 mRNA more ... CTD PMID:28628672 Ephx1 Rat inulin multiple interactions ISO Ephx1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of EPHX1 mRNA CTD PMID:36331819 Ephx1 Rat ivermectin decreases expression ISO EPHX1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of EPHX1 protein CTD PMID:32959892 Ephx1 Rat ketoconazole affects expression EXP 6480464 Ketoconazole affects the expression of EPHX1 mRNA CTD PMID:18355885 Ephx1 Rat ketoconazole increases expression EXP 6480464 Ketoconazole results in increased expression of EPHX1 mRNA CTD PMID:37077353 Ephx1 Rat kojic acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with kojic acid co-treated with Diethylnitrosamine] results in decreased expression of EPHX1 mRNA and [Diethylnitrosamine co-treated with kojic acid] results in increased expression of EPHX1 mRNA CTD PMID:18544905 Ephx1 Rat L-ascorbic acid multiple interactions ISO EPHX1 (Homo sapiens) 6480464 [Quercetin co-treated with Ascorbic Acid] results in decreased expression of EPHX1 mRNA CTD PMID:17639512 Ephx1 Rat lanosterol multiple interactions ISO Ephx1 (Mus musculus) 6480464 Lanosterol analog inhibits the reaction [EPHX1 protein results in increased metabolism of cholesterol alpha-oxide] CTD PMID:2043152 Ephx1 Rat lead diacetate increases expression ISO EPHX1 (Homo sapiens) 6480464 lead acetate results in increased expression of EPHX1 mRNA CTD PMID:38568856 Ephx1 Rat lead(0) affects expression ISO EPHX1 (Homo sapiens) 6480464 Lead affects the expression of EPHX1 mRNA CTD PMID:28903495 Ephx1 Rat levofloxacin decreases expression EXP 6480464 Levofloxacin results in decreased expression of EPHX1 mRNA CTD PMID:24136188 Ephx1 Rat lithocholic acid multiple interactions ISO Ephx1 (Mus musculus) 6480464 [Lithocholic Acid co-treated with Pregnenolone Carbonitrile] results in increased expression of EPHX1 mRNA CTD PMID:20359477 Ephx1 Rat m-xylene increases expression ISO EPHX1 (Homo sapiens) 6480464 3-xylene results in increased expression of EPHX1 mRNA CTD PMID:33269480 Ephx1 Rat malathion decreases expression ISO Ephx1 (Mus musculus) 6480464 Malathion results in decreased expression of EPHX1 mRNA CTD PMID:17311802 Ephx1 Rat mandelic acid multiple interactions ISO EPHX1 (Homo sapiens) 6480464 EPHX1 polymorphism affects the metabolism of [mandelic acid co-treated with phenylglyoxylic acid] CTD PMID:25562543 Ephx1 Rat medroxyprogesterone acetate multiple interactions ISO EPHX1 (Homo sapiens) 6480464 ESR1 protein promotes the reaction [Medroxyprogesterone Acetate results in increased expression of EPHX1 protein] CTD PMID:20383792 Ephx1 Rat medroxyprogesterone acetate increases expression ISO EPHX1 (Homo sapiens) 6480464 Medroxyprogesterone Acetate results in increased expression of EPHX1 mRNA and Medroxyprogesterone Acetate results in increased expression of EPHX1 protein CTD PMID:20383792 Ephx1 Rat menadione increases expression ISO Ephx1 (Mus musculus) 6480464 Vitamin K 3 results in increased expression of EPHX1 mRNA CTD PMID:21382384 Ephx1 Rat mercury dichloride increases expression EXP 6480464 Mercuric Chloride results in increased expression of EPHX1 mRNA CTD PMID:32599119 Ephx1 Rat methamphetamine increases expression ISO Ephx1 (Mus musculus) 6480464 Methamphetamine results in increased expression of EPHX1 mRNA and Methamphetamine results in increased expression of EPHX1 protein CTD PMID:26307267 and PMID:31422080 Ephx1 Rat methamphetamine multiple interactions ISO Ephx1 (Mus musculus) 6480464 EPHX1 protein affects the reaction [Methamphetamine results in decreased expression of BCL2 protein] more ... CTD PMID:31422080 Ephx1 Rat methamphetamine increases methylation ISO Ephx1 (Mus musculus) 6480464 Methamphetamine results in increased methylation of EPHX1 promoter CTD PMID:26307267 Ephx1 Rat methapyrilene increases expression EXP 6480464 Methapyrilene results in increased expression of EPHX1 mRNA CTD PMID:15890375 Ephx1 Rat methyl methanesulfonate increases expression ISO Ephx1 (Mus musculus) 6480464 Methyl Methanesulfonate results in increased expression of EPHX1 mRNA CTD PMID:21382384 Ephx1 Rat methylmercury chloride multiple interactions EXP 6480464 [Hydrocarbons more ... CTD PMID:30744511 Ephx1 Rat mitomycin C increases expression ISO Ephx1 (Mus musculus) 6480464 Mitomycin results in increased expression of EPHX1 mRNA CTD PMID:21382384 Ephx1 Rat mono(2-ethylhexyl) phthalate increases expression EXP 6480464 mono-(2-ethylhexyl)phthalate results in increased expression of EPHX1 mRNA CTD PMID:12706301 Ephx1 Rat muconic acid multiple interactions ISO EPHX1 (Homo sapiens) 6480464 [EPHX1 protein affects the metabolism of Benzene] which affects the abundance of muconic acid CTD PMID:10511268 Ephx1 Rat N,N'-diphenylthiourea increases expression EXP 6480464 diphenylthiourea results in increased expression of EPHX1 mRNA and diphenylthiourea results in increased expression of EPHX1 protein CTD PMID:10190572 Ephx1 Rat N,N-diethyl-m-toluamide increases expression ISO EPHX1 (Homo sapiens) 6480464 DEET results in increased expression of EPHX1 mRNA CTD PMID:27091632 Ephx1 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal increases expression ISO Ephx1 (Mus musculus) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased expression of EPHX1 mRNA CTD PMID:20061341 Ephx1 Rat N-ethyl-N-nitrosourea increases expression EXP 6480464 Ethylnitrosourea results in increased expression of EPHX1 mRNA CTD PMID:15954086 Ephx1 Rat N-methyl-N-nitrosourea increases expression ISO Ephx1 (Mus musculus) 6480464 Methylnitrosourea results in increased expression of EPHX1 mRNA CTD PMID:21382384 Ephx1 Rat N-Methylolacrylamide decreases expression ISO Ephx1 (Mus musculus) 6480464 N-methylolacrylamide results in decreased expression of EPHX1 mRNA CTD PMID:17311802 Ephx1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with kojic acid co-treated with Diethylnitrosamine] results in decreased expression of EPHX1 mRNA more ... CTD PMID:18544905 more ... Ephx1 Rat N-nitrosodiethylamine increases expression ISO Ephx1 (Mus musculus) 6480464 Diethylnitrosamine results in increased expression of EPHX1 mRNA CTD PMID:17854601 and PMID:21607683 Ephx1 Rat N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of EPHX1 mRNA CTD PMID:17602206 more ... Ephx1 Rat N-nitrosodiethylamine multiple interactions ISO Ephx1 (Mus musculus) 6480464 RB1 protein inhibits the reaction [Diethylnitrosamine results in increased expression of EPHX1 mRNA] CTD PMID:17854601 Ephx1 Rat N-nitrosodimethylamine increases expression EXP 6480464 Dimethylnitrosamine results in increased expression of EPHX1 mRNA CTD PMID:14600272 and PMID:15890375 Ephx1 Rat naphthalene increases expression ISO EPHX1 (Homo sapiens) 6480464 naphthalene results in increased expression of EPHX1 mRNA CTD PMID:20500019 Ephx1 Rat naphthalene increases response to substance ISO Ephx1 (Mus musculus) 6480464 EPHX1 results in increased susceptibility to naphthalene CTD PMID:26840748 Ephx1 Rat naphthalene increases metabolic processing ISO Ephx1 (Mus musculus) 6480464 EPHX1 protein results in increased metabolism of naphthalene CTD PMID:18363382 and PMID:26840748 Ephx1 Rat naphthalene multiple interactions ISO Ephx1 (Mus musculus) 6480464 [EPHX1 protein results in increased metabolism of naphthalene] which results in increased chemical synthesis of 1 more ... CTD PMID:18363382 and PMID:26840748 Ephx1 Rat naphthalene-1,5-diamine affects expression ISO Ephx1 (Mus musculus) 6480464 1 and 5-naphthalenediamine affects the expression of EPHX1 mRNA CTD PMID:17114358 Ephx1 Rat naphthalene-1,5-diamine increases expression ISO Ephx1 (Mus musculus) 6480464 1 and 5-naphthalenediamine results in increased expression of EPHX1 mRNA CTD PMID:17311802 Ephx1 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of EPHX1 mRNA CTD PMID:24136188 Ephx1 Rat nefazodone decreases expression ISO EPHX1 (Homo sapiens) 6480464 nefazodone results in decreased expression of EPHX1 mRNA CTD PMID:32152650 Ephx1 Rat nefazodone multiple interactions ISO EPHX1 (Homo sapiens) 6480464 [nefazodone co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in decreased expression of EPHX1 mRNA CTD PMID:32152650 Ephx1 Rat nickel atom decreases expression ISO EPHX1 (Homo sapiens) 6480464 Nickel results in decreased expression of EPHX1 mRNA CTD PMID:25583101 Ephx1 Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of EPHX1 mRNA CTD PMID:24136188 Ephx1 Rat nimesulide decreases glutathionylation ISO EPHX1 (Homo sapiens) 6480464 EPHX1 protein results in decreased glutathionylation of nimesulide CTD PMID:26524229 Ephx1 Rat nitrates multiple interactions ISO Ephx1 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of EPHX1 mRNA CTD PMID:35964746 Ephx1 Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of EPHX1 mRNA CTD PMID:33484710 Ephx1 Rat Nutlin-3 multiple interactions ISO EPHX1 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of EPHX1 protein CTD PMID:38460933 Ephx1 Rat ochratoxin A increases expression ISO EPHX1 (Homo sapiens) 6480464 ochratoxin A results in increased expression of EPHX1 mRNA CTD PMID:32905824 Ephx1 Rat oltipraz increases expression EXP 6480464 oltipraz results in increased expression of EPHX1 mRNA CTD PMID:18418891 Ephx1 Rat organoselenium compound increases activity ISO Ephx1 (Mus musculus) 6480464 Organoselenium Compounds results in increased activity of EPHX1 protein CTD PMID:17163488 Ephx1 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of EPHX1 mRNA CTD PMID:25729387 Ephx1 Rat oxaliplatin increases expression EXP 6480464 oxaliplatin results in increased expression of EPHX1 mRNA CTD PMID:25729387 Ephx1 Rat oxirane affects metabolic processing ISO EPHX1 (Homo sapiens) 6480464 EPHX1 protein affects the metabolism of Ethylene Oxide CTD PMID:11437638 Ephx1 Rat oxirane affects metabolic processing EXP 6480464 EPHX1 protein affects the metabolism of Ethylene Oxide CTD PMID:11437638 Ephx1 Rat ozone decreases expression ISO Ephx1 (Mus musculus) 6480464 Ozone results in decreased expression of EPHX1 mRNA CTD PMID:12763052 Ephx1 Rat ozone multiple interactions ISO Ephx1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of EPHX1 mRNA CTD PMID:34911549 Ephx1 Rat p-toluidine increases expression EXP 6480464 4-toluidine results in increased expression of EPHX1 mRNA CTD PMID:27638505 Ephx1 Rat paracetamol affects expression ISO Ephx1 (Mus musculus) 6480464 Acetaminophen affects the expression of EPHX1 mRNA CTD PMID:15606129 and PMID:17562736 Ephx1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of EPHX1 mRNA CTD PMID:30723492 and PMID:33387578 Ephx1 Rat paracetamol increases expression ISO EPHX1 (Homo sapiens) 6480464 Acetaminophen results in increased expression of EPHX1 mRNA CTD PMID:22230336 Ephx1 Rat paracetamol multiple interactions ISO Ephx1 (Mus musculus) 6480464 [Acetaminophen results in increased activity of and results in increased localization of NFE2L2 protein] which results in increased expression of EPHX1 mRNA CTD PMID:15122755 Ephx1 Rat pentachloronitrobenzene increases expression ISO Ephx1 (Mus musculus) 6480464 quintozene results in increased expression of EPHX1 mRNA CTD PMID:17311802 Ephx1 Rat pentachlorophenol increases expression ISO Ephx1 (Mus musculus) 6480464 Pentachlorophenol results in increased expression of EPHX1 mRNA CTD PMID:23892564 Ephx1 Rat perfluorooctane-1-sulfonic acid increases expression EXP 6480464 perfluorooctane sulfonic acid results in increased expression of EPHX1 mRNA CTD PMID:19162173 Ephx1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Ephx1 (Mus musculus) 6480464 [Dietary Fats co-treated with perfluorooctane sulfonic acid] results in increased expression of EPHX1 mRNA more ... CTD PMID:32979393 and PMID:36331819 Ephx1 Rat perfluorooctane-1-sulfonic acid increases expression ISO EPHX1 (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in increased expression of EPHX1 mRNA CTD PMID:27153767 Ephx1 Rat perfluorooctane-1-sulfonic acid increases expression ISO Ephx1 (Mus musculus) 6480464 perfluorooctane sulfonic acid results in increased expression of EPHX1 mRNA and perfluorooctane sulfonic acid results in increased expression of EPHX1 protein CTD PMID:20936131 and PMID:32979393 Ephx1 Rat perfluorooctane-1-sulfonic acid affects expression ISO Ephx1 (Mus musculus) 6480464 perfluorooctane sulfonic acid affects the expression of EPHX1 mRNA CTD PMID:19429403 Ephx1 Rat perfluorooctanoic acid affects expression ISO Ephx1 (Mus musculus) 6480464 perfluorooctanoic acid affects the expression of EPHX1 mRNA CTD PMID:18281256 and PMID:19429403 Ephx1 Rat perfluorooctanoic acid decreases expression ISO Ephx1 (Mus musculus) 6480464 perfluorooctanoic acid results in decreased expression of EPHX1 protein CTD PMID:28126411 Ephx1 Rat perfluorooctanoic acid multiple interactions ISO Ephx1 (Mus musculus) 6480464 [perfluorooctanoic acid co-treated with Dietary Fats and Unsaturated] results in increased expression of EPHX1 mRNA CTD PMID:23626681 Ephx1 Rat perfluorooctanoic acid increases expression ISO Ephx1 (Mus musculus) 6480464 perfluorooctanoic acid results in increased expression of EPHX1 mRNA CTD PMID:23626681 and PMID:37422089 Ephx1 Rat permethrin increases expression ISO Ephx1 (Mus musculus) 6480464 Permethrin results in increased expression of EPHX1 mRNA CTD PMID:30629241 Ephx1 Rat phenethyl isothiocyanate increases expression EXP 6480464 phenethyl isothiocyanate results in increased expression of EPHX1 protein CTD PMID:21132492 Ephx1 Rat phenobarbital multiple interactions ISO Ephx1 (Mus musculus) 6480464 NR1I3 protein affects the reaction [Phenobarbital results in increased expression of EPHX1 mRNA] and NR1I3 protein promotes the reaction [Phenobarbital results in increased expression of EPHX1 mRNA] CTD PMID:19482888 and PMID:19850644 Ephx1 Rat phenobarbital decreases expression ISO Ephx1 (Mus musculus) 6480464 Phenobarbital results in decreased expression of EPHX1 protein CTD PMID:35881160 Ephx1 Rat phenobarbital increases expression ISO EPHX1 (Homo sapiens) 6480464 Phenobarbital results in increased expression of EPHX1 mRNA and Phenobarbital results in increased expression of EPHX1 protein CTD PMID:22258563 more ... Ephx1 Rat phenobarbital affects expression ISO Ephx1 (Mus musculus) 6480464 Phenobarbital affects the expression of EPHX1 mRNA CTD PMID:23091169 Ephx1 Rat phenobarbital increases expression ISO Ephx1 (Mus musculus) 6480464 Phenobarbital results in increased expression of EPHX1 mRNA CTD PMID:19482888 more ... Ephx1 Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of EPHX1 mRNA and Phenobarbital results in increased expression of EPHX1 protein CTD PMID:11328961 more ... Ephx1 Rat phenobarbital affects expression ISO EPHX1 (Homo sapiens) 6480464 Phenobarbital affects the expression of EPHX1 mRNA CTD PMID:19159669 Ephx1 Rat phenobarbital increases activity ISO Ephx1 (Mus musculus) 6480464 Phenobarbital results in increased activity of EPHX1 protein CTD PMID:3621371 Ephx1 Rat phenobarbital multiple interactions EXP 6480464 [Phenobarbital co-treated with Diethylnitrosamine] results in increased expression of EPHX1 protein CTD PMID:20935162 Ephx1 Rat phenol multiple interactions EXP 6480464 EPHX1 protein promotes the reaction [[CYP2E1 protein results in increased metabolism of Benzene] which results in increased chemical synthesis of Phenol] more ... CTD PMID:8211999 Ephx1 Rat phenols increases expression ISO EPHX1 (Homo sapiens) 6480464 Phenols results in increased expression of EPHX1 mRNA CTD PMID:23561572 Ephx1 Rat phenylglyoxylic acid multiple interactions ISO EPHX1 (Homo sapiens) 6480464 EPHX1 polymorphism affects the metabolism of [mandelic acid co-treated with phenylglyoxylic acid] CTD PMID:25562543 Ephx1 Rat phenylmercury acetate increases expression ISO EPHX1 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of EPHX1 mRNA CTD PMID:26272509 Ephx1 Rat phenylmercury acetate multiple interactions ISO EPHX1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of EPHX1 mRNA CTD PMID:27188386 Ephx1 Rat phenytoin affects response to substance ISO EPHX1 (Homo sapiens) 6480464 EPHX1 gene polymorphism affects the susceptibility to Phenytoin CTD PMID:19952982 Ephx1 Rat phenytoin increases expression EXP 6480464 Phenytoin results in increased expression of EPHX1 mRNA CTD PMID:17381134 Ephx1 Rat PhIP decreases expression EXP 6480464 2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in decreased expression of EPHX1 mRNA CTD PMID:12376462 Ephx1 Rat phlorizin decreases expression ISO Ephx1 (Mus musculus) 6480464 Phlorhizin results in decreased expression of EPHX1 mRNA CTD PMID:22538082 Ephx1 Rat phorbol 13-acetate 12-myristate decreases expression ISO EPHX1 (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate results in decreased expression of EPHX1 protein CTD PMID:24704207 Ephx1 Rat phosphoramide mustard increases expression EXP 6480464 phosphoramide mustard results in increased expression of EPHX1 mRNA and phosphoramide mustard results in increased expression of EPHX1 protein CTD PMID:25070981 Ephx1 Rat pimecrolimus multiple interactions ISO EPHX1 (Homo sapiens) 6480464 pimecrolimus inhibits the reaction [Rifampin results in increased expression of EPHX1 mRNA] CTD PMID:29356861 Ephx1 Rat piperonyl butoxide increases expression EXP 6480464 Piperonyl Butoxide results in increased expression of EPHX1 mRNA CTD PMID:15890375 and PMID:22484513 Ephx1 Rat pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of EPHX1 mRNA CTD PMID:19162173 Ephx1 Rat pirinixic acid increases expression ISO Ephx1 (Mus musculus) 6480464 pirinixic acid results in increased expression of EPHX1 mRNA CTD PMID:15375163 more ... Ephx1 Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of EPHX1 mRNA CTD PMID:15890375 Ephx1 Rat pirinixic acid multiple interactions ISO Ephx1 (Mus musculus) 6480464 PPARA protein affects the reaction [pirinixic acid results in increased expression of EPHX1 mRNA] CTD PMID:16221962 Ephx1 Rat pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of EPHX1 mRNA CTD PMID:19162173 Ephx1 Rat pregnenolone 16alpha-carbonitrile increases expression ISO Ephx1 (Mus musculus) 6480464 Pregnenolone Carbonitrile results in increased expression of EPHX1 mRNA CTD PMID:20359477 and PMID:27413110 Ephx1 Rat pregnenolone 16alpha-carbonitrile multiple interactions ISO Ephx1 (Mus musculus) 6480464 [Lithocholic Acid co-treated with Pregnenolone Carbonitrile] results in increased expression of EPHX1 mRNA CTD PMID:20359477 Ephx1 Rat propiconazole affects expression EXP 6480464 propiconazole affects the expression of EPHX1 mRNA CTD PMID:17383973 Ephx1 Rat propiconazole increases expression ISO Ephx1 (Mus musculus) 6480464 propiconazole results in increased expression of EPHX1 mRNA CTD PMID:21278054 and PMID:22334560 Ephx1 Rat propionamide decreases activity EXP 6480464 propionamide analog results in decreased activity of EPHX1 protein CTD PMID:18363382 Ephx1 Rat propionamide decreases activity ISO Ephx1 (Mus musculus) 6480464 propionamide analog results in decreased activity of EPHX1 protein CTD PMID:18363382 Ephx1 Rat propionamide multiple interactions ISO Ephx1 (Mus musculus) 6480464 [propionamide analog results in decreased activity of EPHX1 protein] which results in increased glutathionylation of naphthalene CTD PMID:18363382 Ephx1 Rat pyrazinecarboxamide increases expression EXP 6480464 Pyrazinamide results in increased expression of EPHX1 mRNA CTD PMID:22431067 Ephx1 Rat quartz decreases expression ISO EPHX1 (Homo sapiens) 6480464 Quartz results in decreased expression of EPHX1 mRNA CTD PMID:27917503 Ephx1 Rat quercetin multiple interactions ISO EPHX1 (Homo sapiens) 6480464 [Quercetin co-treated with Ascorbic Acid] results in decreased expression of EPHX1 mRNA CTD PMID:17639512 Ephx1 Rat quercetin increases expression EXP 6480464 Quercetin results in increased expression of EPHX1 mRNA CTD PMID:18095365 and PMID:21565894 Ephx1 Rat resveratrol multiple interactions ISO EPHX1 (Homo sapiens) 6480464 resveratrol promotes the reaction [Benzo(a)pyrene results in increased activity of EPHX1 protein] CTD PMID:16484233 Ephx1 Rat resveratrol affects expression ISO Ephx1 (Mus musculus) 6480464 resveratrol affects the expression of EPHX1 mRNA CTD PMID:23525482 Ephx1 Rat resveratrol increases expression ISO EPHX1 (Homo sapiens) 6480464 resveratrol results in increased expression of EPHX1 mRNA and resveratrol results in increased expression of EPHX1 protein CTD PMID:11279601 and PMID:18089832 Ephx1 Rat rifampicin increases expression ISO EPHX1 (Homo sapiens) 6480464 Rifampin results in increased expression of EPHX1 mRNA CTD PMID:22258563 more ... Ephx1 Rat rifampicin multiple interactions ISO EPHX1 (Homo sapiens) 6480464 pimecrolimus inhibits the reaction [Rifampin results in increased expression of EPHX1 mRNA] CTD PMID:29356861 Ephx1 Rat rotenone increases expression ISO Ephx1 (Mus musculus) 6480464 Rotenone results in increased expression of EPHX1 mRNA CTD PMID:22016648 Ephx1 Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of EPHX1 mRNA CTD PMID:28374803 Ephx1 Rat SB 431542 multiple interactions ISO EPHX1 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 and PMID:37664457 Ephx1 Rat sevoflurane affects expression EXP 6480464 sevoflurane affects the expression of EPHX1 mRNA CTD PMID:15967596 Ephx1 Rat silicon dioxide decreases expression ISO EPHX1 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of EPHX1 mRNA CTD PMID:25895662 Ephx1 Rat silicon dioxide increases expression ISO EPHX1 (Homo sapiens) 6480464 Silicon Dioxide results in increased expression of EPHX1 mRNA CTD PMID:27917503 Ephx1 Rat silver atom multiple interactions ISO EPHX1 (Homo sapiens) 6480464 NFE2L2 protein promotes the reaction [Silver results in increased expression of EPHX1 mRNA] CTD PMID:22036727 Ephx1 Rat silver atom increases expression ISO Ephx1 (Mus musculus) 6480464 Silver results in increased expression of EPHX1 mRNA CTD PMID:27131904 Ephx1 Rat silver atom increases expression ISO EPHX1 (Homo sapiens) 6480464 Silver results in increased expression of EPHX1 mRNA CTD PMID:22036727 Ephx1 Rat silver(0) multiple interactions ISO EPHX1 (Homo sapiens) 6480464 NFE2L2 protein promotes the reaction [Silver results in increased expression of EPHX1 mRNA] CTD PMID:22036727 Ephx1 Rat silver(0) increases expression ISO Ephx1 (Mus musculus) 6480464 Silver results in increased expression of EPHX1 mRNA CTD PMID:27131904 Ephx1 Rat silver(0) increases expression ISO EPHX1 (Homo sapiens) 6480464 Silver results in increased expression of EPHX1 mRNA CTD PMID:22036727 Ephx1 Rat sodium arsenite increases expression ISO EPHX1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of EPHX1 mRNA CTD PMID:25493608 and PMID:38568856 Ephx1 Rat sodium arsenite multiple interactions ISO EPHX1 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of arsenite] which results in increased expression of EPHX1 mRNA CTD PMID:32076005 Ephx1 Rat sodium dichromate decreases expression ISO Ephx1 (Mus musculus) 6480464 sodium bichromate results in decreased expression of EPHX1 mRNA CTD PMID:22155349 Ephx1 Rat stilbene oxide multiple interactions ISO Ephx1 (Mus musculus) 6480464 araldite promotes the reaction [EPHX1 protein results in increased metabolism of stilbene oxide analog] more ... CTD PMID:2043152 Ephx1 Rat stilbene oxide increases metabolic processing ISO Ephx1 (Mus musculus) 6480464 EPHX1 protein results in increased metabolism of stilbene oxide and EPHX1 protein results in increased metabolism of stilbene oxide analog CTD PMID:2043152 Ephx1 Rat stilbenoid increases activity ISO Ephx1 (Mus musculus) 6480464 Stilbenes results in increased activity of EPHX1 protein CTD PMID:3621371 Ephx1 Rat streptozocin increases expression EXP 6480464 Streptozocin results in increased expression of EPHX1 protein CTD PMID:19634143 Ephx1 Rat streptozocin multiple interactions EXP 6480464 Trientine inhibits the reaction [Streptozocin results in increased expression of EPHX1 protein] CTD PMID:19634143 Ephx1 Rat styrene increases expression EXP 6480464 Styrene results in increased expression of EPHX1 mRNA CTD PMID:16418063 Ephx1 Rat styrene decreases response to substance ISO Ephx1 (Mus musculus) 6480464 EPHX1 protein results in decreased susceptibility to Styrene CTD PMID:22386858 Ephx1 Rat styrene affects response to substance ISO EPHX1 (Homo sapiens) 6480464 EPHX1 gene polymorphism affects the susceptibility to Styrene CTD PMID:14751678 Ephx1 Rat styrene oxide multiple interactions EXP 6480464 CYP1A1 protein promotes the reaction [EPHX1 protein affects the hydrolysis of styrene oxide] more ... CTD PMID:12051674 Ephx1 Rat styrene oxide multiple interactions ISO EPHX1 (Homo sapiens) 6480464 EPHX1 protein affects the metabolism of and results in decreased activity of styrene oxide CTD PMID:12694745 Ephx1 Rat styrene oxide affects hydrolysis ISO EPHX1 (Homo sapiens) 6480464 EPHX1 protein affects the hydrolysis of styrene oxide CTD PMID:11076696 Ephx1 Rat sulfasalazine increases expression ISO Ephx1 (Mus musculus) 6480464 Sulfasalazine results in increased expression of EPHX1 mRNA CTD PMID:22016648 and PMID:31830553 Ephx1 Rat sulforaphane increases expression ISO Ephx1 (Mus musculus) 6480464 sulforaphane results in increased expression of EPHX1 mRNA CTD PMID:17942926 Ephx1 Rat sulforaphane increases expression ISO EPHX1 (Homo sapiens) 6480464 sulforaphane results in increased expression of EPHX1 exon more ... CTD PMID:24704207 and PMID:31838189 Ephx1 Rat sulforaphane multiple interactions ISO EPHX1 (Homo sapiens) 6480464 sulforaphane promotes the reaction [NFE2L2 protein binds to EPHX1 enhancer] CTD PMID:24704207 Ephx1 Rat sulforaphane multiple interactions ISO Ephx1 (Mus musculus) 6480464 [sulforaphane co-treated with dibenzoylmethane] results in increased expression of EPHX1 mRNA CTD PMID:17942926 Ephx1 Rat sunitinib decreases expression ISO EPHX1 (Homo sapiens) 6480464 Sunitinib results in decreased expression of EPHX1 mRNA CTD PMID:31533062 Ephx1 Rat tamoxifen affects expression ISO EPHX1 (Homo sapiens) 6480464 Tamoxifen affects the expression of EPHX1 mRNA CTD PMID:14699072 Ephx1 Rat tamoxifen affects expression ISO Ephx1 (Mus musculus) 6480464 Tamoxifen affects the expression of EPHX1 mRNA CTD PMID:17555576 Ephx1 Rat tert-butyl ethyl ether increases expression EXP 6480464 ethyl tert-butyl ether results in increased expression of EPHX1 protein CTD PMID:24090815 Ephx1 Rat tert-butyl hydroperoxide increases expression ISO Ephx1 (Mus musculus) 6480464 tert-Butylhydroperoxide results in increased expression of EPHX1 mRNA CTD PMID:21382384 Ephx1 Rat testosterone increases expression ISO Ephx1 (Mus musculus) 6480464 Testosterone deficiency results in increased expression of EPHX1 mRNA CTD PMID:33848595 Ephx1 Rat tetrachloromethane decreases expression ISO Ephx1 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of EPHX1 mRNA CTD PMID:17484886 Ephx1 Rat tetrachloromethane multiple interactions ISO Ephx1 (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in increased expression of EPHX1 mRNA CTD PMID:30517762 Ephx1 Rat tetrachloromethane multiple interactions EXP 6480464 Plant Extracts inhibits the reaction [Carbon Tetrachloride results in decreased expression of EPHX1 mRNA] and thymoquinone inhibits the reaction [Carbon Tetrachloride results in decreased expression of EPHX1 mRNA] CTD PMID:21994235 Ephx1 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of EPHX1 mRNA CTD PMID:21994235 Ephx1 Rat tetracycline decreases expression ISO Ephx1 (Mus musculus) 6480464 Tetracycline results in decreased expression of EPHX1 mRNA CTD PMID:24489787 Ephx1 Rat Tetramethylthiourea increases expression EXP 6480464 tetramethylthiourea results in increased expression of EPHX1 mRNA and tetramethylthiourea results in increased expression of EPHX1 protein CTD PMID:10190572 Ephx1 Rat tetraphene multiple interactions ISO Ephx1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of EPHX1 mRNA more ... CTD PMID:27858113 and PMID:8961944 Ephx1 Rat tetraphene increases expression ISO Ephx1 (Mus musculus) 6480464 benz(a)anthracene results in increased expression of EPHX1 protein CTD PMID:2208584 Ephx1 Rat tetraphene multiple interactions ISO EPHX1 (Homo sapiens) 6480464 EPHX1 protein promotes the reaction [CYP1A1 protein results in increased metabolism of benz(a)anthracene] and EPHX1 protein promotes the reaction [CYP1A2 protein results in increased metabolism of benz(a)anthracene] CTD PMID:8961944 Ephx1 Rat thiazoles increases expression EXP 6480464 Thiazoles results in increased expression of EPHX1 mRNA CTD PMID:8951341 Ephx1 Rat thioacetamide multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in increased expression of EPHX1 mRNA CTD PMID:28943392 Ephx1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of EPHX1 mRNA CTD PMID:34492290 Ephx1 Rat thymoquinone multiple interactions EXP 6480464 thymoquinone inhibits the reaction [Carbon Tetrachloride results in decreased expression of EPHX1 mRNA] CTD PMID:21994235 Ephx1 Rat titanium dioxide decreases expression ISO Ephx1 (Mus musculus) 6480464 titanium dioxide results in decreased expression of EPHX1 mRNA CTD PMID:23557971 more ... Ephx1 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of EPHX1 mRNA CTD PMID:25729387 Ephx1 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of EPHX1 mRNA CTD PMID:33387578 Ephx1 Rat Tridiphane multiple interactions ISO Ephx1 (Mus musculus) 6480464 tridiphane promotes the reaction [EPHX1 protein results in increased metabolism of stilbene oxide] CTD PMID:2043152 Ephx1 Rat triphenyl phosphate increases expression EXP 6480464 triphenyl phosphate results in increased expression of EPHX1 mRNA CTD PMID:30589522 Ephx1 Rat tris(2-butoxyethyl) phosphate affects expression ISO EPHX1 (Homo sapiens) 6480464 tris(2-butoxyethyl) phosphate affects the expression of EPHX1 mRNA CTD PMID:29024780 Ephx1 Rat trovafloxacin decreases expression EXP 6480464 trovafloxacin results in decreased expression of EPHX1 mRNA CTD PMID:24136188 Ephx1 Rat valdecoxib increases expression EXP 6480464 valdecoxib results in increased expression of EPHX1 mRNA CTD PMID:24136188 Ephx1 Rat valproic acid decreases methylation ISO EPHX1 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of EPHX1 gene CTD PMID:29154799 and PMID:29501571 Ephx1 Rat valproic acid decreases expression ISO EPHX1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of EPHX1 mRNA CTD PMID:29501571 Ephx1 Rat valproic acid multiple interactions ISO EPHX1 (Homo sapiens) 6480464 Valproic Acid affects the reaction [Colforsin affects the expression of EPHX1 mRNA] CTD PMID:20726872 Ephx1 Rat valproic acid increases expression ISO Ephx1 (Mus musculus) 6480464 Valproic Acid results in increased expression of EPHX1 mRNA CTD PMID:21427059 Ephx1 Rat valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of EPHX1 mRNA CTD PMID:17381134 Ephx1 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of EPHX1 mRNA CTD PMID:19015723 Ephx1 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of EPHX1 mRNA CTD PMID:23034163 Ephx1 Rat vincristine decreases expression ISO Ephx1 (Mus musculus) 6480464 Vincristine results in decreased expression of EPHX1 mRNA CTD PMID:21382384 Ephx1 Rat warfarin affects response to substance ISO EPHX1 (Homo sapiens) 6480464 EPHX1 gene polymorphism affects the susceptibility to Warfarin more ... CTD PMID:15900282 more ... Ephx1 Rat warfarin increases response to substance ISO EPHX1 (Homo sapiens) 6480464 EPHX1 protein results in increased susceptibility to Warfarin CTD PMID:17496169 Ephx1 Rat zinc atom increases expression EXP 6480464 Zinc results in increased expression of EPHX1 mRNA CTD PMID:17074742 Ephx1 Rat zinc sulfate increases expression EXP 6480464 Zinc Sulfate results in increased expression of EPHX1 mRNA CTD PMID:17074742 Ephx1 Rat zinc(0) increases expression EXP 6480464 Zinc results in increased expression of EPHX1 mRNA CTD PMID:17074742
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(1->4)-beta-D-glucan (ISO) (2,4,5-trichlorophenoxy)acetic acid (ISO) (9R,10S)-9,10-epoxy-9,10-dihydrophenanthrene (ISO) (S)-mandelic acid (ISO) 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP) 1,1-dichloroethene (ISO) 1,2-dibromoethane (ISO) 1,2-dihydronaphthalene-1,2-diol (ISO) 1,2-dimethylhydrazine (ISO) 1,3,5-trimethylbenzene (ISO) 1,4-dioxane (ISO) 1-benzofuran (ISO) 1-naphthyl isothiocyanate (EXP) 1-nitropropane (EXP) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP,ISO) 17beta-estradiol 3-benzoate (EXP) 1H-pyrazole (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (EXP,ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,2,2-tetramine (EXP) 2,2-Bis(bromomethyl)propane-1,3-diol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (ISO) 2,3-dimethoxynaphthalene-1,4-dione (ISO) 2,4,6-tribromophenol (ISO) 2,4,6-trinitrotoluene (EXP) 2,4-D (ISO) 2,4-diaminotoluene (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,4-dinitrotoluene (EXP,ISO) 2,6-diaminotoluene (EXP) 2,6-dinitrotoluene (EXP) 2,8-bis-Trifluoromethyl-4-quinoline carboxylic acid (ISO) 2-acetamidofluorene (EXP,ISO) 2-nitro-p-phenylenediamine (EXP) 2-nitrofluorene (EXP) 2-nitropropane (EXP) 2-Oxohexane (EXP) 2-tert-butylhydroquinone (EXP,ISO) 3',4'-dimethoxyflavone (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP,ISO) 3,4-dihydrocoumarin (ISO) 3-chloropropane-1,2-diol (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3-methylcholanthrene (EXP,ISO) 3H-1,2-dithiole-3-thione (EXP) 4,4'-sulfonyldiphenol (EXP,ISO) 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (EXP) 4-acetylaminofluorene (EXP) 4-amino-2,6-dinitrotoluene (EXP) 4-hydroxynon-2-enal (ISO) 4-hydroxyphenyl retinamide (ISO) 4-nitro-1,2-phenylenediamine (EXP) 4-vinylcyclohexene dioxide (EXP,ISO) 5,6alpha-epoxy-5alpha-cholestan-3beta-ol (ISO) 5-aza-2'-deoxycytidine (ISO) 5-fluorouracil (ISO) 7,12-dimethyltetraphene (EXP,ISO) 8,9-EET (ISO) 8-Br-cAMP (ISO) 9,10-epoxy-9,10-dihydrophenanthrene (ISO) acetamide (EXP) acrylamide (ISO) actinomycin D (ISO) aflatoxin B1 (EXP,ISO) all-trans-retinoic acid (ISO) alpha-hexachlorocyclohexane (EXP) amiodarone (EXP) amitriptyline (EXP) ammonium chloride (EXP) aniline (ISO) antimonite (ISO) aristolochic acid A (EXP,ISO) Aroclor 1254 (EXP,ISO) arsenite(3-) (ISO) arsenous acid (ISO) asbestos (ISO) atazanavir sulfate (ISO) atrazine (ISO) azathioprine (ISO) barbiturates (EXP) benzene (EXP,ISO) benzo[a]pyrene (EXP,ISO) Benzo[a]pyrene-7,8-diol (EXP) Benzo[a]pyrene-7,8-oxide (EXP) benzo[b]fluoranthene (ISO) benzo[c]phenanthrene (ISO) benzothiazole (EXP) beta-naphthoflavone (ISO) bexarotene (EXP) bifenthrin (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (EXP,ISO) bromobenzene (EXP) buspirone (EXP) buta-1,3-diene (ISO) butanal (ISO) butylated hydroxyanisole (ISO) butyric acid (ISO) cadmium acetate (EXP) cadmium atom (EXP) cadmium dichloride (EXP,ISO) cannabidiol (ISO) captan (ISO) carbamazepine (EXP,ISO) carbamazepine-10,11-epoxide (ISO) carbon nanotube (ISO) carmustine (ISO) catechol (EXP) CGP 52608 (ISO) chenodeoxycholic acid (ISO) chlorohydrocarbon (EXP) chloroprene (ISO) chrysene (ISO) ciguatoxin CTX1B (ISO) cisplatin (EXP,ISO) clofibrate (EXP,ISO) clomipramine (EXP) clonazepam (EXP) clotrimazole (EXP) cobalt dichloride (ISO) colforsin daropate hydrochloride (ISO) copper atom (ISO) copper(0) (ISO) copper(II) chloride (ISO) copper(II) sulfate (ISO) coumarin (ISO) CU-O LINKAGE (ISO) Cuprizon (EXP) cyclophosphamide (EXP) cyclosporin A (ISO) cypermethrin (EXP) cyproconazole (EXP,ISO) DDE (ISO) DDT (EXP) decabromodiphenyl ether (EXP,ISO) deoxycholic acid (ISO) deoxynivalenol (ISO) dexamethasone (ISO) dextran sulfate (ISO) Diallyl sulfide (EXP) diallyl trisulfide (EXP) diarsenic trioxide (ISO) diazinon (ISO) dibenz[a,h]anthracene (ISO) dibenzofurans (ISO) dibenzoylmethane (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) dichloroacetic acid (ISO) diclofenac (EXP) dicyclanil (ISO) dieldrin (ISO) diepoxybutane (ISO) diethylstilbestrol (EXP) Dihydroxycarbazepine (ISO) dioxygen (EXP) dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate (ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (EXP,ISO) endosulfan (EXP) epoxiconazole (EXP,ISO) Erucin (EXP) estradiol (EXP) ethanol (EXP,ISO) ethoxyquin (EXP) ethylparaben (ISO) etoposide (ISO) felbamate (EXP) fenamidone (ISO) fenvalerate (EXP) finasteride (EXP) fipronil (EXP) flutamide (EXP) folpet (ISO) fulvestrant (ISO) fumonisin B1 (ISO) furan (EXP,ISO) genistein (ISO) gentamycin (EXP) glafenine (EXP) glucoerucin (EXP) glucoerucin(1-) (EXP) glucoraphanin (EXP) glutathione (EXP) glycochenodeoxycholic acid (ISO) glycocholic acid (ISO) glycodeoxycholic acid (ISO) gold atom (ISO) gold(0) (ISO) Heliotrine (EXP) Heptachlor epoxide (ISO) Hexachloro-1,3-butadiene (EXP) hexachlorobenzene (EXP) HT-2 toxin (ISO) hydrogen peroxide (ISO) hydroquinone (EXP) imipramine (EXP) indole-3-methanol (EXP) indometacin (ISO) inulin (ISO) ivermectin (ISO) ketoconazole (EXP) kojic acid (EXP) L-ascorbic acid (ISO) lanosterol (ISO) lead diacetate (ISO) lead(0) (ISO) levofloxacin (EXP) lithocholic acid (ISO) m-xylene (ISO) malathion (ISO) mandelic acid (ISO) medroxyprogesterone acetate (ISO) menadione (ISO) mercury dichloride (EXP) methamphetamine (ISO) methapyrilene (EXP) methyl methanesulfonate (ISO) methylmercury chloride (EXP) mitomycin C (ISO) mono(2-ethylhexyl) phthalate (EXP) muconic acid (ISO) N,N'-diphenylthiourea (EXP) N,N-diethyl-m-toluamide (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) N-ethyl-N-nitrosourea (EXP) N-methyl-N-nitrosourea (ISO) N-Methylolacrylamide (ISO) N-nitrosodiethylamine (EXP,ISO) N-nitrosodimethylamine (EXP) naphthalene (ISO) naphthalene-1,5-diamine (ISO) nefazodone (EXP,ISO) nickel atom (ISO) nimesulide (EXP,ISO) nitrates (ISO) nitrofen (EXP) Nutlin-3 (ISO) ochratoxin A (ISO) oltipraz (EXP) organoselenium compound (ISO) oxaliplatin (EXP) oxirane (EXP,ISO) ozone (ISO) p-toluidine (EXP) paracetamol (EXP,ISO) pentachloronitrobenzene (ISO) pentachlorophenol (ISO) perfluorooctane-1-sulfonic acid (EXP,ISO) perfluorooctanoic acid (ISO) permethrin (ISO) phenethyl isothiocyanate (EXP) phenobarbital (EXP,ISO) phenol (EXP) phenols (ISO) phenylglyoxylic acid (ISO) phenylmercury acetate (ISO) phenytoin (EXP,ISO) PhIP (EXP) phlorizin (ISO) phorbol 13-acetate 12-myristate (ISO) phosphoramide mustard (EXP) pimecrolimus (ISO) piperonyl butoxide (EXP) pirinixic acid (EXP,ISO) pregnenolone 16alpha-carbonitrile (EXP,ISO) propiconazole (EXP,ISO) propionamide (EXP,ISO) pyrazinecarboxamide (EXP) quartz (ISO) quercetin (EXP,ISO) resveratrol (ISO) rifampicin (ISO) rotenone (EXP,ISO) SB 431542 (ISO) sevoflurane (EXP) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) sodium dichromate (ISO) stilbene oxide (ISO) stilbenoid (ISO) streptozocin (EXP) styrene (EXP,ISO) styrene oxide (EXP,ISO) sulfasalazine (ISO) sulforaphane (ISO) sunitinib (ISO) tamoxifen (ISO) tert-butyl ethyl ether (EXP) tert-butyl hydroperoxide (ISO) testosterone (ISO) tetrachloromethane (EXP,ISO) tetracycline (ISO) Tetramethylthiourea (EXP) tetraphene (ISO) thiazoles (EXP) thioacetamide (EXP) thymoquinone (EXP) titanium dioxide (ISO) topotecan (EXP) trichloroethene (EXP) Tridiphane (ISO) triphenyl phosphate (EXP) tris(2-butoxyethyl) phosphate (ISO) trovafloxacin (EXP) valdecoxib (EXP) valproic acid (EXP,ISO) vinclozolin (EXP) vincristine (ISO) warfarin (ISO) zinc atom (EXP) zinc sulfate (EXP) zinc(0) (EXP)
1.
GSTM1 and mEPHX polymorphisms in Parkinson's disease and age of onset.
Ahmadi A, etal., Biochem Biophys Res Commun. 2000 Mar 24;269(3):676-80.
2.
Bladder cancer SNP panel predicts susceptibility and survival.
Andrew AS, etal., Hum Genet. 2009 Jun;125(5-6):527-39. Epub 2009 Mar 1.
3.
Catalytic triad of microsomal epoxide hydrolase: replacement of Glu404 with Asp leads to a strongly increased turnover rate.
Arand M, etal., Biochem J. 1999 Jan 1;337 ( Pt 1):37-43.
4.
Expression of rat microsomal epoxide hydrolase in Escherichia coli. Identification of a histidyl residue essential for catalysis.
Bell PA and Kasper CB, J Biol Chem. 1993 Jul 5;268(19):14011-7.
5.
Glucocorticoid repression and basal regulation of the epoxide hydrolase promoter.
Bell PA, etal., Arch Biochem Biophys. 1990 Jun;279(2):363-9.
6.
Maternal smoking during pregnancy, genetic polymorphisms of metabolic enzymes, and childhood acute leukemia: the ESCALE study (SFCE).
Bonaventure A, etal., Cancer Causes Control. 2012 Feb;23(2):329-45. doi: 10.1007/s10552-011-9882-9. Epub 2011 Dec 27.
7.
Genetic susceptibility for emphysematous changes of the lung in Japanese.
Budhi A, etal., Int J Mol Med. 2003 Mar;11(3):321-9.
8.
Sodium 2-propenyl thiosulfate derived from garlic induces phase II detoxification enzymes in rat hepatoma H4IIE cells.
Chang HS, etal., Nutr Res. 2010 Jun;30(6):435-40.
9.
Genetic variants of microsomal epoxide hydrolase and glutamate-cysteine ligase in COPD.
Chappell S, etal., Eur Respir J. 2008 Oct;32(4):931-7. Epub 2008 Jul 9.
10.
Association of glutathione S-transferase, EPHX, and p53 codon 72 gene polymorphisms with adult acute myeloid leukemia.
Chauhan PS, etal., DNA Cell Biol. 2011 Jan;30(1):39-46. doi: 10.1089/dna.2010.1092. Epub 2010 Aug 23.
11.
High order interactions of xenobiotic metabolizing genes and P53 codon 72 polymorphisms in acute leukemia.
Chauhan PS, etal., Environ Mol Mutagen. 2012 Oct;53(8):619-30. doi: 10.1002/em.21723. Epub 2012 Aug 29.
12.
Epoxide hydratase: sex specific expression and rate-limiting role in DMBA metabolism.
Christou M, etal., Carcinogenesis. 1989 Oct;10(10):1883-90.
13.
EH3 (ABHD9): the first member of a new epoxide hydrolase family with high activity for fatty acid epoxides.
Decker M, etal., J Lipid Res. 2012 Oct;53(10):2038-45. doi: 10.1194/jlr.M024448. Epub 2012 Jul 12.
14.
Genetic polymorphisms of EPHX1, Gsk3beta, TNFSF8 and myeloma cell DKK-1 expression linked to bone disease in myeloma.
Durie BG, etal., Leukemia. 2009 Oct;23(10):1913-9. doi: 10.1038/leu.2009.129. Epub 2009 Aug 6.
15.
Structure and organization of the microsomal xenobiotic epoxide hydrolase gene.
Falany CN, etal., J Biol Chem 1987 Apr 25;262(12):5924-30.
16.
Genetic polymorphisms of microsomal and soluble epoxide hydrolase and the risk of Parkinson's disease.
Farin FM, etal., Pharmacogenetics. 2001 Nov;11(8):703-8.
17.
Studies on the importance of microsomal epoxide hydrolase in the detoxification of arene oxides using the heterologous expression of the enzyme in mammalian cells.
Friedberg T, etal., Carcinogenesis. 1994 Feb;15(2):171-5.
18.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
19.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
20.
Associations of common variants in genes involved in metabolism and response to exogenous chemicals with risk of multiple myeloma.
Gold LS, etal., Cancer Epidemiol. 2009 Oct;33(3-4):276-80. doi: 10.1016/j.canep.2009.08.005. Epub 2009 Sep 6.
21.
The membrane anchor of microsomal epoxide hydrolase from human, rat, and rabbit displays an unexpected membrane topology.
Holler R, etal., Biochem Biophys Res Commun. 1997 Jul 30;236(3):754-9.
22.
Genetic predisposition and health effect of occupational exposure to asbestos.
Horska A, etal., Neuro Endocrinol Lett. 2006 Dec;27 Suppl 2:100-3.
23.
Association between polymorphisms of microsomal epoxide hydrolase and COPD: results from meta-analyses.
Hu G, etal., Respirology. 2008 Nov;13(6):837-50.
24.
Genetic variants of TP53 and EPHX1 in Leber's hereditary optic neuropathy and their relationship to age at onset.
Ishikawa K, etal., Jpn J Ophthalmol. 2005 Mar-Apr;49(2):121-6.
25.
In vivo optical imaging of revascularization after brain trauma in mice.
Jia Y, etal., Microvasc Res. 2011 Jan;81(1):73-80. Epub 2010 Nov 12.
26.
Induced hepatotoxicity in female rats by aflatoxin B1 and ethynylestradiol interaction.
Kamdem L, etal., Toxicol Appl Pharmacol. 1983 Jan;67(1):26-40. doi: 10.1016/0041-008x(83)90241-7.
27.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
28.
Genetic polymorphism of metabolic enzymes modifies the risk of chronic solvent-induced encephalopathy.
Kezic S, etal., Toxicol Ind Health. 2006 Aug;22(7):281-9.
29.
Pharmacogenomic assessment of cisplatin-based chemotherapy outcomes in ovarian cancer.
Khrunin AV, etal., Pharmacogenomics. 2014 Feb;15(3):329-37. doi: 10.2217/pgs.13.237.
30.
Association of COPD candidate genes with CT emphysema and airway phenotypes in severe COPD.
Kim WJ, etal., Eur Respir J. 2010 Jun 4.
31.
[Role of polymorphic variants of cytochrome P450 genes (CYP1A1, CYP2E1) and microsomal epoxide hydrolase (mEPHX) in pathogenesis of cystic fibrosis and chronic respiratory tract diseases]
Korytina GF, etal., Mol Biol (Mosk). 2003 Sep-Oct;37(5):784-92.
32.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
33.
Microsomal Epoxide Hydrolase Gene Polymorphisms and Susceptibility to Chronic Obstructive Pulmonary Disease in Tunisian Population.
Lakhdar R, etal., Genet Test Mol Biomarkers. 2010 Oct 9.
34.
Genetic polymorphisms in microsomal epoxide hydrolase and susceptibility to adult acute myeloid leukaemia with defined cytogenetic abnormalities.
Lebailly P, etal., Br J Haematol. 2002 Mar;116(3):587-94.
35.
Beneficial effects of soluble epoxide hydrolase inhibitors in myocardial infarction model: Insight gained using metabolomic approaches.
Li N, etal., J Mol Cell Cardiol. 2009 Dec;47(6):835-45. Epub 2009 Aug 28.
36.
Genetic polymorphism and gene expression of microsomal epoxide hydrolase in non-small cell lung cancer.
Lin TS, etal., Oncol Rep. 2007 Mar;17(3):565-72.
37.
Genetic variations in benzene metabolism and susceptibility to multiple myeloma.
Lincz LF, etal., Leuk Res. 2007 Jun;31(6):759-63. Epub 2006 Sep 1.
38.
Pharmacokinetic optimization of four soluble epoxide hydrolase inhibitors for use in a murine model of inflammation.
Liu JY, etal., Br J Pharmacol. 2009 Jan;156(2):284-96. Epub 2009 Jan 13.
39.
Expression of microsomal epoxide hydrolase is elevated in Alzheimer's hippocampus and induced by exogenous beta-amyloid and trimethyl-tin.
Liu M, etal., Eur J Neurosci. 2006 Apr;23(8):2027-34.
40.
The clinical relevance and prognostic significance of microsomal epoxide hydrolase gene polymorphisms and their susceptibility to acquired aplastic anemia: an Egyptian study.
Makhlouf MM and Magdy RI, Biomarkers. 2016 Mar 21:1-8.
41.
Genetic variants and multiple myeloma risk: IMMEnSE validation of the best reported associations--an extensive replication of the associations from the candidate gene era.
Martino A, etal., Cancer Epidemiol Biomarkers Prev. 2014 Apr;23(4):670-4. doi: 10.1158/1055-9965.EPI-13-1115. Epub 2014 Feb 12.
42.
Microsomal epoxide hydrolase is not associated with COPD in a community-based sample.
Matheson MC, etal., Hum Biol. 2006 Dec;78(6):705-17.
43.
Microsomal epoxide hydrolase of rat liver is a subunit of theanti-oestrogen-binding site.
Mesange F, etal., Biochem J. 1998 Aug 15;334 ( Pt 1):107-12.
44.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
45.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
46.
Metabolic genotypes as modulators of asbestos-related pleural malignant mesothelioma risk: a comparison of Finnish and Italian populations.
Neri M, etal., Int J Hyg Environ Health. 2006 Jul;209(4):393-8. Epub 2006 May 11.
47.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
48.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
49.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
50.
Complementary DNA and amino acid sequence of rat liver microsomal, xenobiotic epoxide hydrolase.
Porter TD, etal., Arch Biochem Biophys 1986 Jul;248(1):121-9.
51.
Alleviation of lung injury by glycyrrhizic acid in benzo(a)pyrene exposed rats: Probable role of soluble epoxide hydrolase and thioredoxin reductase.
Qamar W, etal., Toxicology. 2012 Jan 27;291(1-3):25-31. Epub 2011 Oct 25.
52.
Soluble epoxide hydrolase deficiency attenuates neointima formation in the femoral cuff model of hyperlipidemic mice.
Revermann M, etal., Arterioscler Thromb Vasc Biol. 2010 May;30(5):909-14. Epub 2010 Mar 11.
53.
GOA pipeline
RGD automated data pipeline
54.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
55.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
56.
Microsomal epoxide hydrolase, glutathione S-transferase P1, traffic and childhood asthma.
Salam MT, etal., Thorax. 2007 Dec;62(12):1050-7. Epub 2007 Aug 21.
57.
Genetic polymorphisms of biotransformation enzymes in patients with Hodgkin's and non-Hodgkin's lymphomas.
Sarmanova J, etal., Hum Mol Genet. 2001 Jun 1;10(12):1265-73.
58.
Effects of hepatocarcinogens and hepatocarcinogenesis on the activity of rat liver microsomal epoxide hydrolase and observations on the electrophoretic behavior of this enzyme.
Sharma RN, etal., Cancer Res. 1981 Sep;41(9 Pt 1):3311-9.
59.
Role of the CYP2D6, EPHX1, MPO, and NQO1 genes in the susceptibility to acute lymphoblastic leukemia in Brazilian children.
Silveira Vda S, etal., Environ Mol Mutagen. 2010 Jan;51(1):48-56. doi: 10.1002/em.20510.
60.
Quantitation of mRNAs specific for the mixed-function oxidase system in rat liver and extrahepatic tissues during development.
Simmons DL and Kasper CB, Arch Biochem Biophys. 1989 May 15;271(1):10-20.
61.
Association between polymorphism in gene for microsomal epoxide hydrolase and susceptibility to emphysema.
Smith CA and Harrison DJ, Lancet. 1997 Aug 30;350(9078):630-3.
62.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
63.
Gene polymorphism for microsomal epoxide hydrolase and susceptibility to emphysema in a Japanese population.
Takeyabu K, etal., Eur Respir J. 2000 May;15(5):891-4.
64.
Interaction between cytochrome P450 and other drug-metabolizing enzymes: evidence for an association of CYP1A1 with microsomal epoxide hydrolase and UDP-glucuronosyltransferase.
Taura KI, etal., Biochem Biophys Res Commun. 2000 Jul 14;273(3):1048-52.
65.
Association between polymorphisms of EPHX1 and XRCC1 genes and the risk of childhood acute lymphoblastic leukemia.
Tumer TB, etal., Arch Toxicol. 2012 Mar;86(3):431-9. doi: 10.1007/s00204-011-0760-8. Epub 2011 Oct 9.
66.
Genetic polymorphisms of glutathione-S-transferase and microsomal epoxide hydrolase in egyptian acquired aplastic anemia patients.
Youssry I, etal., J Pediatr Hematol Oncol. 2011 Mar;33(2):89-92. doi: 10.1097/MPH.0b013e3181ff78ce.
67.
Role of soluble epoxide hydrolase in the sex-specific vascular response to cerebral ischemia.
Zhang W, etal., J Cereb Blood Flow Metab. 2009 Aug;29(8):1475-81. Epub 2009 May 27.
68.
Membrane topology and cell surface targeting of microsomal epoxide hydrolase. Evidence for multiple topological orientations.
Zhu Q, etal., J Biol Chem. 1999 Sep 24;274(39):27898-904.
69.
Inhibition of human m-epoxide hydrolase gene expression in a case of hypercholanemia.
Zhu QS, etal., Biochim Biophys Acta. 2003 Jul 30;1638(3):208-16.
70.
A polymorphism in the gene for microsomal epoxide hydrolase is associated with pre-eclampsia.
Zusterzeel PL, etal., J Med Genet. 2001 Apr;38(4):234-7.
Ephx1 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 95,246,079 - 95,275,852 (-) NCBI GRCr8 mRatBN7.2 13 92,714,315 - 92,744,105 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 92,714,315 - 92,790,235 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 95,219,628 - 95,249,435 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 96,619,561 - 96,649,355 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 93,794,258 - 93,824,062 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 99,271,390 - 99,300,580 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 99,271,366 - 99,300,579 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 104,268,704 - 104,297,617 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 96,722,973 - 96,752,940 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 96,912,126 - 96,925,415 (-) NCBI Celera 13 92,256,740 - 92,285,424 (-) NCBI Celera RH 3.4 Map 13 631.9 RGD Cytogenetic Map 13 q26 NCBI
EPHX1 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 225,810,124 - 225,845,563 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 225,810,124 - 225,845,563 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 225,997,826 - 226,033,264 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 224,079,599 - 224,099,884 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 222,319,710 - 222,339,996 NCBI Celera 1 199,188,853 - 199,224,327 (+) NCBI Celera Cytogenetic Map 1 q42.12 NCBI HuRef 1 196,515,661 - 196,550,964 (+) NCBI HuRef CHM1_1 1 227,270,121 - 227,305,585 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 224,998,070 - 225,033,336 (+) NCBI T2T-CHM13v2.0
Ephx1 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 180,817,121 - 180,845,134 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 180,803,775 - 180,848,469 (-) Ensembl GRCm39 Ensembl GRCm38 1 180,989,556 - 181,017,569 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 180,976,210 - 181,020,904 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 182,919,687 - 182,947,626 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 182,826,231 - 182,854,170 (-) NCBI MGSCv36 mm8 Celera 1 188,055,356 - 188,083,565 (-) NCBI Celera Cytogenetic Map 1 H4 NCBI cM Map 1 84.48 NCBI
Ephx1 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955520 116,363 - 128,665 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955520 116,363 - 142,983 (-) NCBI ChiLan1.0 ChiLan1.0
EPHX1 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 23,692,322 - 23,727,663 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 23,640,786 - 23,675,962 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 201,271,366 - 201,306,635 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 206,272,866 - 206,307,581 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 206,272,866 - 206,307,581 (+) Ensembl panpan1.1 panPan2
EPHX1 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 7 38,964,319 - 39,004,902 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 7 38,964,338 - 38,999,238 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 7 38,446,530 - 38,481,524 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 7 38,798,288 - 38,833,289 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 7 38,798,291 - 38,833,208 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 7 38,638,072 - 38,673,037 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 7 38,646,207 - 38,681,169 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 7 38,915,983 - 38,950,983 (-) NCBI UU_Cfam_GSD_1.0
Ephx1 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 52,094,468 - 52,163,372 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936526 2,614,059 - 2,653,286 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936526 2,589,254 - 2,652,831 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
EPHX1 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 10 13,751,881 - 13,773,072 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 10 13,757,489 - 13,773,071 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 10 16,016,584 - 16,054,476 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
EPHX1 (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 25 3,924,396 - 3,960,264 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 25 3,924,606 - 3,945,535 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666055 3,930,701 - 3,966,856 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ephx1 (Heterocephalus glaber - naked mole-rat)
.
Assembly: mRatBN7.2
Chromosome
Start Pos
End Pos
Reference Nucleotide
Variant Nucleotide
Variant Type
Strain
Variant Page
13
92725270
92725271
C
T
snv
F344/DuCrl (2019) , F344/NCrl (2019), F344/N (2020), F344/Stm (2019), FXLE16/Stm (2020), FXLE18/Stm (2020), LEXF1A/Stm (2019), LEXF1C/Stm (2019), LEXF2B/Stm (2019), LEXF3/Stm (2020), M520/NRrrcMcwi (2019), M520/N (2020), MR/N (2020), MWF/Hsd (2019), PVG/Seac (2019), WAG/RijCrl (2020), F344/DuCrl (2019NG), F344/DuCrl (2019NG), F344/DuCrl (2021), F344/NHsd (2021), F344/StmMcwi (2019), FXLE12/StmMcwi (2021), FXLE12/Stm (2019NG), FXLE13/Stm (2019NG), FXLE15/StmMcwi (2021), FXLE15/Stm (2019NG), FXLE17/Stm (2019NG), FXLE20/Stm (2019NG), FXLE23/Stm (2022), FXLE26/Stm (2022), LEXF1C/StmMcwi (2021), LEXF2A/Stm (2022), LEXF2C/StmMcwi (2022), LEXF7A/Stm (2019NG), LEXF7B/StmMcwi (2022), LEXF7C/StmMcwi (2022), LEXF9/StmMcwi (2022), M520/NRrrcMcwi (2019NG), MR/NRrrc (2022), MWF/SimwMcwi (2019NG), MWF/SimwMcwi (2019), LEXF2A/StmMcwi (2023), FXLE26/StmMcwi (2023), FXLE13/StmMcwi (2023), FXLE20/StmMcwi (2023), FXLE23/StmMcwi (2023), FXLE17/StmMcwi (2023), FXLE15/StmMcwi (2023), FXLE12/StmMcwi (2023)
View more Information
13
92725335
92725336
T
A
snv
F344/DuCrl (2019) , FXLE15/StmMcwi (2023), F344/N (2020), F344/Stm (2019), F344/DuCrl (2019NG), F344/DuCrl (2021), F344/NHsd (2021), F344/StmMcwi (2019), FXLE12/StmMcwi (2023), FXLE16/Stm (2020), FXLE18/Stm (2020), LEXF1A/Stm (2019), LEXF1C/Stm (2019), LEXF2B/Stm (2019), LEXF3/Stm (2020), M520/NRrrcMcwi (2019), M520/N (2020), MR/N (2020), MWF/Hsd (2019), PVG/Seac (2019), WAG/RijCrl (2020), F344/DuCrl (2019NG), FXLE12/StmMcwi (2021), FXLE12/Stm (2019NG), FXLE13/Stm (2019NG), FXLE15/StmMcwi (2021), FXLE15/Stm (2019NG), FXLE17/Stm (2019NG), FXLE20/Stm (2019NG), FXLE23/Stm (2022), FXLE26/Stm (2022), LEXF1C/StmMcwi (2021), LEXF2A/Stm (2022), LEXF2C/StmMcwi (2022), LEXF7A/Stm (2019NG), LEXF7B/StmMcwi (2022), LEXF7C/StmMcwi (2022), LEXF9/StmMcwi (2022), M520/NRrrcMcwi (2019NG), MR/NRrrc (2022), MWF/SimwMcwi (2019NG), MWF/SimwMcwi (2019), LEXF2A/StmMcwi (2023), FXLE26/StmMcwi (2023), FXLE13/StmMcwi (2023), FXLE20/StmMcwi (2023), FXLE23/StmMcwi (2023), FXLE17/StmMcwi (2023), F344/NCrl (2019)
View more Information
Assembly: RGSC_v3.4
Chromosome
Start Pos
End Pos
Reference Nucleotide
Variant Nucleotide
Variant Type
Strain
Variant Page
13
96734188
96734189
C
T
snv
F344/NRrrc (KNAW) , HCR/2Mco (UMich), LCR/1Mco (UMich), HCR/1Mco (UMich), WAG/Rij (ICL), SBH/Ygl (ICL), F344/NCrl (ICL), BBDP/WorN (ICL), MR/N (KNAW), LCR/2Mco (UMich), M520/N (KNAW)
View more Information
13
96734253
96734254
T
A
snv
F344/NHsd (ICAHN) , LCR/2Mco (UMich), HCR/2Mco (UMich), LCR/1Mco (UMich), F344/NRrrc (KNAW), SBH/Ygl (ICL), F344/NCrl (ICL), M520/N (KNAW), HCR/1Mco (UMich)
View more Information
Assembly: Rnor_5.0
Chromosome
Start Pos
End Pos
Reference Nucleotide
Variant Nucleotide
Variant Type
Strain
Variant Page
13
104279058
104279059
C
T
snv
SBH/Ygl (MCW) , SDLEF7/Barth (UDEL), ZFDM (KyushuU), ZF (KyushuU), KFRS3B/Kyo (KyushuU), F344/Jcl (KyushuU), F344/Stm (KyushuU), IS-Tlk/Kyo (KyushuU), F344/NSlc (KyushuU), F344/DuCrlCrlj (KyushuU), NIG-III/Hok (KyushuU), IS/Kyo (KyushuU)
View more Information
13
104279123
104279124
T
A
snv
SBH/Ygl (MCW) , ZF (KyushuU), KFRS3B/Kyo (KyushuU), F344/Jcl (KyushuU), F344/Stm (KyushuU), ZFDM (KyushuU), F344/NSlc (KyushuU), F344/DuCrlCrlj (KyushuU), NIG-III/Hok (KyushuU), IS/Kyo (KyushuU), SDLEF7/Barth (UDEL), IS-Tlk/Kyo (KyushuU)
View more Information
Assembly: Rnor_6.0
Chromosome
Start Pos
End Pos
Reference Nucleotide
Variant Nucleotide
Variant Type
Strain
Variant Page
13
99281798
99281799
C
T
snv
SBH/Ygl (MCW) , F344/NRrrc (MCW), WAG/RijCrl (2020), PVG/Seac (2019), MWF/Hsd (2019), MR/N (2020), M520/N (2020), M520/NRrrcMcwi (2019), LEXF3/Stm (2020), LEXF2B/Stm (2019), LEXF1C/Stm (2019), LEXF1A/Stm (2019), FXLE18/Stm (2020), FXLE16/Stm (2020), F344/Stm (2019), F344/N (2020), F344/NCrl (2019), F344/DuCrl (2019), MR/N (MCW), M520/N (MCW)
View more Information
13
99281863
99281864
T
A
snv
PVG/Seac (2019) , WAG/RijCrl (2020), MR/N (2020), M520/N (2020), M520/NRrrcMcwi (2019), LEXF3/Stm (2020), LEXF2B/Stm (2019), LEXF1C/Stm (2019), LEXF1A/Stm (2019), FXLE18/Stm (2020), FXLE16/Stm (2020), F344/Stm (2019), F344/N (2020), F344/NCrl (2019), F344/DuCrl (2019), M520/N (MCW), F344/NRrrc (MCW), SBH/Ygl (MCW), MWF/Hsd (2019)
View more Information
Predicted Target Of
Count of predictions: 21 Count of miRNA genes: 20 Interacting mature miRNAs: 20 Transcripts: ENSRNOT00000004780 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
7207885 Glom27 Glomerulus QTL 27 3.9 kidney glomerulus integrity trait (VT:0010546) kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139) 13 20605871 101339738 Rat 7387280 Uae43 Urinary albumin excretion QTL 43 5.69 0.4174 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 66451204 106807694 Rat 70181 BpQTLcluster11 Blood pressure QTL cluster 11 6.922 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 13 31241331 93395974 Rat 2293702 Bss34 Bone structure and strength QTL 34 4.61 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 13 65103704 106807694 Rat 1354621 Rf47 Renal function QTL 47 3.7 kidney renin amount (VT:0010559) kidney renin level (CMO:0002166) 13 30395351 101056920 Rat 1354655 Bp241 Blood pressure QTL 241 3.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 56056920 101056920 Rat 4889606 Gluco63 Glucose level QTL 63 2.86 0.003 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 13 80753256 106807694 Rat 8655959 Pur32 Proteinuria QTL 32 8.4 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 13 74023918 97213863 Rat 1641901 Alcrsp6 Alcohol response QTL 6 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 13 52362171 97362171 Rat 2293687 Bss26 Bone structure and strength QTL 26 4.6 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 13 65103704 106807694 Rat 12879475 Bp400 Blood pressure QTL 400 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 61825626 106807694 Rat 1581570 Eae17 Experimental allergic encephalomyelitis QTL 17 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 13 8897350 101631289 Rat 1354666 Bp244 Blood pressure QTL 244 4.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 1 101056920 Rat 2293341 Glom15 Glomerulus QTL 15 9.1 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 13 74862117 101339893 Rat
Ephx1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 92,716,681 - 92,716,790 (+) MAPPER mRatBN7.2 Rnor_6.0 13 99,273,757 - 99,273,865 NCBI Rnor6.0 Rnor_5.0 13 104,271,071 - 104,271,179 UniSTS Rnor5.0 RGSC_v3.4 13 96,725,337 - 96,725,445 UniSTS RGSC3.4 Celera 13 92,259,107 - 92,259,215 UniSTS Cytogenetic Map 13 q26 UniSTS
RH94562
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 92,714,240 - 92,714,327 (+) MAPPER mRatBN7.2 mRatBN7.2 13 92,790,387 - 92,790,474 (+) MAPPER mRatBN7.2 Rnor_6.0 13 99,346,749 - 99,346,835 NCBI Rnor6.0 Rnor_6.0 13 99,271,316 - 99,271,402 NCBI Rnor6.0 Rnor_5.0 13 104,343,786 - 104,343,872 UniSTS Rnor5.0 Rnor_5.0 13 104,268,630 - 104,268,716 UniSTS Rnor5.0 RGSC_v3.4 13 96,722,896 - 96,722,982 UniSTS RGSC3.4 RGSC_v3.4 13 96,799,199 - 96,799,285 UniSTS RGSC3.4 Celera 13 92,331,667 - 92,331,753 UniSTS Celera 13 92,256,666 - 92,256,752 UniSTS RH 3.4 Map 13 631.9 UniSTS Cytogenetic Map 13 q26 UniSTS
UniSTS:142997
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 92,716,681 - 92,716,791 (+) MAPPER mRatBN7.2 Rnor_6.0 13 99,273,757 - 99,273,866 NCBI Rnor6.0 Rnor_5.0 13 104,271,071 - 104,271,180 UniSTS Rnor5.0 RGSC_v3.4 13 96,725,337 - 96,725,446 UniSTS RGSC3.4 Celera 13 92,259,107 - 92,259,216 UniSTS Cytogenetic Map 13 q26 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000004780 ⟹ ENSRNOP00000004780
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 92,714,319 - 92,790,235 (-) Ensembl Rnor_6.0 Ensembl 13 99,271,390 - 99,287,887 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000029787 ⟹ ENSRNOP00000034917
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 92,714,316 - 92,744,054 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000085279 ⟹ ENSRNOP00000074206
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 92,714,315 - 92,727,979 (-) Ensembl Rnor_6.0 Ensembl 13 99,271,366 - 99,300,579 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000109605 ⟹ ENSRNOP00000080132
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 92,714,315 - 92,725,978 (-) Ensembl
RefSeq Acc Id:
NM_001034090 ⟹ NP_001029262
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 95,246,079 - 95,275,852 (-) NCBI mRatBN7.2 13 92,714,318 - 92,744,105 (-) NCBI Rnor_6.0 13 99,271,390 - 99,300,580 (-) NCBI Rnor_5.0 13 104,268,704 - 104,297,617 (-) NCBI RGSC_v3.4 13 96,722,973 - 96,752,940 (-) RGD Celera 13 92,256,740 - 92,285,424 (-) NCBI
Sequence:
GGCTAGAAGGGAGCCGGGCAACCGGCAGCTGGGGTCTCCAAAGCACAGCCACCGGCAGAGAGGCTCAAGAGGAGTTGGAGAGTGGAGAAACTGCACACCAGCCGCCTCGGAAGTAGGAGCGCGAGCGT GACCCTGACAGAGTCATGTGGCTGGAACTTGTCCTGGCTTCCCTTCTGGGCTTTGTCATCTACTGGTTTGTCTCCCGGGACAAGGAGGAAACCTTACCACTAGGAGATGGATGGTGGGGGCCAGGGTC AAAGCCATCAGCCAAAGAAGATGAGAGCATCCGGCCCTTCAAGGTGGAAACATCAGATGAGGAGATCAAGGACTTACACCAGAGGATAGATAGGTTCCGGGCATCCCCACCTTTGGAGGGCAGCCGCT TCCACTATGGCTTCAACTCCAACTACATGAAGAAAGTGGTGTCCTACTGGAGGAACGAGTTTGACTGGAGGAAGCAGGTGGAGATCCTCAACCAGTACCCTCACTTCAAGACCAAGATCGAAGGGCTT GACATCCACTTCATCCATGTGAAGCCTCCCCAGCTGCCCTCAGGGCGCACCCCAAAGCCCTTGCTGATGGTGCATGGCTGGCCTGGATCCTTCTATGAGTTTTACAAGATCATCCCACTACTGACTGA CCCCAAGTCCCACGGTCTGAGTGACGAGCACGTGTTTGAAGTCATCTGTCCCTCGATTCCTGGCTATGGCTACTCAGAGGCATCCAGCAAGAAAGGTTTAAATTCGGTGGCCACTGCGAGGATTTTCT ACAAGCTGATGACACGGCTGGGCTTCCAGAAATTCTACATTCAAGGCGGGGACTGGGGGTCCCTCATCTGCACCAACATGGCCCAGATGGTTCCCAACCACGTGAAAGGCCTGCACTTAAATATGGCT TTCATTTCGAGAAGTTTTTACACCATGACTCCTCTCCTGGGCCAACGCTTCGGGAGATTCCTTGGCTACACAGAGAAGGATATCGAGCTCTTGTACCCCTATAAGGAGAAGGTTTTCTACAGCATCAT GAGGGAGAGTGGCTACTTACACATCCAAGCCACCAAGCCAGACACTGTGGGCTGTGCTCTCAATGACTCTCCCGTGGGCCTGGCTGCCTACATCTTAGAGAAGTTCTCCACCTGGACCAAGTCAGAGT ACCGTGAACTGGAGGATGGAGGCCTGGAGAGGAAGTTCTCCCTGGATGATCTGCTGGTTAACATCATGATCTACTGGACGACAGGAACCATTGTCTCCTCCCAACGCTACTACAAGGAGAATTTGGGC CAGGGCATCATGGTCCATAAACATGAGGGGATGAAGGTCTTTGTGCCCACTGGCTTTTCAGCCTTCCCTTCCGAGCTACTGCATGCCCCAGAAAAGTGGGTGAAGGTCAAGTACCCCAAACTCATCTC CTATTCCTACATGGAACGTGGGGGCCACTTTGCTGCCTTTGAAGAGCCCAAGCTTCTGGCCCAGGACATCCGCAAGTTCGTGTCCCTGGCTGAGCTGCAGTAGTGACACTGGATACCAACTGTGGCTT TAGCAGCAGCCCTGGTTCCTCCCAAGTCACACTTATGGAAGATGACCCCTTTCTGAGGAATAAGTTTGTTCCCTGACCACACTCGAGGACCCAGACTTAAACTCCACAGAGTCGTATGTTACCCCCAT ATGCTTCACCTCACTACATAGCTGTGTTAGCTACATGGCTTTAATGATAAATGGATTTATTTCTACAA
hide sequence
RefSeq Acc Id:
NM_012844 ⟹ NP_036976
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 95,246,079 - 95,263,117 (-) NCBI mRatBN7.2 13 92,714,318 - 92,731,364 (-) NCBI Rnor_6.0 13 99,271,390 - 99,287,887 (-) NCBI Rnor_5.0 13 104,268,704 - 104,297,617 (-) NCBI RGSC_v3.4 13 96,722,973 - 96,752,940 (-) RGD Celera 13 92,256,740 - 92,272,686 (-) NCBI
Sequence:
AGCCACTCTCACTTCGTGCTGTGACCAGGGAGGACTCACGGAGCCTACACTTAGCCCTGGTAAACAGCAGAGCATGCTGGGATAATTCTTCCCAGAAAAGGAAAAGCAGGCACTTCTGTTCCCAGGGA AAACAACAGGAGCACTTTGGACCTCCCTGCTGCAGTCAGGAGTCATGTGGCTGGAACTTGTCCTGGCTTCCCTTCTGGGCTTTGTCATCTACTGGTTTGTCTCCCGGGACAAGGAGGAAACCTTACCA CTAGGAGATGGATGGTGGGGGCCAGGGTCAAAGCCATCAGCCAAAGAAGATGAGAGCATCCGGCCCTTCAAGGTGGAAACATCAGATGAGGAGATCAAGGACTTACACCAGAGGATAGATAGGTTCCG GGCATCCCCACCTTTGGAGGGCAGCCGCTTCCACTATGGCTTCAACTCCAACTACATGAAGAAAGTGGTGTCCTACTGGAGGAACGAGTTTGACTGGAGGAAGCAGGTGGAGATCCTCAACCAGTACC CTCACTTCAAGACCAAGATCGAAGGGCTTGACATCCACTTCATCCATGTGAAGCCTCCCCAGCTGCCCTCAGGGCGCACCCCAAAGCCCTTGCTGATGGTGCATGGCTGGCCTGGATCCTTCTATGAG TTTTACAAGATCATCCCACTACTGACTGACCCCAAGTCCCACGGTCTGAGTGACGAGCACGTGTTTGAAGTCATCTGTCCCTCGATTCCTGGCTATGGCTACTCAGAGGCATCCAGCAAGAAAGGTTT AAATTCGGTGGCCACTGCGAGGATTTTCTACAAGCTGATGACACGGCTGGGCTTCCAGAAATTCTACATTCAAGGCGGGGACTGGGGGTCCCTCATCTGCACCAACATGGCCCAGATGGTTCCCAACC ACGTGAAAGGCCTGCACTTAAATATGGCTTTCATTTCGAGAAGTTTTTACACCATGACTCCTCTCCTGGGCCAACGCTTCGGGAGATTCCTTGGCTACACAGAGAAGGATATCGAGCTCTTGTACCCC TATAAGGAGAAGGTTTTCTACAGCATCATGAGGGAGAGTGGCTACTTACACATCCAAGCCACCAAGCCAGACACTGTGGGCTGTGCTCTCAATGACTCTCCCGTGGGCCTGGCTGCCTACATCTTAGA GAAGTTCTCCACCTGGACCAAGTCAGAGTACCGTGAACTGGAGGATGGAGGCCTGGAGAGGAAGTTCTCCCTGGATGATCTGCTGGTTAACATCATGATCTACTGGACGACAGGAACCATTGTCTCCT CCCAACGCTACTACAAGGAGAATTTGGGCCAGGGCATCATGGTCCATAAACATGAGGGGATGAAGGTCTTTGTGCCCACTGGCTTTTCAGCCTTCCCTTCCGAGCTACTGCATGCCCCAGAAAAGTGG GTGAAGGTCAAGTACCCCAAACTCATCTCCTATTCCTACATGGAACGTGGGGGCCACTTTGCTGCCTTTGAAGAGCCCAAGCTTCTGGCCCAGGACATCCGCAAGTTCGTGTCCCTGGCTGAGCTGCA GTAGTGACACTGGATACCAACTGTGGCTTTAGCAGCAGCCCTGGTTCCTCCCAAGTCACACTTATGGAAGATGACCCCTTTCTGAGGAATAAGTTTGTTCCCTGACCACACTCGAGGACCCAGACTTA AACTCCACAGAGTCGTATGTTACCCCCATATGCTTCACCTCACTACATAGCTGTGTTAGCTACATGGCTTTAATGATAAATGGATTTATTTCTACAA
hide sequence
RefSeq Acc Id:
XM_039090378 ⟹ XP_038946306
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 95,246,079 - 95,263,682 (-) NCBI mRatBN7.2 13 92,714,315 - 92,731,911 (-) NCBI
RefSeq Acc Id:
NP_001029262 ⟸ NM_001034090
- UniProtKB:
P07687 (UniProtKB/Swiss-Prot), A6JGI7 (UniProtKB/TrEMBL), A0A8L2R8K5 (UniProtKB/TrEMBL)
- Sequence:
MWLELVLASLLGFVIYWFVSRDKEETLPLGDGWWGPGSKPSAKEDESIRPFKVETSDEEIKDLHQRIDRFRASPPLEGSRFHYGFNSNYMKKVVSYWRNEFDWRKQVEILNQYPHFKTKIEGLDIHFI HVKPPQLPSGRTPKPLLMVHGWPGSFYEFYKIIPLLTDPKSHGLSDEHVFEVICPSIPGYGYSEASSKKGLNSVATARIFYKLMTRLGFQKFYIQGGDWGSLICTNMAQMVPNHVKGLHLNMAFISRS FYTMTPLLGQRFGRFLGYTEKDIELLYPYKEKVFYSIMRESGYLHIQATKPDTVGCALNDSPVGLAAYILEKFSTWTKSEYRELEDGGLERKFSLDDLLVNIMIYWTTGTIVSSQRYYKENLGQGIMV HKHEGMKVFVPTGFSAFPSELLHAPEKWVKVKYPKLISYSYMERGGHFAAFEEPKLLAQDIRKFVSLAELQ
hide sequence
RefSeq Acc Id:
NP_036976 ⟸ NM_012844
- UniProtKB:
P07687 (UniProtKB/Swiss-Prot), A6JGI7 (UniProtKB/TrEMBL), A0A8L2R8K5 (UniProtKB/TrEMBL)
- Sequence:
MWLELVLASLLGFVIYWFVSRDKEETLPLGDGWWGPGSKPSAKEDESIRPFKVETSDEEIKDLHQRIDRFRASPPLEGSRFHYGFNSNYMKKVVSYWRNEFDWRKQVEILNQYPHFKTKIEGLDIHFI HVKPPQLPSGRTPKPLLMVHGWPGSFYEFYKIIPLLTDPKSHGLSDEHVFEVICPSIPGYGYSEASSKKGLNSVATARIFYKLMTRLGFQKFYIQGGDWGSLICTNMAQMVPNHVKGLHLNMAFISRS FYTMTPLLGQRFGRFLGYTEKDIELLYPYKEKVFYSIMRESGYLHIQATKPDTVGCALNDSPVGLAAYILEKFSTWTKSEYRELEDGGLERKFSLDDLLVNIMIYWTTGTIVSSQRYYKENLGQGIMV HKHEGMKVFVPTGFSAFPSELLHAPEKWVKVKYPKLISYSYMERGGHFAAFEEPKLLAQDIRKFVSLAELQ
hide sequence
Ensembl Acc Id:
ENSRNOP00000074206 ⟸ ENSRNOT00000085279
Ensembl Acc Id:
ENSRNOP00000004780 ⟸ ENSRNOT00000004780
RefSeq Acc Id:
XP_038946306 ⟸ XM_039090378
- Peptide Label:
isoform X1
- UniProtKB:
P07687 (UniProtKB/Swiss-Prot), A6JGI7 (UniProtKB/TrEMBL), A0A8L2R8K5 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000080132 ⟸ ENSRNOT00000109605
Ensembl Acc Id:
ENSRNOP00000034917 ⟸ ENSRNOT00000029787
RGD ID: 13699065
Promoter ID: EPDNEW_R9590
Type: multiple initiation site
Name: Ephx1_2
Description: epoxide hydrolase 1
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Alternative Promoters: null; see alsoEPDNEW_R9591
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 13 99,287,887 - 99,287,947 EPDNEW
RGD ID: 13699066
Promoter ID: EPDNEW_R9591
Type: initiation region
Name: Ephx1_1
Description: epoxide hydrolase 1
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Alternative Promoters: null; see alsoEPDNEW_R9590
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 13 99,300,536 - 99,300,596 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-01-27
Ephx1
epoxide hydrolase 1
Ephx1
epoxide hydrolase 1, microsomal (xenobiotic)
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2013-01-14
Ephx1
epoxide hydrolase 1, microsomal (xenobiotic)
Ephx1
epoxide hydrolase 1, microsomal
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2005-11-17
Ephx1
epoxide hydrolase 1, microsomal
epoxide hydrolase 1
Name updated
1299863
APPROVED
2002-11-06
Ephx1
epoxide hydrolase 1
Epoxide hydrolase 1 (microsomal xenobiotic hydrolase)
Name updated
625702
APPROVED
2002-06-10
Ephx1
Epoxide hydrolase 1 (microsomal xenobiotic hydrolase)
Symbol and Name status set to approved
70586
APPROVED