Symbol:
Eno1 (Ensembl: Eno1-ps1)
Name:
enolase 1 (Ensembl:enolase 1, pseudogene 1)
RGD ID:
2553
Description:
Enables several functions, including heat shock protein binding activity; phosphopyruvate hydratase activity; and protein homodimerization activity. Involved in ERK1 and ERK2 cascade; canonical glycolysis; and cellular response to hypoxia. Located in several cellular components, including growth cone; membrane raft; and synaptic membrane. Part of phosphopyruvate hydratase complex. Biomarker of hypertension. Human ortholog(s) of this gene implicated in Alzheimer's disease. Orthologous to human ENO1 (enolase 1); PARTICIPATES IN gluconeogenesis pathway; Fanconi syndrome pathway; fructose-1,6-bisphosphatase deficiency pathway; INTERACTS WITH 1,2,4-trimethylbenzene; 17alpha-ethynylestradiol; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
2-phospho-D-glycerate hydro-lyase; alpha enolase; alpha-enolase; enolase 1, (alpha); enolase 1, alpha; enolase 1, alpha non-neuron; NNE; non-neural enolase
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ENO1 (enolase 1) HGNC
EggNOG, Ensembl, HomoloGene, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Eno1 (enolase 1, alpha non-neuron) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Eno1 (enolase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ENO1 (enolase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ENO1 (enolase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Eno1 (enolase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ENO1 (enolase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ENO1 (enolase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Eno1 (enolase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Eno1 (enolase 1, alpha non-neuron)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
ENO1 (enolase 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Eno1b (enolase 1B, retrotransposed)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
eno1b (enolase 1b, (alpha))
Alliance
DIOPT (Hieranoid|OMA|OrthoInspector)
Danio rerio (zebrafish):
eno1a (enolase 1a, (alpha))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
ENO1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Eno
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
enol-1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
ENO2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
ERR1
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
ERR2
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
ERR3
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
eno1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Related Pseudogenes:
Eno1-ps1
Eno1-ps4
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 166,002,867 - 166,014,252 (+) NCBI GRCr8 mRatBN7.2 5 160,719,951 - 160,731,337 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 57,576,709 - 57,578,013 (+) Ensembl mRatBN7.2 Ensembl mRatBN7.2 Ensembl 5 160,719,951 - 160,731,336 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 163,436,430 - 163,447,815 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 165,257,901 - 165,269,442 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 165,214,977 - 165,226,362 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 167,288,223 - 167,299,610 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 167,288,223 - 167,299,609 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 170,915,874 - 170,927,267 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 167,394,131 - 167,405,516 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 167,404,823 - 167,415,701 (+) NCBI Celera 5 158,976,607 - 158,987,992 (+) NCBI Celera RH 3.4 Map 5 1122.0 RGD Cytogenetic Map 5 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Eno1 Rat (S)-nicotine multiple interactions ISO Eno1 (Mus musculus) 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Eno1 Rat (Z)-3-butylidenephthalide decreases expression ISO ENO1 (Homo sapiens) 6480464 butylidenephthalide results in decreased expression of ENO1 protein CTD PMID:23770345 Eno1 Rat 1,10-phenanthroline increases expression ISO ENO1 (Homo sapiens) 6480464 1 and 10-phenanthroline results in increased expression of ENO1 mRNA CTD PMID:19502547 Eno1 Rat 1,2,4-trimethylbenzene decreases expression EXP 6480464 pseudocumene results in decreased expression of ENO1 protein CTD PMID:17337753 Eno1 Rat 1,2-dimethylhydrazine multiple interactions ISO Eno1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of ENO1 mRNA CTD PMID:22206623 Eno1 Rat 1,2-dimethylhydrazine increases expression ISO Eno1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of ENO1 mRNA CTD PMID:22206623 Eno1 Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine decreases expression ISO Eno1 (Mus musculus) 6480464 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Eno1 Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine increases expression ISO Eno1 (Mus musculus) 6480464 1-Methyl-4-phenyl-1 more ... CTD PMID:23562983 Eno1 Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine multiple interactions ISO Eno1 (Mus musculus) 6480464 [Caffeine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 and PMID:23562983 Eno1 Rat 14-Deoxy-11,12-didehydroandrographolide decreases expression ISO ENO1 (Homo sapiens) 6480464 14-deoxy-11 and 12-didehydroandrographolide results in decreased expression of ENO1 mRNA CTD PMID:22101062 Eno1 Rat 17alpha-ethynylestradiol increases expression ISO Eno1 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of ENO1 mRNA CTD PMID:17942748 Eno1 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of ENO1 mRNA CTD PMID:12075121 and PMID:17557909 Eno1 Rat 17beta-estradiol increases expression ISO Eno1 (Mus musculus) 6480464 Estradiol results in increased expression of ENO1 mRNA CTD PMID:15289156 Eno1 Rat 17beta-estradiol affects expression ISO Eno1 (Mus musculus) 6480464 Estradiol affects the expression of ENO1 mRNA CTD PMID:39298647 Eno1 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of ENO1 protein CTD PMID:32145629 Eno1 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of ENO1 mRNA CTD PMID:32145629 Eno1 Rat 2,3,7,8-tetrabromodibenzodioxine increases expression ISO Eno1 (Mus musculus) 6480464 2 more ... CTD PMID:27604104 Eno1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of ENO1 mRNA and Tetrachlorodibenzodioxin results in decreased expression of ENO1 protein CTD PMID:16548065 more ... Eno1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Eno1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of ENO1 protein CTD PMID:29935226 Eno1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Eno1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ENO1 mRNA CTD PMID:21570461 and PMID:26377647 Eno1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO ENO1 (Homo sapiens) 6480464 2-methyl-2H-pyrazole-3-carboxylic acid (2-methyl-4-o-tolylazophenyl)amide inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of ENO1 mRNA] and alpha-naphthoflavone inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of ENO1 mRNA] CTD PMID:23152189 Eno1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO ENO1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of ENO1 mRNA CTD PMID:23152189 Eno1 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Eno1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether increases expression EXP 6480464 2 more ... CTD PMID:19954255 Eno1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Eno1 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Eno1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether decreases expression EXP 6480464 2 more ... CTD PMID:19954255 Eno1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether increases expression ISO Eno1 (Mus musculus) 6480464 2 more ... CTD PMID:16451863 and PMID:18550172 Eno1 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of ENO1 mRNA CTD PMID:21346803 Eno1 Rat 2,6-dimethoxyphenol multiple interactions ISO ENO1 (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Eno1 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of ENO1 mRNA CTD PMID:21346803 Eno1 Rat 2-acetamidofluorene multiple interactions EXP 6480464 [2-Acetylaminofluorene co-treated with Diethylnitrosamine] results in increased expression of ENO1 mRNA and [Diethylnitrosamine co-treated with 2-Acetylaminofluorene] results in increased expression of ENO1 mRNA CTD PMID:14656948 and PMID:16158176 Eno1 Rat 2-hydroxypropanoic acid increases expression ISO ENO1 (Homo sapiens) 6480464 Lactic Acid results in increased expression of ENO1 mRNA CTD PMID:30851411 Eno1 Rat 2-methoxyethanol increases expression EXP 6480464 methyl cellosolve results in increased expression of ENO1 protein CTD PMID:15928459 Eno1 Rat 3,3',5-triiodo-L-thyronine increases expression ISO ENO1 (Homo sapiens) 6480464 Triiodothyronine results in increased expression of ENO1 mRNA CTD PMID:15507505 Eno1 Rat 3,4-dihydroxybenzoic acid increases expression ISO ENO1 (Homo sapiens) 6480464 protocatechuic acid results in increased expression of ENO1 mRNA CTD PMID:16227210 Eno1 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Eno1 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of ENO1 mRNA CTD PMID:20188158 Eno1 Rat 3-chloropropane-1,2-diol affects expression EXP 6480464 alpha-Chlorohydrin analog affects the expression of ENO1 protein CTD PMID:26072098 Eno1 Rat 3-chloropropane-1,2-diol decreases expression EXP 6480464 alpha-Chlorohydrin results in decreased expression of ENO1 protein CTD PMID:26072098 Eno1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO ENO1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of ENO1 mRNA CTD PMID:28628672 Eno1 Rat 3H-1,2-dithiole-3-thione increases expression EXP 6480464 1 and 2-dithiol-3-thione results in increased expression of ENO1 mRNA CTD PMID:19162173 Eno1 Rat 4,4'-sulfonyldiphenol increases expression ISO ENO1 (Homo sapiens) 6480464 bisphenol S results in increased expression of ENO1 mRNA and bisphenol S results in increased expression of ENO1 protein CTD PMID:31121516 and PMID:34186270 Eno1 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of ENO1 mRNA CTD PMID:36041667 Eno1 Rat 4,4'-sulfonyldiphenol affects expression ISO Eno1 (Mus musculus) 6480464 bisphenol S affects the expression of ENO1 mRNA CTD PMID:39298647 Eno1 Rat 4-hydroxynon-2-enal affects binding ISO ENO1 (Homo sapiens) 6480464 4-hydroxy-2-nonenal binds to ENO1 protein CTD PMID:19374891 Eno1 Rat 5-aza-2'-deoxycytidine increases expression ISO ENO1 (Homo sapiens) 6480464 Decitabine results in increased expression of ENO1 mRNA CTD PMID:17908484 Eno1 Rat 5-Hydroxythalidomide affects binding ISO Eno1 (Mus musculus) 6480464 5-hydroxythalidomide binds to ENO1 protein CTD PMID:27464947 Eno1 Rat 5-Hydroxythalidomide affects binding ISO ENO1 (Homo sapiens) 6480464 5-hydroxythalidomide binds to ENO1 protein CTD PMID:27464947 Eno1 Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole affects expression EXP 6480464 Omeprazole affects the expression of ENO1 mRNA CTD PMID:19483382 Eno1 Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of ENO1 mRNA CTD PMID:19483382 Eno1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of ENO1 mRNA CTD PMID:30047161 Eno1 Rat 7,12-dimethyltetraphene multiple interactions EXP 6480464 [9 more ... CTD PMID:22248470 Eno1 Rat 7,12-dimethyltetraphene increases expression EXP 6480464 9 more ... CTD PMID:12376462 Eno1 Rat 7,12-dimethyltetraphene decreases expression EXP 6480464 9 more ... CTD PMID:22248470 Eno1 Rat 7H-xanthine multiple interactions EXP 6480464 [Xanthine co-treated with XDH protein] results in decreased expression of ENO1 protein CTD PMID:19464573 Eno1 Rat 9H-xanthine multiple interactions EXP 6480464 [Xanthine co-treated with XDH protein] results in decreased expression of ENO1 protein CTD PMID:19464573 Eno1 Rat afimoxifene decreases response to substance ISO ENO1 (Homo sapiens) 6480464 ENO1 mRNA results in decreased susceptibility to afimoxifene CTD PMID:19655245 Eno1 Rat aflatoxin B1 increases expression ISO Eno1 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of ENO1 mRNA CTD PMID:19770486 Eno1 Rat aflatoxin B1 increases methylation ISO ENO1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of ENO1 gene CTD PMID:28458013 Eno1 Rat aldehydo-D-glucose decreases secretion ISO ENO1 (Homo sapiens) 6480464 Glucose deficiency results in decreased secretion of ENO1 protein CTD PMID:24802182 Eno1 Rat all-trans-retinoic acid affects expression ISO ENO1 (Homo sapiens) 6480464 Tretinoin affects the expression of ENO1 mRNA CTD PMID:16054129 Eno1 Rat all-trans-retinoic acid increases expression ISO ENO1 (Homo sapiens) 6480464 Tretinoin results in increased expression of ENO1 mRNA CTD PMID:33167477 Eno1 Rat all-trans-retinoic acid decreases expression ISO ENO1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of ENO1 mRNA and Tretinoin results in decreased expression of ENO1 protein CTD PMID:17051635 and PMID:21934132 Eno1 Rat alpha-naphthoflavone multiple interactions ISO ENO1 (Homo sapiens) 6480464 alpha-naphthoflavone inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of ENO1 mRNA] CTD PMID:23152189 Eno1 Rat amiodarone affects expression EXP 6480464 Amiodarone affects the expression of ENO1 mRNA CTD PMID:19483382 Eno1 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of ENO1 mRNA CTD PMID:30047161 Eno1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of ENO1 mRNA CTD PMID:16483693 Eno1 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of ENO1 mRNA CTD PMID:30779732 Eno1 Rat amphotericin B multiple interactions ISO ENO1 (Homo sapiens) 6480464 Amphotericin B inhibits the reaction [Oxygen deficiency results in increased expression of ENO1 mRNA] and Amphotericin B results in increased expression of and results in increased secretion of ENO1 protein CTD PMID:16189267 and PMID:26259607 Eno1 Rat aniline increases nitrosation EXP 6480464 aniline results in increased nitrosation of ENO1 protein CTD PMID:21708182 Eno1 Rat antirheumatic drug decreases expression ISO ENO1 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of ENO1 mRNA CTD PMID:24449571 Eno1 Rat aristolochic acid A multiple interactions EXP 6480464 [aristolochic acid I co-treated with aristolochic acid II] results in decreased expression of ENO1 mRNA CTD PMID:23912714 Eno1 Rat aristolochic acid A decreases expression ISO ENO1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of ENO1 mRNA CTD PMID:33212167 Eno1 Rat aristolochic acid A increases expression ISO ENO1 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of ENO1 protein CTD PMID:33212167 Eno1 Rat arsane decreases expression ISO ENO1 (Homo sapiens) 6480464 Arsenic results in decreased expression of ENO1 protein CTD PMID:19818359 Eno1 Rat arsane multiple interactions ISO ENO1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ENO1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of ENO1 mRNA CTD PMID:39836092 Eno1 Rat arsane decreases expression EXP 6480464 Arsenic results in decreased expression of ENO1 mRNA CTD PMID:18315880 Eno1 Rat arsenic atom decreases expression EXP 6480464 Arsenic results in decreased expression of ENO1 mRNA CTD PMID:18315880 Eno1 Rat arsenic atom multiple interactions ISO ENO1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ENO1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of ENO1 mRNA CTD PMID:39836092 Eno1 Rat arsenic atom decreases expression ISO ENO1 (Homo sapiens) 6480464 Arsenic results in decreased expression of ENO1 protein CTD PMID:19818359 Eno1 Rat arsenite(3-) multiple interactions ISO ENO1 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to ENO1 protein] and arsenite results in increased oxidation of and results in decreased activity of ENO1 protein CTD PMID:20196163 and PMID:32406909 Eno1 Rat arsenous acid multiple interactions ISO ENO1 (Homo sapiens) 6480464 [Ascorbic Acid co-treated with Arsenic Trioxide] results in decreased expression of ENO1 protein more ... CTD PMID:38160894 Eno1 Rat arsenous acid decreases expression ISO ENO1 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of ENO1 mRNA and Arsenic Trioxide results in decreased expression of ENO1 protein CTD PMID:38160894 Eno1 Rat Azaspiracid increases expression ISO ENO1 (Homo sapiens) 6480464 azaspiracid results in increased expression of ENO1 mRNA CTD PMID:28939011 Eno1 Rat benzalkonium chloride decreases expression ISO Eno1 (Mus musculus) 6480464 Benzalkonium Compounds results in decreased expression of ENO1 mRNA CTD PMID:31199489 Eno1 Rat benzatropine decreases expression ISO ENO1 (Homo sapiens) 6480464 Benztropine results in decreased expression of ENO1 protein CTD PMID:34122009 Eno1 Rat benzbromarone affects expression EXP 6480464 Benzbromarone affects the expression of ENO1 mRNA CTD PMID:19483382 Eno1 Rat benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of ENO1 protein CTD PMID:16456883 Eno1 Rat benzo[a]pyrene decreases expression ISO ENO1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of ENO1 protein CTD PMID:33278487 Eno1 Rat benzo[a]pyrene increases methylation ISO ENO1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of ENO1 5' UTR CTD PMID:27901495 Eno1 Rat benzo[a]pyrene multiple interactions ISO ENO1 (Homo sapiens) 6480464 [Soot co-treated with Benzo(a)pyrene] results in decreased expression of ENO1 protein CTD PMID:24464499 Eno1 Rat benzo[a]pyrene increases expression ISO ENO1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of ENO1 protein CTD PMID:17292933 and PMID:18495319 Eno1 Rat benzo[a]pyrene multiple interactions EXP 6480464 Benzo(a)pyrene promotes the reaction [sodium arsenite results in increased expression of ENO1 protein] and sodium arsenite promotes the reaction [Benzo(a)pyrene results in increased expression of ENO1 protein] CTD PMID:16456883 Eno1 Rat beta-lapachone increases expression ISO ENO1 (Homo sapiens) 6480464 beta-lapachone results in increased expression of ENO1 mRNA CTD PMID:38218311 Eno1 Rat bexarotene increases expression EXP 6480464 bexarotene results in increased expression of ENO1 mRNA CTD PMID:16648578 Eno1 Rat bis(2-chloroethyl) sulfide decreases expression ISO ENO1 (Homo sapiens) 6480464 Mustard Gas results in decreased expression of ENO1 mRNA CTD PMID:12884408 Eno1 Rat bis(2-ethylhexyl) phthalate increases expression ISO Eno1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of ENO1 mRNA CTD PMID:30284816 and PMID:33754040 Eno1 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO ENO1 (Homo sapiens) 6480464 [Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in decreased methylation of ENO1 5' UTR CTD PMID:33872906 Eno1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ENO1 mRNA and bisphenol A results in increased expression of ENO1 protein CTD PMID:12075121 more ... Eno1 Rat bisphenol A increases expression ISO ENO1 (Homo sapiens) 6480464 bisphenol A results in increased expression of ENO1 protein CTD PMID:37567409 Eno1 Rat bisphenol A decreases expression ISO ENO1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of ENO1 protein CTD PMID:34186270 and PMID:37664457 Eno1 Rat bisphenol A decreases expression ISO Eno1 (Mus musculus) 6480464 bisphenol A results in decreased expression of ENO1 protein CTD PMID:35999755 Eno1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of ENO1 mRNA CTD PMID:36041667 Eno1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ENO1 mRNA CTD PMID:30816183 more ... Eno1 Rat bisphenol A affects expression ISO ENO1 (Homo sapiens) 6480464 bisphenol A affects the expression of ENO1 mRNA CTD PMID:30903817 Eno1 Rat bisphenol A affects methylation ISO Eno1 (Mus musculus) 6480464 bisphenol A affects the methylation of ENO1 promoter CTD PMID:27334623 Eno1 Rat bisphenol A multiple interactions ISO ENO1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of ENO1 mRNA CTD PMID:28628672 Eno1 Rat bisphenol AF increases expression ISO ENO1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of ENO1 protein CTD PMID:34186270 Eno1 Rat Bisphenol B increases expression ISO ENO1 (Homo sapiens) 6480464 bisphenol B results in increased expression of ENO1 protein CTD PMID:34186270 Eno1 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of ENO1 mRNA CTD PMID:36041667 Eno1 Rat bisphenol F increases expression ISO ENO1 (Homo sapiens) 6480464 bisphenol F results in increased expression of ENO1 protein CTD PMID:34186270 Eno1 Rat Brodifacoum increases expression EXP 6480464 bromfenacoum results in increased expression of ENO1 protein CTD PMID:28903499 Eno1 Rat bromobenzene affects binding EXP 6480464 bromobenzene metabolite binds to ENO1 protein CTD PMID:17305373 Eno1 Rat bufalin decreases expression ISO ENO1 (Homo sapiens) 6480464 bufalin results in decreased expression of ENO1 protein CTD PMID:23091618 Eno1 Rat cadmium acetate increases expression ISO ENO1 (Homo sapiens) 6480464 cadmium acetate results in increased expression of ENO1 mRNA CTD PMID:12965115 Eno1 Rat cadmium acetate decreases expression ISO ENO1 (Homo sapiens) 6480464 cadmium acetate results in decreased expression of ENO1 mRNA CTD PMID:18155341 Eno1 Rat cadmium atom multiple interactions ISO ENO1 (Homo sapiens) 6480464 Cadmium inhibits the reaction [Oxygen deficiency results in increased expression of ENO1 mRNA] and Cadmium results in increased expression of and results in increased secretion of ENO1 protein CTD PMID:10866824 and PMID:26259607 Eno1 Rat cadmium dichloride decreases expression ISO ENO1 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of ENO1 mRNA CTD PMID:18560533 Eno1 Rat cadmium dichloride multiple interactions ISO ENO1 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of and results in increased secretion of ENO1 protein CTD PMID:26259607 Eno1 Rat cadmium dichloride increases expression ISO Eno1 (Mus musculus) 6480464 Cadmium Chloride results in increased expression of ENO1 mRNA CTD PMID:24982889 Eno1 Rat cadmium dichloride increases expression ISO ENO1 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of ENO1 mRNA and Cadmium Chloride results in increased expression of ENO1 protein CTD PMID:24527689 and PMID:25596134 Eno1 Rat caffeine multiple interactions ISO Eno1 (Mus musculus) 6480464 [Caffeine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Eno1 Rat caffeine affects phosphorylation ISO ENO1 (Homo sapiens) 6480464 Caffeine affects the phosphorylation of ENO1 protein CTD PMID:35688186 Eno1 Rat carbon nanotube decreases expression ISO Eno1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25620056 Eno1 Rat CGP 52608 multiple interactions ISO ENO1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to ENO1 gene] CTD PMID:28238834 Eno1 Rat chlordecone decreases expression ISO Eno1 (Mus musculus) 6480464 Chlordecone results in decreased expression of ENO1 protein CTD PMID:19666090 Eno1 Rat chlordecone increases expression ISO Eno1 (Mus musculus) 6480464 Chlordecone results in increased expression of ENO1 mRNA CTD PMID:33711761 Eno1 Rat chloroacetaldehyde increases expression ISO ENO1 (Homo sapiens) 6480464 chloroacetaldehyde results in increased expression of ENO1 mRNA CTD PMID:25596134 Eno1 Rat chlorophyllin decreases expression ISO ENO1 (Homo sapiens) 6480464 chlorophyllin analog results in decreased expression of ENO1 protein CTD PMID:22852132 Eno1 Rat chloropicrin increases expression ISO ENO1 (Homo sapiens) 6480464 chloropicrin results in increased expression of ENO1 mRNA CTD PMID:26352163 Eno1 Rat chlorpyrifos decreases expression ISO Eno1 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of ENO1 mRNA CTD PMID:32715474 Eno1 Rat chlorpyrifos increases expression ISO Eno1 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of ENO1 mRNA CTD PMID:37019170 Eno1 Rat choline multiple interactions EXP 6480464 [Folic Acid deficiency co-treated with Methionine deficiency co-treated with Choline deficiency] results in increased expression of ENO1 protein CTD PMID:19566968 Eno1 Rat ciguatoxin CTX1B affects expression ISO Eno1 (Mus musculus) 6480464 Ciguatoxins affects the expression of ENO1 mRNA CTD PMID:18353800 Eno1 Rat cisplatin multiple interactions ISO ENO1 (Homo sapiens) 6480464 Cisplatin results in increased expression of and results in increased secretion of ENO1 protein CTD PMID:26259607 Eno1 Rat clofibrate affects expression EXP 6480464 Clofibrate affects the expression of ENO1 mRNA CTD PMID:19483382 Eno1 Rat clozapine increases expression EXP 6480464 Clozapine results in increased expression of ENO1 mRNA CTD PMID:15860345 Eno1 Rat cobalt dichloride increases expression ISO ENO1 (Homo sapiens) 6480464 cobaltous chloride results in increased expression of ENO1 mRNA and cobaltous chloride results in increased expression of ENO1 protein CTD PMID:19502547 and PMID:22339908 Eno1 Rat cobalt dichloride increases expression EXP 6480464 cobaltous chloride results in increased expression of ENO1 mRNA CTD PMID:24386269 Eno1 Rat cobalt dichloride decreases expression ISO ENO1 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of ENO1 mRNA CTD PMID:19376846 Eno1 Rat cobalt(2+) sulfate increases expression ISO ENO1 (Homo sapiens) 6480464 cobalt sulfate results in increased expression of ENO1 mRNA CTD PMID:19502547 Eno1 Rat copper atom affects binding ISO ENO1 (Homo sapiens) 6480464 ENO1 protein binds to Copper CTD PMID:15359738 Eno1 Rat copper(0) affects binding ISO ENO1 (Homo sapiens) 6480464 ENO1 protein binds to Copper CTD PMID:15359738 Eno1 Rat crocidolite asbestos increases expression ISO ENO1 (Homo sapiens) 6480464 Asbestos and Crocidolite results in increased expression of ENO1 protein CTD PMID:29553831 Eno1 Rat cumene multiple interactions ISO Eno1 (Mus musculus) 6480464 [cumene co-treated with KRAS gene mutant form] results in decreased expression of ENO1 mRNA CTD PMID:18648096 Eno1 Rat curcumin decreases expression ISO ENO1 (Homo sapiens) 6480464 Curcumin results in decreased expression of ENO1 mRNA CTD PMID:16880289 Eno1 Rat cyclosporin A decreases expression ISO ENO1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of ENO1 mRNA CTD PMID:21163907 and PMID:25562108 Eno1 Rat cyclosporin A multiple interactions ISO ENO1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of and results in increased secretion of ENO1 protein CTD PMID:26259607 Eno1 Rat D-glucose decreases secretion ISO ENO1 (Homo sapiens) 6480464 Glucose deficiency results in decreased secretion of ENO1 protein CTD PMID:24802182 Eno1 Rat DDT decreases expression ISO ENO1 (Homo sapiens) 6480464 DDT results in decreased expression of ENO1 protein CTD PMID:26186133 Eno1 Rat desferrioxamine B increases expression ISO ENO1 (Homo sapiens) 6480464 Deferoxamine results in increased expression of ENO1 mRNA CTD PMID:16227210 Eno1 Rat dexamethasone decreases expression ISO Eno1 (Mus musculus) 6480464 Dexamethasone results in decreased expression of ENO1 protein CTD PMID:33567340 Eno1 Rat dexamethasone multiple interactions ISO ENO1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of ENO1 mRNA CTD PMID:28628672 Eno1 Rat dextran sulfate decreases expression ISO Eno1 (Mus musculus) 6480464 Dextran Sulfate results in decreased expression of ENO1 protein CTD PMID:35999755 Eno1 Rat diallyl trisulfide increases expression ISO ENO1 (Homo sapiens) 6480464 diallyl trisulfide results in increased expression of ENO1 protein CTD PMID:16344271 Eno1 Rat diarsenic trioxide multiple interactions ISO ENO1 (Homo sapiens) 6480464 [Ascorbic Acid co-treated with Arsenic Trioxide] results in decreased expression of ENO1 protein more ... CTD PMID:38160894 Eno1 Rat diarsenic trioxide decreases expression ISO ENO1 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of ENO1 mRNA and Arsenic Trioxide results in decreased expression of ENO1 protein CTD PMID:38160894 Eno1 Rat diazinon increases expression ISO Eno1 (Mus musculus) 6480464 Diazinon results in increased expression of ENO1 protein CTD PMID:19647006 Eno1 Rat diazinon increases methylation ISO ENO1 (Homo sapiens) 6480464 Diazinon results in increased methylation of ENO1 gene CTD PMID:22964155 Eno1 Rat dibenzo[a,l]pyrene increases expression ISO ENO1 (Homo sapiens) 6480464 dibenzo(a and l)pyrene results in increased expression of ENO1 protein CTD PMID:18495319 Eno1 Rat Dibutyl phosphate affects expression ISO ENO1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of ENO1 mRNA CTD PMID:37042841 Eno1 Rat dibutyl phthalate increases expression ISO Eno1 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of ENO1 mRNA CTD PMID:21266533 Eno1 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of ENO1 mRNA CTD PMID:17379624 Eno1 Rat diclofenac increases expression ISO Eno1 (Mus musculus) 6480464 Diclofenac results in increased expression of ENO1 mRNA CTD PMID:26934552 Eno1 Rat diethylstilbestrol increases expression ISO Eno1 (Mus musculus) 6480464 Diethylstilbestrol results in increased expression of ENO1 mRNA CTD PMID:15289156 Eno1 Rat dihydroartemisinin affects binding ISO ENO1 (Homo sapiens) 6480464 artenimol analog binds to ENO1 protein CTD PMID:26340163 Eno1 Rat Diosbulbin B decreases expression ISO Eno1 (Mus musculus) 6480464 diosbulbin B results in decreased expression of ENO1 mRNA CTD PMID:32148032 Eno1 Rat dioxygen multiple interactions ISO ENO1 (Homo sapiens) 6480464 Amphotericin B inhibits the reaction [Oxygen deficiency results in increased expression of ENO1 mRNA] and Cadmium inhibits the reaction [Oxygen deficiency results in increased expression of ENO1 mRNA] CTD PMID:10866824 and PMID:16189267 Eno1 Rat dioxygen increases expression ISO ENO1 (Homo sapiens) 6480464 Oxygen deficiency results in increased expression of ENO1 mRNA CTD PMID:10866824 more ... Eno1 Rat diquat increases expression ISO Eno1 (Mus musculus) 6480464 Diquat results in increased expression of ENO1 mRNA CTD PMID:36851058 Eno1 Rat diuron increases expression EXP 6480464 Diuron results in increased expression of ENO1 mRNA CTD PMID:21551480 Eno1 Rat diuron decreases expression ISO ENO1 (Homo sapiens) 6480464 Diuron results in decreased expression of ENO1 mRNA CTD PMID:35967413 Eno1 Rat dorsomorphin multiple interactions ISO ENO1 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Eno1 Rat doxorubicin increases oxidation EXP 6480464 Doxorubicin results in increased oxidation of ENO1 protein CTD PMID:28818578 Eno1 Rat enzyme inhibitor multiple interactions ISO ENO1 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of ENO1 protein CTD PMID:23301498 Eno1 Rat ethanol increases expression EXP 6480464 Ethanol results in increased expression of ENO1 mRNA CTD PMID:15353170 Eno1 Rat ethanol affects splicing ISO Eno1 (Mus musculus) 6480464 Ethanol affects the splicing of ENO1 mRNA CTD PMID:30319688 Eno1 Rat ethanol multiple interactions ISO Eno1 (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in increased expression of ENO1 mRNA CTD PMID:30517762 Eno1 Rat ethanol increases expression ISO ENO1 (Homo sapiens) 6480464 Ethanol results in increased expression of ENO1 protein CTD PMID:20621659 Eno1 Rat ethanol decreases expression ISO ENO1 (Homo sapiens) 6480464 Ethanol results in decreased expression of ENO1 protein CTD PMID:20621659 Eno1 Rat etoposide decreases expression ISO Eno1 (Mus musculus) 6480464 Etoposide results in decreased expression of ENO1 protein CTD PMID:29733421 Eno1 Rat fenofibrate increases expression ISO ENO1 (Homo sapiens) 6480464 Fenofibrate results in increased expression of ENO1 mRNA CTD PMID:25596134 Eno1 Rat fenthion increases expression ISO Eno1 (Mus musculus) 6480464 Fenthion results in increased expression of ENO1 mRNA CTD PMID:34813904 Eno1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of ENO1 mRNA CTD PMID:24136188 Eno1 Rat folic acid multiple interactions EXP 6480464 [Folic Acid deficiency co-treated with Methionine deficiency co-treated with Choline deficiency] results in increased expression of ENO1 protein CTD PMID:19566968 Eno1 Rat folic acid multiple interactions ISO Eno1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of ENO1 mRNA CTD PMID:22206623 Eno1 Rat FR900359 increases phosphorylation ISO ENO1 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of ENO1 protein CTD PMID:37730182 Eno1 Rat furan increases expression EXP 6480464 furan results in increased expression of ENO1 mRNA CTD PMID:15120968 Eno1 Rat furan affects activity EXP 6480464 furan affects the activity of ENO1 protein CTD PMID:27402187 Eno1 Rat furan affects binding EXP 6480464 furan binds to ENO1 protein CTD PMID:22240984 Eno1 Rat furfural multiple interactions ISO ENO1 (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Eno1 Rat genistein increases expression ISO Eno1 (Mus musculus) 6480464 Genistein results in increased expression of ENO1 mRNA CTD PMID:15289156 Eno1 Rat genistein increases expression EXP 6480464 Genistein results in increased expression of ENO1 mRNA CTD PMID:12075121 Eno1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of ENO1 protein CTD PMID:22061828 Eno1 Rat glucose decreases secretion ISO ENO1 (Homo sapiens) 6480464 Glucose deficiency results in decreased secretion of ENO1 protein CTD PMID:24802182 Eno1 Rat gold atom multiple interactions ISO Eno1 (Mus musculus) 6480464 Gold analog results in decreased expression of and results in increased phosphorylation of ENO1 protein CTD PMID:24780912 Eno1 Rat gold(0) multiple interactions ISO Eno1 (Mus musculus) 6480464 Gold analog results in decreased expression of and results in increased phosphorylation of ENO1 protein CTD PMID:24780912 Eno1 Rat GW 4064 decreases expression ISO Eno1 (Mus musculus) 6480464 GW 4064 results in decreased expression of ENO1 protein CTD PMID:23178280 Eno1 Rat haloperidol increases expression EXP 6480464 Haloperidol results in increased expression of ENO1 mRNA CTD PMID:15860345 Eno1 Rat hyaluronic acid decreases expression EXP 6480464 Hyaluronic Acid analog results in decreased expression of ENO1 protein CTD PMID:23178681 Eno1 Rat hydrogen peroxide decreases activity ISO ENO1 (Homo sapiens) 6480464 Hydrogen Peroxide results in decreased activity of ENO1 protein CTD PMID:20196163 Eno1 Rat hydrogen peroxide decreases expression EXP 6480464 Hydrogen Peroxide results in decreased expression of ENO1 protein CTD PMID:23178681 Eno1 Rat ibuprofen affects expression ISO ENO1 (Homo sapiens) 6480464 Ibuprofen affects the expression of ENO1 protein CTD PMID:18351690 Eno1 Rat ibuprofen increases expression ISO ENO1 (Homo sapiens) 6480464 Ibuprofen results in increased expression of ENO1 mRNA CTD PMID:25596134 Eno1 Rat indometacin multiple interactions ISO ENO1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of ENO1 mRNA CTD PMID:28628672 Eno1 Rat indometacin decreases expression EXP 6480464 Indomethacin results in decreased expression of ENO1 mRNA CTD PMID:36868495 Eno1 Rat inulin multiple interactions ISO Eno1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of ENO1 mRNA CTD PMID:36331819 Eno1 Rat iodide salt multiple interactions EXP 6480464 [hexabromocyclododecane co-treated with Iodides deficiency] results in decreased expression of ENO1 protein CTD PMID:26795019 Eno1 Rat irinotecan decreases expression ISO ENO1 (Homo sapiens) 6480464 Irinotecan analog results in decreased expression of ENO1 mRNA CTD PMID:18927307 Eno1 Rat isoflavones multiple interactions EXP 6480464 [9 more ... CTD PMID:22248470 Eno1 Rat isoprenaline decreases expression ISO Eno1 (Mus musculus) 6480464 Isoproterenol results in decreased expression of ENO1 mRNA CTD PMID:20003209 Eno1 Rat ivermectin decreases expression ISO ENO1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of ENO1 protein CTD PMID:32959892 Eno1 Rat L-ascorbic acid decreases expression ISO ENO1 (Homo sapiens) 6480464 Ascorbic Acid results in decreased expression of ENO1 mRNA and Ascorbic Acid results in decreased expression of ENO1 protein CTD PMID:38160894 Eno1 Rat L-ascorbic acid multiple interactions ISO ENO1 (Homo sapiens) 6480464 [Ascorbic Acid co-treated with Arsenic Trioxide] results in decreased expression of ENO1 protein more ... CTD PMID:38160894 Eno1 Rat L-ethionine affects expression EXP 6480464 Ethionine affects the expression of ENO1 mRNA CTD PMID:19483382 Eno1 Rat L-methionine multiple interactions EXP 6480464 [Folic Acid deficiency co-treated with Methionine deficiency co-treated with Choline deficiency] results in increased expression of ENO1 protein CTD PMID:19566968 Eno1 Rat lead diacetate increases expression ISO Eno1 (Mus musculus) 6480464 lead acetate results in increased expression of ENO1 protein CTD PMID:20797405 Eno1 Rat lead(II) chloride increases expression ISO ENO1 (Homo sapiens) 6480464 lead chloride results in increased expression of ENO1 protein CTD PMID:24419708 Eno1 Rat Macrosphelide A multiple interactions ISO ENO1 (Homo sapiens) 6480464 macrosphelide A binds to and results in decreased activity of ENO1 protein CTD PMID:34681284 Eno1 Rat maneb multiple interactions ISO Eno1 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in increased expression of ENO1 protein more ... CTD PMID:17532186 more ... Eno1 Rat manganese atom decreases activity ISO Eno1 (Mus musculus) 6480464 Manganese results in decreased activity of ENO1 protein CTD PMID:22191580 Eno1 Rat manganese atom multiple interactions ISO ENO1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ENO1 mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of ENO1 mRNA CTD PMID:39836092 Eno1 Rat manganese(0) decreases activity ISO Eno1 (Mus musculus) 6480464 Manganese results in decreased activity of ENO1 protein CTD PMID:22191580 Eno1 Rat manganese(0) multiple interactions ISO ENO1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ENO1 mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of ENO1 mRNA CTD PMID:39836092 Eno1 Rat manganese(II) chloride multiple interactions ISO ENO1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ENO1 mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of ENO1 mRNA CTD PMID:39836092 Eno1 Rat mercury dichloride multiple interactions ISO ENO1 (Homo sapiens) 6480464 Mercuric Chloride results in increased expression of and results in increased secretion of ENO1 protein CTD PMID:26259607 Eno1 Rat methamphetamine decreases expression EXP 6480464 Methamphetamine results in decreased expression of ENO1 protein CTD PMID:19826936 Eno1 Rat methidathion affects expression ISO Eno1 (Mus musculus) 6480464 methidathion affects the expression of ENO1 mRNA CTD PMID:34813904 Eno1 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of ENO1 mRNA CTD PMID:30047161 Eno1 Rat methotrexate increases expression ISO ENO1 (Homo sapiens) 6480464 Methotrexate results in increased expression of ENO1 protein CTD PMID:24736981 Eno1 Rat methyl methanesulfonate decreases expression ISO ENO1 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of ENO1 mRNA CTD PMID:23649840 Eno1 Rat minocycline multiple interactions ISO Eno1 (Mus musculus) 6480464 Minocycline inhibits the reaction [1-Methyl-4-phenyl-1 more ... CTD PMID:23562983 Eno1 Rat mono(2-ethylhexyl) phthalate multiple interactions ISO ENO1 (Homo sapiens) 6480464 [Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in decreased methylation of ENO1 5' UTR CTD PMID:33872906 Eno1 Rat motexafin gadolinium increases expression ISO ENO1 (Homo sapiens) 6480464 motexafin gadolinium results in increased expression of ENO1 mRNA CTD PMID:16357179 Eno1 Rat N-methyl-4-phenylpyridinium decreases expression ISO Eno1 (Mus musculus) 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of ENO1 mRNA CTD PMID:17475336 and PMID:22776087 Eno1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [2-Acetylaminofluorene co-treated with Diethylnitrosamine] results in increased expression of ENO1 mRNA and [Diethylnitrosamine co-treated with 2-Acetylaminofluorene] results in increased expression of ENO1 mRNA CTD PMID:14656948 and PMID:16158176 Eno1 Rat N-nitrosomorpholine affects expression EXP 6480464 N-nitrosomorpholine affects the expression of ENO1 protein CTD PMID:19716841 Eno1 Rat nickel atom increases expression ISO ENO1 (Homo sapiens) 6480464 Nickel results in increased expression of ENO1 mRNA CTD PMID:24768652 and PMID:25583101 Eno1 Rat nickel sulfate increases expression ISO Eno1 (Mus musculus) 6480464 nickel sulfate results in increased expression of ENO1 mRNA CTD PMID:16100012 Eno1 Rat nicotine multiple interactions ISO Eno1 (Mus musculus) 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Eno1 Rat nitrofen decreases expression EXP 6480464 nitrofen results in decreased expression of ENO1 mRNA CTD PMID:20638522 Eno1 Rat Nonylphenol decreases expression EXP 6480464 nonylphenol results in decreased expression of ENO1 protein CTD PMID:19260726 Eno1 Rat obeticholic acid decreases expression ISO ENO1 (Homo sapiens) 6480464 obeticholic acid results in decreased expression of ENO1 mRNA CTD PMID:27939613 Eno1 Rat ochratoxin A increases expression EXP 6480464 ochratoxin A results in increased expression of ENO1 protein CTD PMID:31369848 Eno1 Rat omeprazole affects expression EXP 6480464 Omeprazole affects the expression of ENO1 mRNA CTD PMID:19483382 Eno1 Rat ozone increases expression EXP 6480464 Ozone results in increased expression of ENO1 mRNA CTD PMID:25838073 Eno1 Rat ozone multiple interactions ISO Eno1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of ENO1 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of ENO1 mRNA CTD PMID:34911549 Eno1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of ENO1 mRNA and Acetaminophen results in increased expression of ENO1 protein CTD PMID:15800402 and PMID:16538041 Eno1 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of ENO1 mRNA CTD PMID:33387578 Eno1 Rat paracetamol multiple interactions ISO Eno1 (Mus musculus) 6480464 [CTH gene mutant form results in increased susceptibility to Acetaminophen] which results in increased expression of ENO1 protein CTD PMID:25499718 Eno1 Rat paracetamol decreases expression ISO ENO1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of ENO1 mRNA CTD PMID:21420995 Eno1 Rat paraoxon decreases expression ISO ENO1 (Homo sapiens) 6480464 Paraoxon results in decreased expression of ENO1 protein CTD PMID:20931991 Eno1 Rat paraquat multiple interactions ISO Eno1 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in increased expression of ENO1 protein more ... CTD PMID:17532186 more ... Eno1 Rat paraquat increases expression ISO ENO1 (Homo sapiens) 6480464 Paraquat results in increased expression of ENO1 protein CTD PMID:34064677 Eno1 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of ENO1 mRNA CTD PMID:32680482 Eno1 Rat paraquat decreases expression ISO Eno1 (Mus musculus) 6480464 Paraquat results in decreased expression of ENO1 mRNA and Paraquat results in decreased expression of ENO1 protein CTD PMID:27111068 Eno1 Rat PCB138 increases expression EXP 6480464 2 more ... CTD PMID:21673325 Eno1 Rat perfluorooctane-1-sulfonic acid affects expression ISO Eno1 (Mus musculus) 6480464 perfluorooctane sulfonic acid affects the expression of ENO1 mRNA CTD PMID:19429403 Eno1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Eno1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of ENO1 mRNA CTD PMID:36331819 Eno1 Rat perfluorooctanoic acid affects expression ISO Eno1 (Mus musculus) 6480464 perfluorooctanoic acid affects the expression of ENO1 mRNA CTD PMID:19429403 Eno1 Rat perfluorooctanoic acid increases expression ISO Eno1 (Mus musculus) 6480464 perfluorooctanoic acid results in increased expression of ENO1 protein CTD PMID:37422089 Eno1 Rat perfluorooctanoic acid decreases expression ISO ENO1 (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of ENO1 mRNA CTD PMID:36326898 Eno1 Rat Pf-06840003 increases expression ISO Eno1 (Mus musculus) 6480464 PF-06840003 results in increased expression of ENO1 mRNA CTD PMID:39172838 Eno1 Rat Pf-06840003 multiple interactions ISO ENO1 (Homo sapiens) 6480464 PF-06840003 inhibits the reaction [MAPT protein mutant form results in decreased expression of ENO1 mRNA] CTD PMID:39172838 Eno1 Rat Pf-06840003 multiple interactions ISO Eno1 (Mus musculus) 6480464 PF-06840003 inhibits the reaction [[amyloid beta-protein (1-42) binds to MAPT protein] which results in decreased expression of ENO1 mRNA] CTD PMID:39172838 Eno1 Rat PhIP increases expression EXP 6480464 2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in increased expression of ENO1 mRNA CTD PMID:12376462 Eno1 Rat pinosylvin decreases expression ISO ENO1 (Homo sapiens) 6480464 pinosylvin results in decreased expression of ENO1 mRNA CTD PMID:23333577 Eno1 Rat pirinixic acid affects expression EXP 6480464 pirinixic acid affects the expression of ENO1 mRNA CTD PMID:19483382 Eno1 Rat propiconazole increases metabolic processing ISO Eno1 (Mus musculus) 6480464 propiconazole results in increased metabolism of ENO1 protein CTD PMID:19714882 Eno1 Rat prostaglandin A1 increases metabolic processing ISO Eno1 (Mus musculus) 6480464 prostaglandin A1 analog results in increased metabolism of ENO1 protein CTD PMID:19800325 Eno1 Rat pyrogallol increases expression ISO Eno1 (Mus musculus) 6480464 Pyrogallol results in increased expression of ENO1 mRNA CTD PMID:20362636 Eno1 Rat quercetin increases expression ISO ENO1 (Homo sapiens) 6480464 Quercetin results in increased expression of ENO1 protein CTD PMID:17292933 and PMID:19207037 Eno1 Rat rac-lactic acid increases expression ISO ENO1 (Homo sapiens) 6480464 Lactic Acid results in increased expression of ENO1 mRNA CTD PMID:30851411 Eno1 Rat resveratrol decreases expression ISO ENO1 (Homo sapiens) 6480464 resveratrol results in decreased expression of ENO1 mRNA CTD PMID:15582268 Eno1 Rat rotenone increases oxidation EXP 6480464 Rotenone results in increased oxidation of ENO1 protein CTD PMID:30951809 Eno1 Rat sarin decreases expression EXP 6480464 Sarin results in decreased expression of ENO1 protein CTD PMID:28973502 Eno1 Rat saxitoxin affects expression ISO Eno1 (Mus musculus) 6480464 Saxitoxin affects the expression of ENO1 protein CTD PMID:29228856 Eno1 Rat SB 431542 multiple interactions ISO ENO1 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 and PMID:37664457 Eno1 Rat silicon dioxide increases secretion ISO ENO1 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased secretion of ENO1 protein CTD PMID:25895662 Eno1 Rat simvastatin decreases expression EXP 6480464 Simvastatin results in decreased expression of ENO1 protein CTD PMID:20217863 Eno1 Rat sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of ENO1 protein CTD PMID:16456883 and PMID:29459688 Eno1 Rat sodium arsenite multiple interactions EXP 6480464 Benzo(a)pyrene promotes the reaction [sodium arsenite results in increased expression of ENO1 protein] and sodium arsenite promotes the reaction [Benzo(a)pyrene results in increased expression of ENO1 protein] CTD PMID:16456883 Eno1 Rat sodium arsenite increases expression ISO Eno1 (Mus musculus) 6480464 sodium arsenite results in increased expression of ENO1 mRNA CTD PMID:17450228 Eno1 Rat sodium arsenite increases expression ISO ENO1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of ENO1 mRNA and sodium arsenite results in increased expression of ENO1 protein CTD PMID:23648393 more ... Eno1 Rat sodium arsenite multiple interactions ISO ENO1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ENO1 mRNA more ... CTD PMID:26259607 more ... Eno1 Rat sodium arsenite decreases expression ISO ENO1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of ENO1 mRNA and sodium arsenite results in decreased expression of ENO1 protein CTD PMID:20050688 and PMID:38568856 Eno1 Rat sodium chloride multiple interactions ISO ENO1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of ENO1 protein more ... CTD PMID:38598786 Eno1 Rat sodium fluoride increases expression ISO Eno1 (Mus musculus) 6480464 Sodium Fluoride results in increased expression of ENO1 protein CTD PMID:27548804 Eno1 Rat streptozocin increases expression EXP 6480464 Streptozocin results in increased expression of ENO1 protein CTD PMID:24924950 Eno1 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of ENO1 mRNA CTD PMID:30047161 Eno1 Rat sunitinib increases expression ISO ENO1 (Homo sapiens) 6480464 Sunitinib results in increased expression of ENO1 mRNA CTD PMID:31533062 Eno1 Rat T-2 toxin affects expression EXP 6480464 T-2 Toxin affects the expression of ENO1 protein CTD PMID:26141394 Eno1 Rat tanespimycin increases expression ISO ENO1 (Homo sapiens) 6480464 tanespimycin analog results in increased expression of ENO1 protein CTD PMID:31370342 Eno1 Rat tetrachloromethane multiple interactions ISO Eno1 (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in increased expression of ENO1 mRNA CTD PMID:30517762 Eno1 Rat thapsigargin increases expression EXP 6480464 Thapsigargin results in increased expression of ENO1 protein CTD PMID:35544339 Eno1 Rat thimerosal decreases expression ISO ENO1 (Homo sapiens) 6480464 Thimerosal results in decreased expression of ENO1 mRNA CTD PMID:27188386 Eno1 Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of ENO1 mRNA CTD PMID:19483382 Eno1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of ENO1 mRNA CTD PMID:34492290 Eno1 Rat thiram decreases expression ISO ENO1 (Homo sapiens) 6480464 Thiram results in decreased expression of ENO1 mRNA CTD PMID:38568856 Eno1 Rat titanium dioxide decreases expression ISO Eno1 (Mus musculus) 6480464 titanium dioxide results in decreased expression of ENO1 mRNA CTD PMID:23557971 Eno1 Rat titanium dioxide decreases methylation ISO Eno1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of ENO1 promoter CTD PMID:35295148 Eno1 Rat titanium dioxide increases expression ISO Eno1 (Mus musculus) 6480464 titanium dioxide results in increased expression of ENO1 mRNA CTD PMID:29264374 Eno1 Rat toosendanin increases activity EXP 6480464 toosendanin results in increased activity of ENO1 protein CTD PMID:30848893 Eno1 Rat toosendanin affects binding EXP 6480464 toosendanin metabolite binds to ENO1 protein CTD PMID:30848893 Eno1 Rat trans-pinosylvin decreases expression ISO ENO1 (Homo sapiens) 6480464 pinosylvin results in decreased expression of ENO1 mRNA CTD PMID:23333577 Eno1 Rat trichloroethene increases expression ISO Eno1 (Mus musculus) 6480464 Trichloroethylene results in increased expression of ENO1 mRNA CTD PMID:19254012 Eno1 Rat trichostatin A increases expression ISO ENO1 (Homo sapiens) 6480464 trichostatin A results in increased expression of ENO1 mRNA CTD PMID:24935251 and PMID:26272509 Eno1 Rat trichostatin A affects expression ISO ENO1 (Homo sapiens) 6480464 trichostatin A affects the expression of ENO1 mRNA CTD PMID:28542535 Eno1 Rat trichostatin A multiple interactions ISO ENO1 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ENO1 mRNA CTD PMID:27188386 Eno1 Rat trimellitic anhydride increases expression ISO Eno1 (Mus musculus) 6480464 trimellitic anhydride results in increased expression of ENO1 mRNA CTD PMID:19042947 Eno1 Rat triphenylstannane decreases expression ISO ENO1 (Homo sapiens) 6480464 triphenyltin analog results in decreased expression of ENO1 protein CTD PMID:31634547 Eno1 Rat triptonide decreases expression ISO Eno1 (Mus musculus) 6480464 triptonide results in decreased expression of ENO1 mRNA CTD PMID:33045310 Eno1 Rat troglitazone decreases expression EXP 6480464 troglitazone results in decreased expression of ENO1 protein CTD PMID:21315101 Eno1 Rat urethane decreases expression ISO ENO1 (Homo sapiens) 6480464 Urethane results in decreased expression of ENO1 mRNA CTD PMID:28818685 Eno1 Rat valproic acid increases expression ISO ENO1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of ENO1 mRNA CTD PMID:23179753 more ... Eno1 Rat valproic acid multiple interactions ISO ENO1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ENO1 mRNA CTD PMID:27188386 Eno1 Rat vitamin E increases expression ISO ENO1 (Homo sapiens) 6480464 Vitamin E results in increased expression of ENO1 mRNA CTD PMID:19244175 Eno1 Rat vorinostat increases expression ISO ENO1 (Homo sapiens) 6480464 vorinostat results in increased expression of ENO1 protein CTD PMID:20543569 Eno1 Rat zinc acetate increases expression ISO ENO1 (Homo sapiens) 6480464 Zinc Acetate results in increased expression of ENO1 mRNA CTD PMID:16357179 Eno1 Rat zinc atom affects binding ISO ENO1 (Homo sapiens) 6480464 ENO1 protein binds to Zinc CTD PMID:14534351 Eno1 Rat zinc atom increases expression EXP 6480464 Zinc deficiency results in increased expression of ENO1 mRNA CTD PMID:16140947 Eno1 Rat zinc atom multiple interactions EXP 6480464 Zinc inhibits the reaction [Zinc deficiency results in increased expression of ENO1 mRNA] CTD PMID:16140947 Eno1 Rat zinc(0) affects binding ISO ENO1 (Homo sapiens) 6480464 ENO1 protein binds to Zinc CTD PMID:14534351 Eno1 Rat zinc(0) multiple interactions EXP 6480464 Zinc inhibits the reaction [Zinc deficiency results in increased expression of ENO1 mRNA] CTD PMID:16140947 Eno1 Rat zinc(0) increases expression EXP 6480464 Zinc deficiency results in increased expression of ENO1 mRNA CTD PMID:16140947
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(S)-nicotine (ISO) (Z)-3-butylidenephthalide (ISO) 1,10-phenanthroline (ISO) 1,2,4-trimethylbenzene (EXP) 1,2-dimethylhydrazine (ISO) 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO) 14-Deoxy-11,12-didehydroandrographolide (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrabromodibenzodioxine (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP,ISO) 2,4-dinitrotoluene (EXP) 2,6-dimethoxyphenol (ISO) 2,6-dinitrotoluene (EXP) 2-acetamidofluorene (EXP) 2-hydroxypropanoic acid (ISO) 2-methoxyethanol (EXP) 3,3',5-triiodo-L-thyronine (ISO) 3,4-dihydroxybenzoic acid (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-chloropropane-1,2-diol (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3H-1,2-dithiole-3-thione (EXP) 4,4'-sulfonyldiphenol (EXP,ISO) 4-hydroxynon-2-enal (ISO) 5-aza-2'-deoxycytidine (ISO) 5-Hydroxythalidomide (ISO) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP) 6-propyl-2-thiouracil (EXP) 7,12-dimethyltetraphene (EXP) 7H-xanthine (EXP) 9H-xanthine (EXP) afimoxifene (ISO) aflatoxin B1 (ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (ISO) alpha-naphthoflavone (ISO) amiodarone (EXP) amitrole (EXP) ammonium chloride (EXP) amphetamine (EXP) amphotericin B (ISO) aniline (EXP) antirheumatic drug (ISO) aristolochic acid A (EXP,ISO) arsane (EXP,ISO) arsenic atom (EXP,ISO) arsenite(3-) (ISO) arsenous acid (ISO) Azaspiracid (ISO) benzalkonium chloride (ISO) benzatropine (ISO) benzbromarone (EXP) benzo[a]pyrene (EXP,ISO) beta-lapachone (ISO) bexarotene (EXP) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (EXP,ISO) Brodifacoum (EXP) bromobenzene (EXP) bufalin (ISO) cadmium acetate (ISO) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chlordecone (ISO) chloroacetaldehyde (ISO) chlorophyllin (ISO) chloropicrin (ISO) chlorpyrifos (ISO) choline (EXP) ciguatoxin CTX1B (ISO) cisplatin (ISO) clofibrate (EXP) clozapine (EXP) cobalt dichloride (EXP,ISO) cobalt(2+) sulfate (ISO) copper atom (ISO) copper(0) (ISO) crocidolite asbestos (ISO) cumene (ISO) curcumin (ISO) cyclosporin A (ISO) D-glucose (ISO) DDT (ISO) desferrioxamine B (ISO) dexamethasone (ISO) dextran sulfate (ISO) diallyl trisulfide (ISO) diarsenic trioxide (ISO) diazinon (ISO) dibenzo[a,l]pyrene (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) diclofenac (ISO) diethylstilbestrol (ISO) dihydroartemisinin (ISO) Diosbulbin B (ISO) dioxygen (ISO) diquat (ISO) diuron (EXP,ISO) dorsomorphin (ISO) doxorubicin (EXP) enzyme inhibitor (ISO) ethanol (EXP,ISO) etoposide (ISO) fenofibrate (ISO) fenthion (ISO) flutamide (EXP) folic acid (EXP,ISO) FR900359 (ISO) furan (EXP) furfural (ISO) genistein (EXP,ISO) gentamycin (EXP) glucose (ISO) gold atom (ISO) gold(0) (ISO) GW 4064 (ISO) haloperidol (EXP) hyaluronic acid (EXP) hydrogen peroxide (EXP,ISO) ibuprofen (ISO) indometacin (EXP,ISO) inulin (ISO) iodide salt (EXP) irinotecan (ISO) isoflavones (EXP) isoprenaline (ISO) ivermectin (ISO) L-ascorbic acid (ISO) L-ethionine (EXP) L-methionine (EXP) lead diacetate (ISO) lead(II) chloride (ISO) Macrosphelide A (ISO) maneb (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) mercury dichloride (ISO) methamphetamine (EXP) methidathion (ISO) methimazole (EXP) methotrexate (ISO) methyl methanesulfonate (ISO) minocycline (ISO) mono(2-ethylhexyl) phthalate (ISO) motexafin gadolinium (ISO) N-methyl-4-phenylpyridinium (ISO) N-nitrosodiethylamine (EXP) N-nitrosomorpholine (EXP) nickel atom (ISO) nickel sulfate (ISO) nicotine (ISO) nitrofen (EXP) Nonylphenol (EXP) obeticholic acid (ISO) ochratoxin A (EXP) omeprazole (EXP) ozone (EXP,ISO) paracetamol (EXP,ISO) paraoxon (ISO) paraquat (EXP,ISO) PCB138 (EXP) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) Pf-06840003 (ISO) PhIP (EXP) pinosylvin (ISO) pirinixic acid (EXP) propiconazole (ISO) prostaglandin A1 (ISO) pyrogallol (ISO) quercetin (ISO) rac-lactic acid (ISO) resveratrol (ISO) rotenone (EXP) sarin (EXP) saxitoxin (ISO) SB 431542 (ISO) silicon dioxide (ISO) simvastatin (EXP) sodium arsenite (EXP,ISO) sodium chloride (ISO) sodium fluoride (ISO) streptozocin (EXP) sulfadimethoxine (EXP) sunitinib (ISO) T-2 toxin (EXP) tanespimycin (ISO) tetrachloromethane (ISO) thapsigargin (EXP) thimerosal (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) toosendanin (EXP) trans-pinosylvin (ISO) trichloroethene (ISO) trichostatin A (ISO) trimellitic anhydride (ISO) triphenylstannane (ISO) triptonide (ISO) troglitazone (EXP) urethane (ISO) valproic acid (ISO) vitamin E (ISO) vorinostat (ISO) zinc acetate (ISO) zinc atom (EXP,ISO) zinc(0) (EXP,ISO)
Cellular Component
cell cortex (IDA,ISO) cell surface (IDA,ISO) cytoplasm (IDA,IEA,ISO) cytosol (IDA,ISO) growth cone (IDA) membrane (IEA,ISO) membrane raft (IDA) nuclear outer membrane (ISO) phosphopyruvate hydratase complex (IBA,IC,IDA,IEA,ISO) plasma membrane (IDA,IEA,ISO) synaptic membrane (IDA)
1.
Evidence that stimulation of gluconeogenesis by fatty acid is mediated through thermodynamic mechanisms.
Berry MN, etal., FEBS Lett. 1988 Apr 11;231(1):19-24.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
4.
Differential protein expression in hypertrophic heart with and without hypertension in spontaneously hypertensive rats.
Jin X, etal., Proteomics. 2006 Mar;6(6):1948-56.
5.
Alpha gamma-enolase in the rat: ontogeny and tissue distribution.
Jorgensen OS and Centervall G, J Neurochem. 1982 Aug;39(2):537-42.
6.
Structure of human alpha-enolase (hENO1), a multifunctional glycolytic enzyme.
Kang HJ, etal., Acta Crystallogr D Biol Crystallogr. 2008 Jun;64(Pt 6):651-7. Epub 2008 May 14.
7.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
8.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
9.
Proteomic characterisation of neuronal sphingolipid-cholesterol microdomains: role in plasminogen activation.
Ledesma MD, etal., Brain Res. 2003 Oct 10;987(1):107-16.
10.
Constitutive heat shock protein 70 interacts with alpha-enolase and protects cardiomyocytes against oxidative stress.
Luo Q, etal., Free Radic Res. 2011 Nov;45(11-12):1355-65. doi: 10.3109/10715762.2011.627330.
11.
ERK1/2 regulates intracellular ATP levels through alpha-enolase expression in cardiomyocytes exposed to ischemic hypoxia and reoxygenation.
Mizukami Y, etal., J Biol Chem. 2004 Nov 26;279(48):50120-31. Epub 2004 Sep 30.
12.
Plasminogen binds specifically to alpha-enolase on rat neuronal plasma membrane.
Nakajima K, etal., J Neurochem. 1994 Dec;63(6):2048-57.
13.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
14.
An increase in S-glutathionylated proteins in the Alzheimer's disease inferior parietal lobule, a proteomics approach.
Newman SF, etal., J Neurosci Res. 2007 May 15;85(7):1506-14. doi: 10.1002/jnr.21275.
15.
Cathepsin X cleaves the C-terminal dipeptide of alpha- and gamma-enolase and impairs survival and neuritogenesis of neuronal cells.
Obermajer N, etal., Int J Biochem Cell Biol. 2009 Aug-Sep;41(8-9):1685-96. doi: 10.1016/j.biocel.2009.02.019. Epub 2009 Mar 6.
16.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
17.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
18.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
19.
GOA pipeline
RGD automated data pipeline
20.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
21.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
22.
Comprehensive gene review and curation
RGD comprehensive gene curation
23.
Molecular cloning and the nucleotide sequence of cDNA to mRNA for non-neuronal enolase (alpha alpha enolase) of rat brain and liver.
Sakimura K, etal., Nucleic Acids Res 1985 Jun 25;13(12):4365-78.
24.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
25.
Localization of enolase in synaptic plasma membrane as an alphagamma heterodimer in rat brain.
Ueta H, etal., Neurosci Res. 2004 Apr;48(4):379-86.
26.
Myomegalin is a novel A-kinase anchoring protein involved in the phosphorylation of cardiac myosin binding protein C.
Uys GM, etal., BMC Cell Biol. 2011 May 10;12:18. doi: 10.1186/1471-2121-12-18.
Eno1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 166,002,867 - 166,014,252 (+) NCBI GRCr8 mRatBN7.2 5 160,719,951 - 160,731,337 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 57,576,709 - 57,578,013 (+) Ensembl mRatBN7.2 Ensembl mRatBN7.2 Ensembl 5 160,719,951 - 160,731,336 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 163,436,430 - 163,447,815 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 165,257,901 - 165,269,442 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 165,214,977 - 165,226,362 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 167,288,223 - 167,299,610 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 167,288,223 - 167,299,609 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 170,915,874 - 170,927,267 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 167,394,131 - 167,405,516 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 167,404,823 - 167,415,701 (+) NCBI Celera 5 158,976,607 - 158,987,992 (+) NCBI Celera RH 3.4 Map 5 1122.0 RGD Cytogenetic Map 5 q36 NCBI
ENO1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 8,861,000 - 8,878,686 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 8,861,000 - 8,879,190 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 8,921,059 - 8,938,745 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 8,843,650 - 8,861,367 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 8,855,328 - 8,873,046 NCBI Celera 1 8,029,808 - 8,047,527 (-) NCBI Celera Cytogenetic Map 1 p36.23 NCBI HuRef 1 8,070,030 - 8,088,151 (-) NCBI HuRef CHM1_1 1 8,910,955 - 8,929,047 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 8,394,464 - 8,412,155 (-) NCBI T2T-CHM13v2.0
Eno1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 150,321,165 - 150,333,336 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 18 48,178,402 - 48,181,479 (+) Ensembl GRCm39 Ensembl GRCm39 Ensembl 4 150,321,178 - 150,333,336 (+) Ensembl GRCm39 Ensembl GRCm38 4 150,236,708 - 150,248,879 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 150,236,721 - 150,248,879 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 149,611,306 - 149,622,982 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 149,081,055 - 149,092,675 (+) NCBI MGSCv36 mm8 Celera 8 132,110,941 - 132,111,948 (+) NCBI Celera Cytogenetic Map 4 E2 NCBI cM Map 4 81.24 NCBI
Eno1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955486 4,274,238 - 4,289,809 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955486 4,275,371 - 4,287,152 (+) NCBI ChiLan1.0 ChiLan1.0
ENO1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 219,351,374 - 219,369,649 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 217,996,187 - 218,014,436 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 7,619,490 - 7,637,558 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 8,855,074 - 8,873,215 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 8,855,074 - 8,873,215 (-) Ensembl panpan1.1 panPan2
ENO1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 62,300,805 - 62,314,508 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 62,300,808 - 62,304,093 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 62,318,328 - 62,332,136 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 62,527,150 - 62,540,950 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 62,527,150 - 62,540,937 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 62,525,778 - 62,539,586 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 62,390,486 - 62,404,274 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 62,794,265 - 62,808,082 (-) NCBI UU_Cfam_GSD_1.0
Eno1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 32,630,119 - 32,643,410 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936623 3,115,081 - 3,128,183 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936623 3,115,357 - 3,130,289 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ENO1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 69,385,879 - 69,401,151 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 69,385,879 - 69,401,664 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 63,737,321 - 63,748,351 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ENO1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 122,884,846 - 122,902,669 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 122,884,727 - 122,903,372 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666054 26,906,844 - 26,924,920 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Eno1
.
Predicted Target Of
Count of predictions: 174 Count of miRNA genes: 122 Interacting mature miRNAs: 134 Transcripts: ENSRNOT00000024106 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
10053720 Scort26 Serum corticosterone level QTL 26 2.06 0.0147 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 124965598 166875058 Rat 631272 Lanf1 Left ventricular atrial natriuretic factor QTL 1 12 heart left ventricle natriuretic peptide A amount (VT:0010596) heart left ventricle natriuretic peptide A level (CMO:0002165) 5 151113452 166875058 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 2302369 Scl60 Serum cholesterol level QTL 60 3.13 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 143608201 161165651 Rat 631562 Apr2 Acute phase response QTL 2 3.7 blood murinoglobulin 1 amount (VT:0010597) plasma murinoglobulin 1 level (CMO:0001931) 5 135927956 166875058 Rat 634349 Bp139 Blood pressure QTL 139 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128924607 166875058 Rat 61444 Strs2 Sensitivity to stroke QTL 2 4.7 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 5 135929696 166875058 Rat 724525 Bp147 Blood pressure QTL 147 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 126424772 166875058 Rat 1549904 Neuinf1 Neuroinflammation QTL 1 3 0 nervous system integrity trait (VT:0010566) blood T lymphocyte count (CMO:0000110) 5 154828214 166875058 Rat 738018 Anxrr4 Anxiety related response QTL 4 5.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 5 130130159 166875058 Rat 2313096 Bmd78 Bone mineral density QTL 78 3.1 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 5 144377876 161317411 Rat 8552908 Pigfal4 Plasma insulin-like growth factor 1 level QTL 4 6.6 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 128506074 166875058 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 7794791 Mcs33 Mammary carcinoma susceptibility QTL 33 1.93 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 5 131345754 166875058 Rat 1354631 Swd2 Spike wave discharge measurement QTL 2 3.64 0.0002 brain electrophysiology trait (VT:0010557) brain total spike-and-wave discharge duration (CMO:0001740) 5 151113452 164465185 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1598861 Cm64 Cardiac mass QTL 64 2.9 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 127798274 166875058 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 631505 Bp103 Blood pressure QTL 103 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 132717196 165560427 Rat 1641920 Colcs1 Colorectal carcinoma susceptibility QTL 1 2.99 0.0055 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 5 121846814 166846814 Rat 1298090 Bp155 Blood pressure QTL 155 3.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 5 151006154 161165494 Rat 1598819 Bp292 Blood pressure QTL 292 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 127798274 166875058 Rat 8694169 Bw148 Body weight QTL 148 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 128506074 166875058 Rat 1331721 Bp210 Blood pressure QTL 210 3.413 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 5 143069996 166846814 Rat
RH128457
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 57,578,045 - 57,578,268 (+) MAPPER mRatBN7.2 mRatBN7.2 X 20,725,014 - 20,725,237 (-) MAPPER mRatBN7.2 mRatBN7.2 4 150,927,454 - 150,927,677 (-) MAPPER mRatBN7.2 mRatBN7.2 5 160,731,064 - 160,731,284 (+) MAPPER mRatBN7.2 Rnor_6.0 5 167,299,338 - 167,299,557 NCBI Rnor6.0 Rnor_5.0 5 170,926,992 - 170,927,211 UniSTS Rnor5.0 RGSC_v3.4 5 167,405,244 - 167,405,463 UniSTS RGSC3.4 Celera 5 158,987,720 - 158,987,939 UniSTS Cytogenetic Map 5 q36 UniSTS
RH94671
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 57,578,040 - 57,578,240 (+) MAPPER mRatBN7.2 mRatBN7.2 X 20,725,042 - 20,725,242 (-) MAPPER mRatBN7.2 mRatBN7.2 4 150,927,482 - 150,927,682 (-) MAPPER mRatBN7.2 mRatBN7.2 5 160,731,059 - 160,731,256 (+) MAPPER mRatBN7.2 Rnor_6.0 5 167,299,333 - 167,299,529 NCBI Rnor6.0 Rnor_5.0 5 170,926,987 - 170,927,183 UniSTS Rnor5.0 RGSC_v3.4 5 167,405,239 - 167,405,435 UniSTS RGSC3.4 Celera 5 158,987,715 - 158,987,911 UniSTS RH 3.4 Map 5 1122.0 UniSTS Cytogenetic Map 5 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000024106 ⟹ ENSRNOP00000024106
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 160,720,459 - 160,731,335 (+) Ensembl Rnor_6.0 Ensembl 5 167,288,717 - 167,299,609 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000031418 ⟹ ENSRNOP00000064663
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 57,576,709 - 57,578,013 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000081579 ⟹ ENSRNOP00000073191
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 160,719,951 - 160,731,336 (+) Ensembl Rnor_6.0 Ensembl 5 167,288,223 - 167,299,609 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000101015 ⟹ ENSRNOP00000083922
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 160,720,456 - 160,724,779 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000114907 ⟹ ENSRNOP00000097167
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 160,720,471 - 160,731,325 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000119075 ⟹ ENSRNOP00000096876
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 160,719,951 - 160,731,336 (+) Ensembl
RefSeq Acc Id:
NM_001109908 ⟹ NP_001103378
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 166,002,867 - 166,014,252 (+) NCBI mRatBN7.2 5 160,719,951 - 160,731,337 (+) NCBI Rnor_6.0 5 167,288,223 - 167,299,610 (+) NCBI Rnor_5.0 5 170,915,874 - 170,927,267 (+) NCBI RGSC_v3.4 5 167,394,131 - 167,405,516 (+) RGD Celera 5 158,976,607 - 158,987,992 (+) RGD
Sequence:
GGCCCCTAGGCCGCGCATCAACGTTTCCACACCGCCGGGGGCTCCAGCACCTCCCGGCGGGGGGGGAGGCCCACAGGAAGGCCCAGCCCTAAAGGTCATCAGCAAGGTCGTGGGCCGGACGTGAGGCG
hide sequence
RefSeq Acc Id:
NM_012554 ⟹ NP_036686
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 166,003,361 - 166,014,252 (+) NCBI mRatBN7.2 5 160,720,445 - 160,731,337 (+) NCBI Rnor_6.0 5 167,288,717 - 167,299,610 (+) NCBI Rnor_5.0 5 170,915,874 - 170,927,267 (+) NCBI RGSC_v3.4 5 167,394,131 - 167,405,516 (+) RGD Celera 5 158,977,101 - 158,987,992 (+) NCBI
Sequence:
GGGAGGCGCTTAGTGCTGCTCCGGTACCGAGTCGCGCTCACGTTTGTCCTTAAGACTCCCTTCG
hide sequence
RefSeq Acc Id:
XM_006239444 ⟹ XP_006239506
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 166,003,312 - 166,014,252 (+) NCBI mRatBN7.2 5 160,720,399 - 160,731,337 (+) NCBI Rnor_6.0 5 167,288,697 - 167,299,610 (+) NCBI Rnor_5.0 5 170,915,874 - 170,927,267 (+) NCBI
Sequence:
GCAGGCTAGGAAGTCGGAGTGGGAGGCGCTTAGTGCTGCTCCGGTACCGAGTCGCGCTCACGTT
hide sequence
RefSeq Acc Id:
XM_039109257 ⟹ XP_038965185
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 166,002,881 - 166,014,252 (+) NCBI mRatBN7.2 5 160,720,074 - 160,731,337 (+) NCBI
RefSeq Acc Id:
XM_039109258 ⟹ XP_038965186
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 166,002,888 - 166,014,252 (+) NCBI mRatBN7.2 5 160,721,810 - 160,731,337 (+) NCBI
RefSeq Acc Id:
NP_036686 ⟸ NM_012554
- UniProtKB:
Q6AYV3 (UniProtKB/Swiss-Prot), Q66HI3 (UniProtKB/Swiss-Prot), Q6P504 (UniProtKB/Swiss-Prot), P04764 (UniProtKB/Swiss-Prot), Q5BJ93 (UniProtKB/TrEMBL), Q4QR91 (UniProtKB/TrEMBL), A0A9K3Y892 (UniProtKB/TrEMBL), M0R5J4 (UniProtKB/TrEMBL)
- Sequence:
MSILKIHAREIFDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDNDKTRFMGKGVSKAVEHINKTIAPALVSKKLNVVEQEKIDQLMIEMDGTENKSKFGANAILGVSLAVCKAGAVEKGV
hide sequence
RefSeq Acc Id:
NP_001103378 ⟸ NM_001109908
- UniProtKB:
Q6AYV3 (UniProtKB/Swiss-Prot), Q66HI3 (UniProtKB/Swiss-Prot), Q6P504 (UniProtKB/Swiss-Prot), P04764 (UniProtKB/Swiss-Prot), Q5BJ93 (UniProtKB/TrEMBL), Q4QR91 (UniProtKB/TrEMBL), A0A9K3Y892 (UniProtKB/TrEMBL), M0R5J4 (UniProtKB/TrEMBL)
- Sequence:
MSILKIHAREIFDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDNDKTRFMGKGVSK
hide sequence
RefSeq Acc Id:
XP_006239506 ⟸ XM_006239444
- Peptide Label:
isoform X1
- Sequence:
MSILKIHAREIFDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDNDKTRFMGKGVSRPVKYVNEFLAPALCTQKLNVVEQEKIDQLMIEMDGTENKSKFGANAILGVSLAVCKAGAVEKGV
hide sequence
Ensembl Acc Id:
ENSRNOP00000024106 ⟸ ENSRNOT00000024106
Ensembl Acc Id:
ENSRNOP00000073191 ⟸ ENSRNOT00000081579
RefSeq Acc Id:
XP_038965185 ⟸ XM_039109257
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_038965186 ⟸ XM_039109258
- Peptide Label:
isoform X2
Ensembl Acc Id:
ENSRNOP00000096876 ⟸ ENSRNOT00000119075
Ensembl Acc Id:
ENSRNOP00000083922 ⟸ ENSRNOT00000101015
Ensembl Acc Id:
ENSRNOP00000097167 ⟸ ENSRNOT00000114907
Ensembl Acc Id:
ENSRNOP00000064663 ⟸ ENSRNOT00000031418
RGD ID: 13694280 Promoter ID: EPDNEW_R4805 Type: initiation region Name: Eno1_1 Description: enolase 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 167,288,728 - 167,288,788 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-04-13
Eno1
enolase 1
Eno1
enolase 1, (alpha)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-11-25
Eno1
enolase 1, (alpha)
Eno1
enolase 1, alpha non-neuron
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-03-31
Eno1
enolase 1, alpha non-neuron
Eno1
enolase 1, alpha
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-11-06
Eno1
enolase 1, alpha
Enolase 1, alpha
Name updated
625702 APPROVED
2002-06-10
Eno1
Enolase 1, alpha
Symbol and Name status set to approved
70586 APPROVED
