Symbol:
Ace
Name:
angiotensin I converting enzyme
RGD ID:
2493
Description:
Enables heterocyclic compound binding activity; metallopeptidase activity; and peptidyl-dipeptidase activity. Involved in several processes, including blood vessel diameter maintenance; negative regulation of transport; and response to corticosteroid. Located in several cellular components, including basal plasma membrane; brush border membrane; and sperm midpiece. Used to study several diseases, including artery disease (multiple); glomerulonephritis (multiple); kidney failure (multiple); lung disease (multiple); and proteinuria (multiple). Biomarker of several diseases, including artery disease (multiple); congenital diaphragmatic hernia; endomyocardial fibrosis; liver cirrhosis (multiple); and lung disease (multiple). Human ortholog(s) of this gene implicated in several diseases, including artery disease (multiple); autoimmune disease (multiple); gastrointestinal system cancer (multiple); heart valve disease (multiple); and lung disease (multiple). Orthologous to human ACE (angiotensin I converting enzyme); PARTICIPATES IN angiotensin (1-7) signaling pathway; renin-angiotensin cascade pathway; angiotensin II signaling pathway; INTERACTS WITH (+)-pilocarpine; (+)-schisandrin B; (R)-lipoic acid.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
angiotensin 1 converting enzyme; angiotensin 1 converting enzyme 1; angiotensin converting enzyme; angiotensin I converting enzyme (peptidyl-dipeptidase A) 1; angiotensin I converting enzyme 1; angiotensin I-converting enzyme (Dipeptidyl carboxypeptidase 1); angiotensin-converting enzyme; angiotensin-converting enzyme-like; CD143; Dcp1; Dipeptidyl carboxypeptidase 1; Dipeptidyl carboxypeptidase 1 (Angiotensin I-converting enzyme); dipeptidyl carboxypeptidase I; kininase II; LOC102556346; StsRR92
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Allele / Splice:
Aceem1Mcwi
Aceem2Mcwi
Genetic Models:
SS-Aceem1Mcwi
SS-Aceem2Mcwi
Is Marker For:
Strains:
SD-Tg(Ren2)27
SS.MNS-(D10M11Mit119-D10Mit11 )/Jr
LOU.BN-(D10Mgh1-D10Mgh14 )/Ins QTLs:
Bp9
Bw57
Bp342
Bw102
Candidate Gene For:
Bp1 Bp9 Bp72 Bp128 Bp342
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 91,410,129 - 91,430,246 (+) NCBI GRCr8 mRatBN7.2 10 90,910,316 - 90,930,437 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 90,910,316 - 90,931,131 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 95,964,627 - 95,984,783 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 95,427,801 - 95,447,951 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 90,839,016 - 90,859,102 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 94,170,766 - 94,213,831 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 94,170,766 - 94,187,822 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 93,922,062 - 93,965,127 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 95,361,338 - 95,381,455 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 10 89,588,544 - 89,608,666 (+) NCBI Celera Cytogenetic Map 10 q32.1 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ace Rat (+)-pilocarpine multiple interactions EXP 6480464 [Lithium Chloride co-treated with Pilocarpine] affects the reaction [Dexamethasone results in increased expression of ACE mRNA] and [Lithium Chloride co-treated with Pilocarpine] affects the reaction [Dexamethasone results in increased expression of ACE protein] CTD PMID:32494933 Ace Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of ACE mRNA] CTD PMID:31150632 Ace Rat (+)-trans-(S)-allethrin decreases activity ISO ACE (Homo sapiens) 6480464 bioallethrin results in decreased activity of ACE protein CTD PMID:32097678 Ace Rat (-)-epigallocatechin 3-gallate multiple interactions ISO ACE (Homo sapiens) 6480464 Ascorbic Acid inhibits the reaction [epigallocatechin gallate results in decreased activity of ACE protein] more ... CTD PMID:28544013 Ace Rat (R)-lipoic acid multiple interactions ISO Ace (Mus musculus) 6480464 Thioctic Acid affects the reaction [Dietary Fats affects the activity of ACE protein] and Thioctic Acid affects the reaction [Dietary Fats affects the expression of ACE mRNA] CTD PMID:27260466 Ace Rat (R)-lipoic acid multiple interactions EXP 6480464 Thioctic Acid inhibits the reaction [Sodium Chloride and Dietary results in increased expression of ACE] CTD PMID:26518973 Ace Rat (S)-colchicine multiple interactions EXP 6480464 carvedilol inhibits the reaction [Colchicine results in decreased activity of ACE protein] more ... CTD PMID:17135773 more ... Ace Rat (S)-colchicine decreases activity EXP 6480464 Colchicine results in decreased activity of ACE protein CTD PMID:17135773 more ... Ace Rat (S)-colchicine decreases expression EXP 6480464 Colchicine results in decreased expression of ACE protein CTD PMID:17652827 Ace Rat (S)-nicotine increases expression ISO ACE (Homo sapiens) 6480464 Nicotine results in increased expression of ACE mRNA CTD PMID:11166759 Ace Rat (S,S,S)-nicotianamine decreases activity ISO ACE (Homo sapiens) 6480464 nicotianamine results in decreased activity of ACE protein CTD PMID:26106051 Ace Rat 1,10-phenanthroline decreases expression ISO ACE (Homo sapiens) 6480464 1 and 10-phenanthroline results in decreased expression of ACE mRNA CTD PMID:19502547 Ace Rat 1,2-dimethylhydrazine decreases expression ISO Ace (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of ACE mRNA CTD PMID:22206623 Ace Rat 1,2-dimethylhydrazine multiple interactions ISO Ace (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in decreased expression of ACE mRNA] CTD PMID:22206623 Ace Rat 14,15-EET decreases activity EXP 6480464 14 more ... CTD PMID:27428043 Ace Rat 17alpha-ethynylestradiol multiple interactions ISO Ace (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of ACE mRNA CTD PMID:17942748 Ace Rat 17alpha-ethynylestradiol increases expression ISO Ace (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of ACE mRNA CTD PMID:17942748 Ace Rat 17beta-estradiol multiple interactions EXP 6480464 [Estradiol co-treated with Testosterone] results in increased expression of ACE mRNA CTD PMID:11375906 Ace Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Ace (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of ACE mRNA CTD PMID:17942748 Ace Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of ACE mRNA CTD PMID:33387578 Ace Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 401793709 2 more ... RGD Ace Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Ace (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of ACE mRNA CTD PMID:33956508 Ace Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of ACE mRNA CTD PMID:19490992 Ace Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Ace (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Ace Rat 2,5-dihydroxybenzoic acid multiple interactions ISO Ace (Mus musculus) 6480464 2 and 5-dihydroxybenzoic acid inhibits the reaction [[Streptozocin co-treated with Niacinamide] results in increased expression of ACE mRNA] CTD PMID:37120126 Ace Rat 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine affects activity EXP 6480464 Puromycin Aminonucleoside affects the activity of ACE protein CTD PMID:1318808 Ace Rat 3,3',5-triiodo-L-thyronine multiple interactions EXP 6480464 Triiodothyronine results in increased expression of and results in increased activity of ACE protein CTD PMID:1659346 Ace Rat 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione multiple interactions ISO ACE (Homo sapiens) 6480464 bisindolylmaleimide I inhibits the reaction [VEGFA protein results in increased expression of ACE protein] CTD PMID:11158990 Ace Rat 3-chloropropane-1,2-diol decreases expression EXP 6480464 alpha-Chlorohydrin results in decreased expression of ACE mRNA CTD PMID:28522335 Ace Rat 4,4'-sulfonyldiphenol increases methylation ISO Ace (Mus musculus) 6480464 bisphenol S results in increased methylation of ACE exon CTD PMID:33297965 Ace Rat 4-(5,6,7,8-tetrahydroimidazo[1,5-a]pyridin-5-yl)benzonitrile decreases expression EXP 6480464 Fadrozole results in decreased expression of ACE protein CTD PMID:18586661 Ace Rat 4-hydroxyphenyl retinamide decreases expression ISO Ace (Mus musculus) 6480464 Fenretinide results in decreased expression of ACE mRNA CTD PMID:28973697 Ace Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of ACE mRNA CTD PMID:24780913 and PMID:25825206 Ace Rat 7,9-dihydro-1H-purine-2,6,8(3H)-trione increases expression ISO Ace (Mus musculus) 6480464 Uric Acid results in increased expression of ACE mRNA CTD PMID:30710622 Ace Rat 7,9-dihydro-1H-purine-2,6,8(3H)-trione multiple interactions ISO Ace (Mus musculus) 6480464 APLN protein modified form inhibits the reaction [Uric Acid results in increased expression of ACE mRNA] CTD PMID:30710622 Ace Rat Ac-Ser-Asp-Lys-Pro-OH increases expression ISO Ace (Mus musculus) 6480464 goralatide results in increased expression of ACE mRNA CTD PMID:20096676 Ace Rat Ac-Ser-Asp-Lys-Pro-OH decreases expression ISO Ace (Mus musculus) 6480464 goralatide results in decreased expression of ACE mRNA CTD PMID:20096676 Ace Rat Ac-Ser-Asp-Lys-Pro-OH multiple interactions ISO Ace (Mus musculus) 6480464 [BDKRB1 protein affects the activity of ACE protein] which affects the hydrolysis of goralatide more ... CTD PMID:20096676 and PMID:33007385 Ace Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of ACE mRNA CTD PMID:31881176 Ace Rat acetylsalicylic acid affects response to substance ISO ACE (Homo sapiens) 6480464 ACE polymorphism affects the susceptibility to Aspirin CTD PMID:18727619 Ace Rat acrylamide decreases expression ISO Ace (Mus musculus) 6480464 Acrylamide results in decreased expression of ACE mRNA CTD PMID:35032568 Ace Rat actinomycin D multiple interactions EXP 6480464 Dactinomycin inhibits the reaction [Aldosterone results in increased activity of ACE protein] and Dactinomycin inhibits the reaction [Aldosterone results in increased expression of ACE mRNA] CTD PMID:15932931 Ace Rat aldehydo-D-glucose increases expression ISO ACE (Homo sapiens) 6480464 Glucose results in increased expression of ACE protein CTD PMID:16452552 Ace Rat aldehydo-D-glucose increases expression ISO Ace (Mus musculus) 6480464 Glucose results in increased expression of ACE protein CTD PMID:29266779 Ace Rat aldehydo-D-glucose multiple interactions EXP 6480464 NFE2L2 protein affects the reaction [Glucose results in increased expression of ACE mRNA] more ... CTD PMID:29211853 Ace Rat aldehydo-D-glucose multiple interactions ISO Ace (Mus musculus) 6480464 CEBPB protein inhibits the reaction [Glucose results in increased expression of ACE protein] CTD PMID:29266779 Ace Rat aldehydo-D-glucose increases expression EXP 6480464 Glucose results in increased expression of ACE mRNA CTD PMID:29211853 Ace Rat aldehydo-D-glucose decreases expression ISO ACE (Homo sapiens) 6480464 Glucose results in decreased expression of ACE mRNA CTD PMID:31655124 Ace Rat aldehydo-D-glucose multiple interactions ISO ACE (Homo sapiens) 6480464 Enalaprilat inhibits the reaction [Glucose results in increased expression of ACE protein] CTD PMID:16452552 Ace Rat aldosterone increases activity EXP 6480464 Aldosterone results in increased activity of ACE protein CTD PMID:15932931 Ace Rat aldosterone increases expression EXP 6480464 Aldosterone results in increased expression of ACE mRNA CTD PMID:15932931 Ace Rat aldosterone multiple interactions EXP 6480464 AG 1879 inhibits the reaction [Aldosterone results in increased expression of ACE mRNA] more ... CTD PMID:15932931 Ace Rat aluminium atom decreases activity ISO Ace (Mus musculus) 6480464 Aluminum results in decreased activity of ACE protein CTD PMID:12008977 Ace Rat aluminium(0) decreases activity ISO Ace (Mus musculus) 6480464 Aluminum results in decreased activity of ACE protein CTD PMID:12008977 Ace Rat aminoguanidine multiple interactions ISO Ace (Mus musculus) 6480464 pimagedine inhibits the reaction [Paraquat results in decreased activity of ACE protein] CTD PMID:12161173 Ace Rat amitrole multiple interactions EXP 6480464 Amitrole promotes the reaction [Sodium Chloride and Dietary results in increased expression of ACE protein] CTD PMID:25891026 Ace Rat amlodipine decreases expression EXP 6480464 Amlodipine results in decreased expression of ACE mRNA CTD PMID:16392774 Ace Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of ACE mRNA CTD PMID:16483693 Ace Rat antirheumatic drug increases expression ISO ACE (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of ACE mRNA CTD PMID:24449571 Ace Rat arsenite(3-) decreases expression ISO Ace (Mus musculus) 6480464 arsenite results in decreased expression of ACE mRNA CTD PMID:33053406 Ace Rat atorvastatin calcium decreases expression EXP 6480464 Atorvastatin results in decreased expression of ACE mRNA CTD PMID:23390189 Ace Rat atrazine multiple interactions ISO ACE (Homo sapiens) 6480464 [Atrazine co-treated with Arsenates] results in increased expression of ACE mRNA CTD PMID:18585445 Ace Rat Azoxymethane multiple interactions ISO Ace (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of ACE mRNA CTD PMID:29950665 Ace Rat benazepril decreases activity ISO ACE (Homo sapiens) 6480464 benazepril results in decreased activity of ACE protein CTD PMID:8359184 Ace Rat benazepril affects response to substance ISO ACE (Homo sapiens) 6480464 ACE gene polymorphism affects the susceptibility to benazepril CTD PMID:11007831 more ... Ace Rat benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of ACE mRNA CTD PMID:21839799 Ace Rat benzo[a]pyrene decreases expression ISO ACE (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of ACE mRNA CTD PMID:32234424 Ace Rat benzo[a]pyrene increases methylation ISO ACE (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of ACE exon and Benzo(a)pyrene results in increased methylation of ACE promoter CTD PMID:27901495 Ace Rat benzo[a]pyrene increases expression ISO Ace (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of ACE mRNA CTD PMID:22610609 and PMID:27195522 Ace Rat beta-naphthoflavone multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in decreased expression of ACE mRNA CTD PMID:18164116 Ace Rat bezafibrate multiple interactions EXP 6480464 Bezafibrate inhibits the reaction [Streptozocin results in increased expression of ACE mRNA] and Bezafibrate inhibits the reaction [Streptozocin results in increased expression of ACE protein] CTD PMID:16979161 Ace Rat bis(2-chloroethyl) sulfide affects response to substance ISO ACE (Homo sapiens) 6480464 ACE gene affects the susceptibility to Mustard Gas CTD PMID:18702808 Ace Rat bis(2-chloroethyl) sulfide affects expression EXP 6480464 Mustard Gas affects the expression of ACE mRNA CTD PMID:15651846 Ace Rat bis(2-ethylhexyl) phthalate decreases expression ISO Ace (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of ACE mRNA CTD PMID:33162236 Ace Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ACE mRNA CTD PMID:25181051 Ace Rat bisphenol A increases expression ISO Ace (Mus musculus) 6480464 bisphenol A results in increased expression of ACE mRNA CTD PMID:37392660 Ace Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ACE mRNA and bisphenol A results in increased expression of ACE protein CTD PMID:38027817 Ace Rat bisphenol A decreases activity EXP 6480464 bisphenol A results in decreased activity of ACE protein CTD PMID:32153214 Ace Rat bisphenol A increases activity EXP 6480464 bisphenol A results in increased activity of ACE protein CTD PMID:32172062 and PMID:32810514 Ace Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Fructose] results in increased expression of ACE mRNA more ... CTD PMID:27622962 more ... Ace Rat bisphenol A increases expression ISO ACE (Homo sapiens) 6480464 bisphenol A results in increased expression of ACE mRNA CTD PMID:27622962 Ace Rat bisphenol A decreases methylation ISO Ace (Mus musculus) 6480464 bisphenol A results in decreased methylation of ACE promoter CTD PMID:27312807 Ace Rat bleomycin A2 decreases expression EXP 6480464 Bleomycin results in decreased expression of ACE protein CTD PMID:20581171 Ace Rat bleomycin A2 multiple interactions EXP 6480464 angiotensin I (1-7) inhibits the reaction [Bleomycin results in decreased expression of ACE protein] CTD PMID:20581171 Ace Rat boric acid multiple interactions ISO ACE (Homo sapiens) 6480464 boric acid inhibits the reaction [epigallocatechin gallate results in decreased activity of ACE protein] CTD PMID:28544013 Ace Rat bortezomib multiple interactions ISO ACE (Homo sapiens) 6480464 [Butyrates co-treated with Bortezomib] results in increased activity of ACE protein mutant form CTD PMID:20454656 Ace Rat Butralin multiple interactions EXP 6480464 Gum Arabic inhibits the reaction [butralin results in increased expression of ACE mRNA] CTD PMID:34240313 Ace Rat Butralin increases expression EXP 6480464 butralin results in increased expression of ACE mRNA CTD PMID:34240313 Ace Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of ACE protein CTD PMID:32738273 Ace Rat caffeine decreases methylation EXP 6480464 Caffeine results in decreased methylation of ACE promoter CTD PMID:30423288 Ace Rat caffeine increases expression EXP 6480464 Caffeine results in increased expression of ACE mRNA and Caffeine results in increased expression of ACE protein CTD PMID:30423288 Ace Rat candesartan affects expression EXP 6480464 candesartan affects the expression of ACE mRNA CTD PMID:18796534 Ace Rat cannabidiol increases expression ISO ACE (Homo sapiens) 6480464 Cannabidiol results in increased expression of ACE1 mRNA CTD PMID:28025562 Ace Rat captan decreases expression ISO Ace (Mus musculus) 6480464 Captan results in decreased expression of ACE mRNA CTD PMID:31558096 Ace Rat captopril multiple interactions ISO Ace (Mus musculus) 6480464 Captopril inhibits the reaction [AGT protein results in increased expression of ACE mRNA] more ... CTD PMID:33007385 Ace Rat captopril decreases activity ISO ACE (Homo sapiens) 6480464 Captopril results in decreased activity of ACE protein CTD PMID:26851370 Ace Rat captopril multiple interactions EXP 6480464 Captopril inhibits the reaction [Pregabalin results in increased expression of ACE protein] CTD PMID:31629013 Ace Rat carbon nanotube affects expression ISO Ace (Mus musculus) 6480464 Nanotubes and Carbon affects the expression of ACE protein CTD PMID:21135415 Ace Rat carvedilol multiple interactions EXP 6480464 carvedilol inhibits the reaction [Colchicine results in decreased activity of ACE protein] CTD PMID:18992766 Ace Rat carvedilol multiple interactions ISO ACE (Homo sapiens) 6480464 carvedilol inhibits the reaction [Tetradecanoylphorbol Acetate results in increased expression of ACE mRNA] CTD PMID:15071347 Ace Rat chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of ACE protein CTD PMID:38042398 Ace Rat chromium atom decreases activity EXP 6480464 Chromium results in decreased activity of ACE protein CTD PMID:18374418 Ace Rat chromium(6+) affects expression ISO Ace (Mus musculus) 6480464 chromium hexavalent ion affects the expression of ACE mRNA CTD PMID:28472532 Ace Rat cilazapril monohydrate affects response to substance ISO ACE (Homo sapiens) 6480464 ACE gene polymorphism affects the susceptibility to Cilazapril CTD PMID:15498266 Ace Rat cisplatin increases expression EXP 6480464 Cisplatin results in increased expression of ACE protein CTD PMID:38437957 Ace Rat cisplatin multiple interactions EXP 6480464 Ondansetron inhibits the reaction [Cisplatin results in increased expression of ACE protein] CTD PMID:38437957 Ace Rat cobalt dichloride increases expression ISO Ace (Mus musculus) 6480464 cobaltous chloride results in increased expression of ACE mRNA and cobaltous chloride results in increased expression of ACE protein CTD PMID:25511041 Ace Rat cocaine multiple interactions ISO ACE (Homo sapiens) 6480464 ACE inhibits the reaction [Cocaine affects the abundance of Dinoprostone] and ACE inhibits the reaction [Cocaine affects the abundance of Epoprostenol] CTD PMID:14738173 Ace Rat corticosterone increases expression EXP 6480464 Corticosterone results in increased expression of ACE mRNA CTD PMID:15755911 and PMID:30423288 Ace Rat corticosterone decreases methylation EXP 6480464 Corticosterone results in decreased methylation of ACE promoter CTD PMID:30423288 Ace Rat corticosterone multiple interactions EXP 6480464 Mifepristone inhibits the reaction [Corticosterone results in increased expression of ACE mRNA] CTD PMID:30423288 Ace Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of ACE mRNA CTD PMID:26577399 Ace Rat curcumin multiple interactions EXP 6480464 Curcumin inhibits the reaction [Paraquat affects the expression of ACE protein] CTD PMID:10666014 Ace Rat cyclophosphamide decreases expression EXP 6480464 Cyclophosphamide results in decreased expression of ACE mRNA CTD PMID:27281708 Ace Rat D-glucose multiple interactions ISO ACE (Homo sapiens) 6480464 Enalaprilat inhibits the reaction [Glucose results in increased expression of ACE protein] CTD PMID:16452552 Ace Rat D-glucose multiple interactions ISO Ace (Mus musculus) 6480464 CEBPB protein inhibits the reaction [Glucose results in increased expression of ACE protein] CTD PMID:29266779 Ace Rat D-glucose increases expression ISO Ace (Mus musculus) 6480464 Glucose results in increased expression of ACE protein CTD PMID:29266779 Ace Rat D-glucose increases expression EXP 6480464 Glucose results in increased expression of ACE mRNA CTD PMID:29211853 Ace Rat D-glucose multiple interactions EXP 6480464 NFE2L2 protein affects the reaction [Glucose results in increased expression of ACE mRNA] more ... CTD PMID:29211853 Ace Rat D-glucose decreases expression ISO ACE (Homo sapiens) 6480464 Glucose results in decreased expression of ACE mRNA CTD PMID:31655124 Ace Rat D-glucose increases expression ISO ACE (Homo sapiens) 6480464 Glucose results in increased expression of ACE protein CTD PMID:16452552 Ace Rat DDT decreases expression EXP 6480464 DDT results in decreased expression of ACE mRNA CTD PMID:30207508 Ace Rat dexamethasone increases expression EXP 6480464 Dexamethasone results in increased expression of ACE mRNA and Dexamethasone results in increased expression of ACE protein CTD PMID:15932931 and PMID:32494933 Ace Rat dexamethasone multiple interactions ISO Ace (Mus musculus) 6480464 diisononyl phthalate promotes the reaction [Dexamethasone results in increased expression of ACE protein] more ... CTD PMID:30940551 Ace Rat dexamethasone decreases activity EXP 6480464 Dexamethasone results in decreased activity of ACE protein CTD PMID:1659346 and PMID:9498404 Ace Rat dexamethasone increases expression ISO Ace (Mus musculus) 6480464 Dexamethasone results in increased expression of ACE mRNA and Dexamethasone results in increased expression of ACE protein CTD PMID:22733784 and PMID:30940551 Ace Rat dexamethasone multiple interactions EXP 6480464 [Lithium Chloride co-treated with Pilocarpine] affects the reaction [Dexamethasone results in increased expression of ACE mRNA] more ... CTD PMID:15932931 and PMID:32494933 Ace Rat dextran sulfate multiple interactions ISO Ace (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of ACE mRNA CTD PMID:29950665 Ace Rat dextran sulfate increases abundance ISO Ace (Mus musculus) 11555935 dextran sodium sulfate increases abundance of Ace protein in small and large intestine extracellular space RGD Ace Rat diisononyl phthalate increases expression ISO Ace (Mus musculus) 6480464 diisononyl phthalate results in increased expression of ACE protein CTD PMID:30940551 Ace Rat diisononyl phthalate multiple interactions ISO Ace (Mus musculus) 6480464 diisononyl phthalate promotes the reaction [Dexamethasone results in increased expression of ACE protein] and Enalapril inhibits the reaction [diisononyl phthalate promotes the reaction [Dexamethasone results in increased expression of ACE protein]] CTD PMID:30940551 Ace Rat dioxygen increases expression ISO Ace (Mus musculus) 6480464 Oxygen deficiency results in increased expression of ACE mRNA and Oxygen deficiency results in increased expression of ACE protein CTD PMID:25511041 Ace Rat dioxygen multiple interactions ISO Ace (Mus musculus) 6480464 Losartan inhibits the reaction [Oxygen deficiency results in increased expression of ACE protein] CTD PMID:25511041 Ace Rat doxorubicin affects activity EXP 6480464 Doxorubicin affects the activity of ACE protein CTD PMID:8303709 Ace Rat doxorubicin increases expression EXP 6480464 Doxorubicin results in increased expression of ACE mRNA CTD PMID:36636964 Ace Rat doxorubicin multiple interactions EXP 6480464 Ramipril inhibits the reaction [Doxorubicin results in increased expression of ACE mRNA] CTD PMID:36636964 Ace Rat doxorubicin increases activity EXP 6480464 Doxorubicin results in increased activity of ACE protein CTD PMID:25673179 Ace Rat EC 3.4.15.1 (peptidyl-dipeptidase A) inhibitor decreases activity EXP 6480464 Angiotensin-Converting Enzyme Inhibitors results in decreased activity of ACE protein CTD PMID:15667801 Ace Rat enalapril decreases activity ISO ACE (Homo sapiens) 6480464 Enalapril results in decreased activity of ACE protein CTD PMID:20679179 and PMID:28973481 Ace Rat enalapril multiple interactions ISO Ace (Mus musculus) 6480464 Enalapril inhibits the reaction [Dexamethasone results in increased expression of ACE protein] more ... CTD PMID:30940551 and PMID:36706861 Ace Rat enalapril decreases activity EXP 6480464 Enalapril results in decreased activity of ACE protein CTD PMID:15728788 and PMID:15816410 Ace Rat enalapril multiple interactions ISO ACE (Homo sapiens) 6480464 ACE gene polymorphism affects the susceptibility to [Enalapril co-treated with Sodium Chloride] and ACE gene polymorphism inhibits the reaction [[Enalapril co-treated with Sodium Chloride] results in increased susceptibility to AGT protein modified form] CTD PMID:20829712 Ace Rat enalapril increases expression EXP 6480464 Enalapril results in increased expression of ACE mRNA CTD PMID:15728788 Ace Rat enalapril multiple interactions EXP 6480464 Enalapril inhibits the reaction [Streptozocin results in increased expression of ACE mRNA] more ... CTD PMID:15728788 and PMID:23733546 Ace Rat enalaprilat dihydrate multiple interactions ISO ACE (Homo sapiens) 6480464 Enalaprilat inhibits the reaction [Glucose results in increased expression of ACE protein] CTD PMID:16452552 Ace Rat ethanol increases expression EXP 6480464 Ethanol results in increased expression of ACE mRNA and Ethanol results in increased expression of ACE protein CTD PMID:29548890 and PMID:31887396 Ace Rat ethanol multiple interactions EXP 6480464 4-(4-((5-(4 more ... CTD PMID:31887396 Ace Rat ethylbenzene multiple interactions ISO ACE (Homo sapiens) 6480464 [Toluene co-treated with ethylbenzene co-treated with Xylenes] results in decreased methylation of ACE gene and [Toluene co-treated with ethylbenzene co-treated with Xylenes] results in increased expression of ACE mRNA CTD PMID:26018793 Ace Rat ethylenediaminetetraacetic acid decreases activity ISO ACE (Homo sapiens) 6480464 Edetic Acid results in decreased activity of ACE protein CTD PMID:28544013 Ace Rat ethylenediaminetetraacetic acid multiple interactions ISO ACE (Homo sapiens) 6480464 Zinc Sulfate inhibits the reaction [Edetic Acid results in decreased activity of ACE protein] CTD PMID:28544013 Ace Rat fenvalerate affects methylation ISO Ace (Mus musculus) 6480464 fenvalerate affects the methylation of ACE gene CTD PMID:23548413 Ace Rat flavonoids decreases expression EXP 6480464 Flavonoids results in decreased expression of ACE mRNA CTD PMID:18035473 Ace Rat folic acid multiple interactions EXP 6480464 Enalapril promotes the reaction [Folic Acid results in increased expression of ACE mRNA] CTD PMID:15728788 Ace Rat folic acid multiple interactions ISO Ace (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in decreased expression of ACE mRNA] CTD PMID:22206623 Ace Rat folic acid increases expression EXP 6480464 Folic Acid results in increased expression of ACE mRNA CTD PMID:15728788 Ace Rat folpet decreases expression ISO Ace (Mus musculus) 6480464 folpet results in decreased expression of ACE mRNA CTD PMID:31558096 Ace Rat formaldehyde multiple interactions ISO Ace (Mus musculus) 6480464 Enalapril inhibits the reaction [Formaldehyde results in increased expression of ACE protein] CTD PMID:36706861 Ace Rat formaldehyde increases expression ISO Ace (Mus musculus) 6480464 Formaldehyde results in increased expression of ACE protein CTD PMID:36706861 Ace Rat fructose increases expression EXP 6480464 Fructose results in increased expression of ACE mRNA CTD PMID:17587757 and PMID:30710622 Ace Rat fructose multiple interactions EXP 6480464 [bisphenol A co-treated with Fructose] results in increased expression of ACE mRNA and APLN protein modified form inhibits the reaction [Fructose results in increased expression of ACE mRNA] CTD PMID:27622962 and PMID:30710622 Ace Rat furan increases expression EXP 6480464 furan results in increased expression of ACE mRNA CTD PMID:27387713 Ace Rat genistein multiple interactions EXP 6480464 [Genistein co-treated with Methoxychlor] results in increased expression of ACE mRNA and Genistein inhibits the reaction [Aldosterone results in increased expression of ACE mRNA] CTD PMID:15932931 and PMID:21782745 Ace Rat genistein increases expression EXP 6480464 Genistein results in increased expression of ACE mRNA CTD PMID:21782745 Ace Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of ACE mRNA CTD PMID:33387578 Ace Rat glucose multiple interactions ISO ACE (Homo sapiens) 6480464 Enalaprilat inhibits the reaction [Glucose results in increased expression of ACE protein] CTD PMID:16452552 Ace Rat glucose multiple interactions ISO Ace (Mus musculus) 6480464 CEBPB protein inhibits the reaction [Glucose results in increased expression of ACE protein] CTD PMID:29266779 Ace Rat glucose increases expression ISO Ace (Mus musculus) 6480464 Glucose results in increased expression of ACE protein CTD PMID:29266779 Ace Rat glucose multiple interactions EXP 6480464 NFE2L2 protein affects the reaction [Glucose results in increased expression of ACE mRNA] more ... CTD PMID:29211853 Ace Rat glucose increases expression EXP 6480464 Glucose results in increased expression of ACE mRNA CTD PMID:29211853 Ace Rat glucose decreases expression ISO ACE (Homo sapiens) 6480464 Glucose results in decreased expression of ACE mRNA CTD PMID:31655124 Ace Rat glucose increases expression ISO ACE (Homo sapiens) 6480464 Glucose results in increased expression of ACE protein CTD PMID:16452552 Ace Rat glycidol increases expression EXP 6480464 glycidol results in increased expression of ACE mRNA CTD PMID:24395379 Ace Rat goralatide decreases expression ISO Ace (Mus musculus) 6480464 goralatide results in decreased expression of ACE mRNA CTD PMID:20096676 Ace Rat goralatide multiple interactions ISO Ace (Mus musculus) 6480464 [BDKRB1 protein affects the activity of ACE protein] which affects the hydrolysis of goralatide more ... CTD PMID:20096676 and PMID:33007385 Ace Rat goralatide increases expression ISO Ace (Mus musculus) 6480464 goralatide results in increased expression of ACE mRNA CTD PMID:20096676 Ace Rat GW 4064 increases expression ISO Ace (Mus musculus) 6480464 GW 4064 results in increased expression of ACE mRNA CTD PMID:26655953 Ace Rat herbimycin multiple interactions ISO ACE (Homo sapiens) 6480464 herbimycin inhibits the reaction [VEGFA protein results in increased expression of ACE protein] CTD PMID:11158990 Ace Rat hydralazine multiple interactions EXP 6480464 Hydralazine inhibits the reaction [Nitric Oxide deficiency results in increased expression of ACE mRNA] CTD PMID:16326922 Ace Rat hydrazines decreases expression ISO Ace (Mus musculus) 6480464 Hydrazines results in decreased expression of ACE mRNA CTD PMID:21647536 Ace Rat hydrochlorothiazide increases expression EXP 6480464 Hydrochlorothiazide results in increased expression of ACE mRNA CTD PMID:18796534 Ace Rat hydrochlorothiazide multiple interactions EXP 6480464 Hydrochlorothiazide inhibits the reaction [Nitric Oxide deficiency results in increased expression of ACE mRNA] CTD PMID:16326922 Ace Rat hydrogen peroxide multiple interactions ISO ACE (Homo sapiens) 6480464 [GPX1 gene polymorphism co-treated with ACE gene polymorphism] affects the susceptibility to Hydrogen Peroxide CTD PMID:20444272 Ace Rat hydrogen peroxide increases expression ISO Ace (Mus musculus) 6480464 Hydrogen Peroxide results in increased expression of ACE mRNA CTD PMID:30710622 Ace Rat indometacin multiple interactions ISO ACE (Homo sapiens) 6480464 Indomethacin promotes the reaction [VEGFA protein results in increased expression of ACE protein] CTD PMID:11158990 Ace Rat indoxyl sulfate increases expression EXP 6480464 Indican results in increased expression of ACE mRNA CTD PMID:25056788 Ace Rat inulin multiple interactions ISO Ace (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of ACE mRNA CTD PMID:36331819 Ace Rat isoprenaline multiple interactions EXP 6480464 oleuropein inhibits the reaction [Isoproterenol results in increased activity of ACE protein] CTD PMID:26056852 Ace Rat isoprenaline increases activity EXP 6480464 Isoproterenol results in increased activity of ACE protein CTD PMID:26056852 Ace Rat ketamine increases expression EXP 6480464 Ketamine results in increased expression of ACE mRNA CTD PMID:20080153 Ace Rat L-ascorbic acid multiple interactions ISO ACE (Homo sapiens) 6480464 Ascorbic Acid inhibits the reaction [epigallocatechin gallate results in decreased activity of ACE protein] CTD PMID:28544013 Ace Rat Lasiocarpine decreases expression ISO ACE (Homo sapiens) 6480464 lasiocarpine metabolite results in decreased expression of ACE mRNA CTD PMID:30465738 Ace Rat lead diacetate affects expression EXP 6480464 lead acetate affects the expression of ACE mRNA CTD PMID:21864555 and PMID:22641619 Ace Rat lead(0) increases activity EXP 6480464 Lead results in increased activity of ACE protein CTD PMID:21364929 Ace Rat lipoic acid multiple interactions ISO Ace (Mus musculus) 6480464 Thioctic Acid affects the reaction [Dietary Fats affects the activity of ACE protein] and Thioctic Acid affects the reaction [Dietary Fats affects the expression of ACE mRNA] CTD PMID:27260466 Ace Rat lipoic acid multiple interactions EXP 6480464 Thioctic Acid inhibits the reaction [Sodium Chloride and Dietary results in increased expression of ACE] CTD PMID:26518973 Ace Rat lisinopril dihydrate decreases activity ISO ACE (Homo sapiens) 6480464 Lisinopril analog results in decreased activity of ACE protein CTD PMID:22200082 Ace Rat lithium chloride multiple interactions EXP 6480464 [Lithium Chloride co-treated with Pilocarpine] affects the reaction [Dexamethasone results in increased expression of ACE mRNA] and [Lithium Chloride co-treated with Pilocarpine] affects the reaction [Dexamethasone results in increased expression of ACE protein] CTD PMID:32494933 Ace Rat losartan multiple interactions ISO Ace (Mus musculus) 6480464 Losartan inhibits the reaction [AGT protein results in increased expression of ACE mRNA] more ... CTD PMID:25511041 more ... Ace Rat losartan multiple interactions EXP 6480464 Losartan inhibits the reaction [Testosterone results in increased activity of ACE protein] CTD PMID:25673179 Ace Rat losartan decreases expression ISO Ace (Mus musculus) 6480464 Losartan results in decreased expression of ACE protein CTD PMID:25655897 Ace Rat losartan decreases expression EXP 6480464 Losartan results in decreased expression of ACE protein CTD PMID:28091615 Ace Rat losartan multiple interactions ISO ACE (Homo sapiens) 6480464 Losartan inhibits the reaction [AGT protein results in increased expression of ACE protein] CTD PMID:28578904 Ace Rat lycopene multiple interactions EXP 6480464 Lycopene inhibits the reaction [bisphenol A results in decreased activity of ACE protein] CTD PMID:32153214 Ace Rat Magnolol multiple interactions EXP 6480464 magnolol inhibits the reaction [Monocrotaline results in increased expression of ACE protein] CTD PMID:30466619 Ace Rat maneb multiple interactions ISO Ace (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of ACE mRNA CTD PMID:36117858 Ace Rat manganese(II) chloride increases expression EXP 6480464 manganese chloride results in increased expression of ACE mRNA CTD PMID:28801915 Ace Rat manidipine decreases expression EXP 6480464 manidipine results in decreased expression of ACE mRNA CTD PMID:16392774 Ace Rat metformin multiple interactions ISO Ace (Mus musculus) 6480464 Metformin inhibits the reaction [[Streptozocin co-treated with Niacinamide] results in increased expression of ACE mRNA] CTD PMID:37120126 Ace Rat methoxychlor increases expression EXP 6480464 Methoxychlor results in increased expression of ACE mRNA CTD PMID:21782745 Ace Rat methoxychlor multiple interactions EXP 6480464 [Genistein co-treated with Methoxychlor] results in increased expression of ACE mRNA CTD PMID:21782745 Ace Rat metoprolol affects response to substance ISO ACE (Homo sapiens) 6480464 ACE gene polymorphism affects the susceptibility to Metoprolol CTD PMID:20819590 Ace Rat microcystin RR increases expression ISO Ace (Mus musculus) 6480464 microcystin RR results in increased expression of ACE mRNA and microcystin RR results in increased expression of ACE protein CTD PMID:28330766 Ace Rat mifepristone multiple interactions EXP 6480464 Mifepristone inhibits the reaction [Corticosterone results in increased expression of ACE mRNA] and Mifepristone inhibits the reaction [Dexamethasone results in increased expression of ACE mRNA] CTD PMID:15932931 more ... Ace Rat monocrotaline increases expression EXP 6480464 Monocrotaline results in increased expression of ACE mRNA and Monocrotaline results in increased expression of ACE protein CTD PMID:20581171 and PMID:30466619 Ace Rat monocrotaline multiple interactions EXP 6480464 angiotensin I (1-7) inhibits the reaction [Monocrotaline results in increased expression of ACE mRNA] and magnolol inhibits the reaction [Monocrotaline results in increased expression of ACE protein] CTD PMID:20581171 and PMID:30466619 Ace Rat N(4)-hydroxycytidine decreases expression ISO Ace (Mus musculus) 6480464 N(4)-hydroxycytidine results in decreased expression of ACE mRNA CTD PMID:37748715 Ace Rat N(gamma)-nitro-L-arginine methyl ester multiple interactions EXP 6480464 [NG-Nitroarginine Methyl Ester co-treated with bisphenol A] results in increased activity of ACE protein more ... CTD PMID:32172062 more ... Ace Rat N(gamma)-nitro-L-arginine methyl ester increases activity EXP 6480464 NG-Nitroarginine Methyl Ester results in increased activity of ACE protein CTD PMID:32172062 more ... Ace Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions ISO ACE (Homo sapiens) 6480464 [Butyrates co-treated with benzyloxycarbonylleucyl-leucyl-leucine aldehyde] affects the localization of ACE protein mutant form and [Butyrates co-treated with benzyloxycarbonylleucyl-leucyl-leucine aldehyde] results in increased activity of ACE protein mutant form CTD PMID:20454656 Ace Rat N-methylnicotinate multiple interactions EXP 6480464 oltipraz inhibits the reaction [trigonelline inhibits the reaction [Glucose results in increased expression of ACE mRNA]] and trigonelline inhibits the reaction [Glucose results in increased expression of ACE mRNA] CTD PMID:29211853 Ace Rat N-methylnicotinate multiple interactions ISO Ace (Mus musculus) 6480464 oltipraz affects the reaction [trigonelline affects the reaction [INS2 protein affects the expression of ACE mRNA]] more ... CTD PMID:29211853 Ace Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in decreased expression of ACE mRNA CTD PMID:18164116 Ace Rat Nandrolone decanoate increases expression EXP 6480464 nandrolone decanoate results in increased expression of ACE mRNA CTD PMID:17906098 Ace Rat naringin multiple interactions EXP 6480464 naringin inhibits the reaction [[NG-Nitroarginine Methyl Ester co-treated with bisphenol A] results in increased activity of ACE protein] more ... CTD PMID:32172062 and PMID:32810514 Ace Rat nicotianamine decreases activity ISO ACE (Homo sapiens) 6480464 nicotianamine results in decreased activity of ACE protein CTD PMID:26106051 Ace Rat nicotinamide multiple interactions ISO Ace (Mus musculus) 6480464 2 more ... CTD PMID:37120126 Ace Rat nicotine increases expression ISO ACE (Homo sapiens) 6480464 Nicotine results in increased expression of ACE mRNA CTD PMID:11166759 Ace Rat nicotinic acid decreases activity EXP 6480464 Niacin results in decreased activity of ACE protein CTD PMID:18374418 Ace Rat nitric oxide multiple interactions EXP 6480464 Hydralazine inhibits the reaction [Nitric Oxide deficiency results in increased expression of ACE mRNA] and Hydrochlorothiazide inhibits the reaction [Nitric Oxide deficiency results in increased expression of ACE mRNA] CTD PMID:16326922 Ace Rat nitric oxide increases expression EXP 6480464 Nitric Oxide deficiency results in increased expression of ACE mRNA CTD PMID:10948087 and PMID:16326922 Ace Rat nitrofen decreases activity EXP 6480464 nitrofen results in decreased activity of ACE protein CTD PMID:9498404 Ace Rat NS-398 multiple interactions ISO ACE (Homo sapiens) 6480464 N-(2-cyclohexyloxy-4-nitrophenyl)methanesulfonamide promotes the reaction [VEGFA protein results in increased expression of ACE protein] CTD PMID:11158990 Ace Rat oleic acid affects activity EXP 6480464 Oleic Acid affects the activity of ACE protein CTD PMID:20804650 Ace Rat oleuropein multiple interactions EXP 6480464 oleuropein inhibits the reaction [Isoproterenol results in increased activity of ACE protein] CTD PMID:26056852 Ace Rat oltipraz multiple interactions EXP 6480464 oltipraz inhibits the reaction [trigonelline inhibits the reaction [Glucose results in increased expression of ACE mRNA]] CTD PMID:29211853 Ace Rat oltipraz multiple interactions ISO Ace (Mus musculus) 6480464 oltipraz affects the reaction [trigonelline affects the reaction [INS2 protein affects the expression of ACE mRNA]] and oltipraz affects the reaction [trigonelline affects the reaction [INS2 protein affects the expression of ACE protein]] CTD PMID:29211853 Ace Rat omapatrilat decreases activity ISO ACE (Homo sapiens) 6480464 omapatrilat results in decreased activity of ACE protein CTD PMID:11762555 Ace Rat Ondansetron multiple interactions EXP 6480464 Ondansetron inhibits the reaction [Cisplatin results in increased expression of ACE protein] CTD PMID:38437957 Ace Rat ouabain affects expression EXP 6480464 Ouabain affects the expression of ACE mRNA and Ouabain affects the expression of ACE protein CTD PMID:16565308 Ace Rat ozone multiple interactions ISO Ace (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of ACE mRNA CTD PMID:34911549 Ace Rat paracetamol increases expression ISO Ace (Mus musculus) 6480464 Acetaminophen results in increased expression of ACE mRNA CTD PMID:34724096 Ace Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of ACE mRNA CTD PMID:33387578 Ace Rat paraquat multiple interactions ISO Ace (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of ACE mRNA and pimagedine inhibits the reaction [Paraquat results in decreased activity of ACE protein] CTD PMID:12161173 and PMID:36117858 Ace Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of ACE mRNA CTD PMID:20465954 Ace Rat paraquat decreases activity EXP 6480464 Paraquat results in decreased activity of ACE protein CTD PMID:16182431 Ace Rat paraquat affects expression EXP 6480464 Paraquat affects the expression of ACE protein CTD PMID:10666014 Ace Rat paraquat multiple interactions EXP 6480464 Curcumin inhibits the reaction [Paraquat affects the expression of ACE protein] and Unithiol inhibits the reaction [Paraquat results in decreased expression of ACE mRNA] CTD PMID:10666014 and PMID:20465954 Ace Rat paraquat decreases activity ISO Ace (Mus musculus) 6480464 Paraquat results in decreased activity of ACE protein CTD PMID:12161173 Ace Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Ace (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of ACE mRNA CTD PMID:36331819 Ace Rat perindopril affects response to substance ISO ACE (Homo sapiens) 6480464 ACE gene polymorphism affects the susceptibility to Perindopril CTD PMID:11007831 Ace Rat phenylephrine affects response to substance ISO ACE (Homo sapiens) 6480464 ACE protein affects the susceptibility to Phenylephrine CTD PMID:18431347 Ace Rat phorbol 13-acetate 12-myristate increases expression ISO ACE (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate results in increased expression of ACE mRNA CTD PMID:15071347 Ace Rat phorbol 13-acetate 12-myristate multiple interactions ISO ACE (Homo sapiens) 6480464 carvedilol inhibits the reaction [Tetradecanoylphorbol Acetate results in increased expression of ACE mRNA] and Tetradecanoylphorbol Acetate inhibits the reaction [VEGFA protein results in increased expression of ACE protein] CTD PMID:11158990 and PMID:15071347 Ace Rat pioglitazone multiple interactions EXP 6480464 pioglitazone inhibits the reaction [Streptozocin results in increased expression of ACE mRNA] and pioglitazone inhibits the reaction [Streptozocin results in increased expression of ACE protein] CTD PMID:16979161 Ace Rat pirfenidone decreases expression EXP 6480464 pirfenidone results in decreased expression of ACE protein CTD PMID:28091615 Ace Rat pirinixic acid decreases expression ISO Ace (Mus musculus) 6480464 pirinixic acid results in decreased expression of ACE mRNA CTD PMID:17426115 Ace Rat potassium dichromate decreases expression ISO Ace (Mus musculus) 6480464 Potassium Dichromate results in decreased expression of ACE mRNA CTD PMID:23608068 Ace Rat pravastatin multiple interactions EXP 6480464 [INS1 protein co-treated with Pravastatin] inhibits the reaction [Streptozocin results in increased expression of ACE protein] CTD PMID:29682576 Ace Rat pregabalin multiple interactions EXP 6480464 Captopril inhibits the reaction [Pregabalin results in increased expression of ACE protein] and Telmisartan inhibits the reaction [Pregabalin results in increased expression of ACE protein] CTD PMID:31629013 Ace Rat pregabalin increases expression EXP 6480464 Pregabalin results in increased expression of ACE protein CTD PMID:31629013 Ace Rat proanthocyanidin decreases activity EXP 6480464 Proanthocyanidins results in decreased activity of ACE protein CTD PMID:16390204 Ace Rat prostaglandin E2 multiple interactions ISO ACE (Homo sapiens) 6480464 ACE inhibits the reaction [Cocaine affects the abundance of Dinoprostone] CTD PMID:14738173 Ace Rat prostaglandin I2 multiple interactions ISO ACE (Homo sapiens) 6480464 ACE inhibits the reaction [Cocaine affects the abundance of Epoprostenol] CTD PMID:14738173 Ace Rat quercetin multiple interactions EXP 6480464 Quercetin inhibits the reaction [Colchicine results in decreased activity of ACE protein] CTD PMID:18980205 Ace Rat quercetin multiple interactions ISO Ace (Mus musculus) 6480464 Quercetin affects the reaction [Dietary Fats affects the activity of ACE protein] and Quercetin affects the reaction [Dietary Fats affects the expression of ACE mRNA] CTD PMID:27260466 Ace Rat quercetin increases expression EXP 6480464 Quercetin results in increased expression of ACE mRNA CTD PMID:18095365 Ace Rat quinapril hydrochloride decreases activity EXP 6480464 Quinapril results in decreased activity of ACE protein CTD PMID:15728788 Ace Rat quinapril hydrochloride decreases activity ISO ACE (Homo sapiens) 6480464 Quinapril results in decreased activity of ACE protein CTD PMID:8227822 Ace Rat raloxifene decreases expression ISO ACE (Homo sapiens) 6480464 Raloxifene Hydrochloride results in decreased expression of ACE mRNA CTD PMID:15849065 Ace Rat ramipril decreases activity ISO ACE (Homo sapiens) 6480464 Ramipril results in decreased activity of ACE protein CTD PMID:10543928 and PMID:3034026 Ace Rat ramipril multiple interactions EXP 6480464 Ramipril inhibits the reaction [Doxorubicin results in increased expression of ACE mRNA] CTD PMID:36636964 Ace Rat rebaudioside A decreases expression ISO ACE (Homo sapiens) 6480464 rebaudioside A results in decreased expression of ACE mRNA CTD PMID:31655124 Ace Rat resveratrol decreases expression EXP 6480464 resveratrol results in decreased expression of ACE protein CTD PMID:21962734 Ace Rat resveratrol decreases expression EXP 401793709 resveratrol decreases expression of mRNA in kidney of male offspring from pregnant dams treated with 2 more ... RGD Ace Rat resveratrol multiple interactions ISO Ace (Mus musculus) 6480464 resveratrol affects the reaction [Dietary Fats affects the activity of ACE protein] and resveratrol affects the reaction [Dietary Fats affects the expression of ACE mRNA] CTD PMID:27260466 Ace Rat resveratrol multiple interactions EXP 6480464 Resveratrol inhibits the reaction [Colchicine results in decreased activity of ACE protein] and Resveratrol inhibits the reaction [Streptozocin results in increased expression of ACE mRNA] CTD PMID:17135773 and PMID:22191573 Ace Rat rivastigmine multiple interactions EXP 6480464 Rivastigmine inhibits the reaction [Colchicine results in decreased expression of ACE protein] CTD PMID:17652827 Ace Rat silicon atom multiple interactions ISO Ace (Mus musculus) 6480464 [Silicon Dioxide results in increased abundance of Silicon] which results in decreased expression of ACE mRNA CTD PMID:39353502 Ace Rat silicon dioxide multiple interactions ISO Ace (Mus musculus) 6480464 7-Ala-angiotensin (1-7) promotes the reaction [Silicon Dioxide results in increased expression of ACE protein] more ... CTD PMID:33007385 and PMID:39353502 Ace Rat silicon dioxide increases expression ISO Ace (Mus musculus) 6480464 Silicon Dioxide results in increased expression of ACE mRNA and Silicon Dioxide results in increased expression of ACE protein CTD PMID:33007385 Ace Rat silver atom increases expression EXP 6480464 Silver results in increased expression of ACE mRNA CTD PMID:26277626 Ace Rat silver(0) increases expression EXP 6480464 Silver results in increased expression of ACE mRNA CTD PMID:26277626 Ace Rat sodium arsenite decreases expression ISO Ace (Mus musculus) 6480464 sodium arsenite results in decreased expression of ACE mRNA and sodium arsenite results in decreased expression of ACE protein CTD PMID:32991915 Ace Rat sodium arsenite increases methylation ISO ACE (Homo sapiens) 6480464 sodium arsenite results in increased methylation of ACE exon CTD PMID:32844245 Ace Rat sodium arsenite decreases expression ISO ACE (Homo sapiens) 6480464 sodium arsenite results in decreased expression of ACE mRNA CTD PMID:29301061 and PMID:32844245 Ace Rat sodium arsenite multiple interactions ISO ACE (Homo sapiens) 6480464 ERN1 affects the reaction [sodium arsenite results in increased expression of ACE mRNA] more ... CTD PMID:28973481 Ace Rat sodium arsenite increases expression ISO ACE (Homo sapiens) 6480464 sodium arsenite results in increased expression of ACE mRNA and sodium arsenite results in increased expression of ACE protein CTD PMID:28973481 Ace Rat sodium chloride multiple interactions ISO ACE (Homo sapiens) 6480464 ACE gene polymorphism affects the susceptibility to [Enalapril co-treated with Sodium Chloride] and ACE gene polymorphism inhibits the reaction [[Enalapril co-treated with Sodium Chloride] results in increased susceptibility to AGT protein modified form] CTD PMID:20829712 Ace Rat sodium dichromate decreases expression EXP 6480464 sodium bichromate results in decreased expression of ACE mRNA CTD PMID:22561333 Ace Rat sodium fluoride decreases expression ISO Ace (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of ACE protein CTD PMID:28918527 Ace Rat spironolactone multiple interactions EXP 6480464 Spironolactone inhibits the reaction [Aldosterone results in increased activity of ACE protein] and Spironolactone inhibits the reaction [Aldosterone results in increased expression of ACE mRNA] CTD PMID:15932931 Ace Rat spironolactone affects expression EXP 6480464 Spironolactone affects the expression of ACE protein CTD PMID:30734886 Ace Rat spironolactone decreases expression EXP 6480464 Spironolactone results in decreased expression of ACE protein CTD PMID:18586661 Ace Rat steviol decreases expression ISO ACE (Homo sapiens) 6480464 steviol results in decreased expression of ACE mRNA CTD PMID:31655124 Ace Rat stevioside decreases expression ISO ACE (Homo sapiens) 6480464 stevioside results in decreased expression of ACE mRNA CTD PMID:31655124 Ace Rat streptozocin multiple interactions EXP 6480464 [INS1 protein co-treated with Pravastatin] inhibits the reaction [Streptozocin results in increased expression of ACE protein] more ... CTD PMID:16979161 more ... Ace Rat streptozocin multiple interactions ISO Ace (Mus musculus) 6480464 2 more ... CTD PMID:29266779 and PMID:37120126 Ace Rat streptozocin increases activity ISO Ace (Mus musculus) 6480464 Streptozocin results in increased activity of ACE protein CTD PMID:28468961 Ace Rat streptozocin increases expression ISO Ace (Mus musculus) 6480464 Streptozocin results in increased expression of ACE protein CTD PMID:29266779 Ace Rat streptozocin increases expression EXP 6480464 Streptozocin results in increased expression of ACE mRNA and Streptozocin results in increased expression of ACE protein CTD PMID:15793251 more ... Ace Rat sunitinib decreases expression ISO ACE (Homo sapiens) 6480464 Sunitinib results in decreased expression of ACE mRNA CTD PMID:31533062 Ace Rat telmisartan decreases expression EXP 6480464 Telmisartan results in decreased expression of ACE mRNA and Telmisartan results in decreased expression of ACE protein CTD PMID:19171132 more ... Ace Rat telmisartan multiple interactions EXP 6480464 Telmisartan inhibits the reaction [Pregabalin results in increased expression of ACE protein] CTD PMID:31629013 Ace Rat testosterone multiple interactions EXP 6480464 [Estradiol co-treated with Testosterone] results in increased expression of ACE mRNA and Losartan inhibits the reaction [Testosterone results in increased activity of ACE protein] CTD PMID:11375906 and PMID:25673179 Ace Rat testosterone decreases expression ISO ACE (Homo sapiens) 6480464 Testosterone results in decreased expression of ACE mRNA CTD PMID:33359661 Ace Rat testosterone increases activity EXP 6480464 Testosterone results in increased activity of ACE protein CTD PMID:25673179 Ace Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of ACE mRNA and Carbon Tetrachloride results in increased expression of ACE protein CTD PMID:12629582 and PMID:31150632 Ace Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of ACE mRNA] CTD PMID:31150632 Ace Rat titanium dioxide decreases expression ISO Ace (Mus musculus) 6480464 titanium dioxide results in decreased expression of ACE mRNA CTD PMID:23557971 Ace Rat titanium dioxide decreases methylation ISO Ace (Mus musculus) 6480464 titanium dioxide results in decreased methylation of ACE gene CTD PMID:35295148 Ace Rat titanium dioxide multiple interactions ISO Ace (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of ACE mRNA CTD PMID:29950665 Ace Rat titanium dioxide increases expression ISO Ace (Mus musculus) 6480464 titanium dioxide results in increased expression of ACE mRNA CTD PMID:29264374 Ace Rat titanium dioxide increases expression EXP 6480464 titanium dioxide results in increased expression of ACE mRNA CTD PMID:26277626 Ace Rat toluene multiple interactions ISO ACE (Homo sapiens) 6480464 [Toluene co-treated with ethylbenzene co-treated with Xylenes] results in decreased methylation of ACE gene and [Toluene co-treated with ethylbenzene co-treated with Xylenes] results in increased expression of ACE mRNA CTD PMID:26018793 Ace Rat trandolapril decreases activity EXP 6480464 trandolapril results in decreased activity of ACE protein CTD PMID:27428043 Ace Rat tributylstannane increases expression ISO Ace (Mus musculus) 6480464 tributyltin results in increased expression of ACE mRNA CTD PMID:31939706 Ace Rat triclosan decreases expression ISO ACE (Homo sapiens) 6480464 Triclosan results in decreased expression of ACE mRNA CTD PMID:30510588 Ace Rat triptonide increases expression ISO Ace (Mus musculus) 6480464 triptonide results in increased expression of ACE mRNA CTD PMID:33045310 Ace Rat tyrphostin AG 1478 multiple interactions EXP 6480464 RTKI cpd inhibits the reaction [Aldosterone results in increased expression of ACE mRNA] CTD PMID:15932931 Ace Rat valproic acid increases methylation ISO ACE (Homo sapiens) 6480464 Valproic Acid results in increased methylation of ACE gene CTD PMID:29154799 Ace Rat valsartan multiple interactions EXP 6480464 Valsartan inhibits the reaction [Streptozocin results in increased expression of ACE mRNA] and Valsartan inhibits the reaction [Streptozocin results in increased expression of ACE protein] CTD PMID:23733546 Ace Rat valsartan decreases expression EXP 6480464 Valsartan results in decreased expression of ACE mRNA CTD PMID:31023080 Ace Rat venlafaxine hydrochloride increases expression EXP 6480464 Venlafaxine Hydrochloride results in increased expression of ACE mRNA CTD PMID:25423262 Ace Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of ACE mRNA CTD PMID:19015723 Ace Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of ACE mRNA CTD PMID:30207508 Ace Rat zinc atom decreases activity ISO ACE (Homo sapiens) 6480464 Zinc results in decreased activity of ACE protein CTD PMID:17114810 Ace Rat zinc sulfate multiple interactions ISO ACE (Homo sapiens) 6480464 Zinc Sulfate inhibits the reaction [Edetic Acid results in decreased activity of ACE protein] CTD PMID:28544013 Ace Rat zinc(0) decreases activity ISO ACE (Homo sapiens) 6480464 Zinc results in decreased activity of ACE protein CTD PMID:17114810
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
abdominal aortic aneurysm (IMP) Acute Hepatitis (IEP) acute kidney failure (IMP) Acute Lung Injury (ISO) adenocarcinoma (ISO) adult respiratory distress syndrome (ISO) Albuminuria (IMP,ISO) alcoholic cardiomyopathy (ISO) Alcoholic Liver Diseases (ISO) allergic disease (ISO) allergic rhinitis (ISO) Alzheimer's disease (IMP,ISO) anemia (ISO) Angiotensin I-Converting Enzyme, Benign Serum Increase (ISO) ankylosing spondylitis (ISO) Aortic Coarctation (IEP) Arteriovenous Fistula (IEP,IMP) aspiration pneumonia (ISO) asthma (ISO) atrial fibrillation (ISO) autistic disorder (ISO) autosomal recessive polycystic kidney disease (IEP,IMP) Banti's Syndrome (ISO) Behcet's disease (ISO) berylliosis (ISO) bipolar disorder (IEA) brain ischemia (ISO) breast cancer (ISO) bronchiolitis obliterans (IMP) CAKUT (ISO) Cardiac Arrhythmias (ISO) Cardiomegaly (IMP) cardiovascular system disease (ISO) carotid artery disease (ISO) celiac disease (ISO) Cerebral Hemorrhage (ISO) cerebral infarction (ISO) Chemical and Drug Induced Liver Injury (IEP) chemical colitis (ISO) Chemotherapy-Induced Febrile Neutropenia (ISO) cholestasis (IEP) Chronic Hepatitis C (IEP,ISO) Chronic Intermittent Hypoxia (IEP) chronic myeloid leukemia (ISO) chronic obstructive pulmonary disease (ISO) congenital diaphragmatic hernia (IEP) Congenital Hepatic Fibrosis (IEP) congestive heart failure (IEP,IMP,ISO) coronary artery disease (ISO) Coronary Disease (ISO) coronary restenosis (ISO) Coronavirus infectious disease (ISO) Cough (ISO) COVID-19 (ISO) Cytomegalovirus Infections (ISO) diabetic angiopathy (ISO) Diabetic Cardiomyopathies (IEP) Diabetic Nephropathies (IDA,IMP,ISO) diabetic retinopathy (ISO) diastolic heart failure (IMP,ISO) diffuse cystic renal dysplasia (ISO) dilated cardiomyopathy (ISO) drug allergy (ISO) end stage renal disease (IMP,ISO) endomyocardial fibrosis (IEP) Endotoxemia (IEP) Experimental Arthritis (IEP) Experimental Colitis (ISO) Experimental Diabetes Mellitus (IEP,ISO) Experimental Liver Cirrhosis (IEP) extrinsic allergic alveolitis (ISO) Fabry disease (ISO) Familial Cerebral Cavernous Malformation (ISO) familial Mediterranean fever (ISO) Fetal Death (ISO) Fetal Growth Retardation (IEP) focal segmental glomerulosclerosis 1 (IMP) gallbladder adenocarcinoma (ISO) Gaucher's disease (ISO) genetic disease (ISO) Genetic Predisposition to Disease (ISO) glomerulonephritis (IMP) glomerulosclerosis (IMP) glycogen storage disease V (ISO) heart valve disease (ISO) Helicobacter Infections (ISO) hepatitis A (ISO) hepatocellular carcinoma (ISO) Hyperoxia (IEP) hypertension (IDA,IEP,IMP,ISO) Hypertensive Nephrosclerosis (IMP,ISO) hypertrophic cardiomyopathy (ISO) Hypotension (ISO) IgA glomerulonephritis (ISO) IgA vasculitis (ISO) in situ carcinoma (ISO) Insulin Resistance (ISO) intermediate coronary syndrome (ISO) Intestinal Reperfusion Injury (IEP) intracranial aneurysm (ISO) kidney disease (ISO) kidney failure (ISO) Kidney Reperfusion Injury (IMP) Left Ventricular Hypertrophy (IEP,IMP,ISO) leukemia (ISO) leukostasis (IMP) liver cirrhosis (IEP,ISO) Liver Metastasis (ISO) lung cancer (ISO) lung carcinoma (ISO) lung disease (IEP,IMP,ISO) Lung Injury (ISO) Lung Neoplasms (ISO) malaria (ISO) male infertility (ISO) Memory Disorders (IMP,ISO) Meningococcal Infections (ISO) metabolic dysfunction-associated steatotic liver disease (ISO) microcephaly (ISO) middle cerebral artery infarction (IMP) mitral valve disease (ISO) mitral valve prolapse (ISO) multiple myeloma (ISO) Mycobacterium Infections (ISO) myocardial infarction (IEP,IMP,ISO) myocarditis (IMP) Neoplasm Metastasis (ISO) nephritis (ISO) nephrosis (IEP,IMP) nephrotic syndrome (IDA,IMP) non-arteritic anterior ischemic optic neuropathy (ISO) obesity (IEP,ISO) obstructive sleep apnea (IEP,ISO) ocular hypotension (IMP) osteoporosis (IMP) Pain (IMP) pancreatic cancer (ISO) pancreatic ductal carcinoma (ISO) Parkinson's disease (ISO) Peritoneal Fibrosis (IMP,ISO) Pleural Effusion (ISO) pneumonia (ISO) polycythemia (ISO) pre-eclampsia (ISO) pre-malignant neoplasm (IMP) Pregnancy-Induced Hypertension (IEP) Premature Infant Diseases (ISO) Prenatal Exposure Delayed Effects (IEP) primary biliary cholangitis (IEP) Prostatic Neoplasms (ISO) proteinuria (IMP,ISO) pulmonary fibrosis (IEP,IMP,ISO) pulmonary hypertension (ISO) Puromycin Aminonucleoside Nephrosis (IMP) pyelonephritis (ISO) Radiation Nephropathy (IMP) renal fibrosis (IMP,ISO) Renal Tubular Dysgenesis (ISO) renovascular hypertension (IDA,IEP) Reperfusion Injury (IMP) respiratory system disease (ISO) Right Ventricular Hypertrophy (IEP) sarcoidosis (ISO) schizophrenia (ISO) Sepsis (ISO) severe acute respiratory syndrome (ISO) Staphylococcal Infections (ISO) stomach cancer (ISO) Stomach Neoplasms (ISO) Stroke (IMP,ISO) subacute sclerosing panencephalitis (ISO) substance-induced psychosis (ISO) Sudden Death (ISO) systemic lupus erythematosus (ISO) systemic scleroderma (ISO) toxic shock syndrome (ISO) type 1 diabetes mellitus (ISO) type 2 diabetes mellitus (ISO) ureteral obstruction (IMP) uveitis (ISO) Vascular System Injuries (IAGP,ISO) Venous Thromboembolism (ISO) Ventricular Fibrillation (IMP) Ventricular Remodeling (IDA) viral pneumonia (ISO) Weight Gain (ISO) Weight Loss (ISO)
(+)-pilocarpine (EXP) (+)-schisandrin B (EXP) (+)-trans-(S)-allethrin (ISO) (-)-epigallocatechin 3-gallate (ISO) (R)-lipoic acid (EXP,ISO) (S)-colchicine (EXP) (S)-nicotine (ISO) (S,S,S)-nicotianamine (ISO) 1,10-phenanthroline (ISO) 1,2-dimethylhydrazine (ISO) 14,15-EET (EXP) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,5-dihydroxybenzoic acid (ISO) 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine (EXP) 3,3',5-triiodo-L-thyronine (EXP) 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione (ISO) 3-chloropropane-1,2-diol (EXP) 4,4'-sulfonyldiphenol (ISO) 4-(5,6,7,8-tetrahydroimidazo[1,5-a]pyridin-5-yl)benzonitrile (EXP) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) 7,9-dihydro-1H-purine-2,6,8(3H)-trione (ISO) Ac-Ser-Asp-Lys-Pro-OH (ISO) acetamide (EXP) acetylsalicylic acid (ISO) acrylamide (ISO) actinomycin D (EXP) aldehydo-D-glucose (EXP,ISO) aldosterone (EXP) aluminium atom (ISO) aluminium(0) (ISO) aminoguanidine (ISO) amitrole (EXP) amlodipine (EXP) ammonium chloride (EXP) antirheumatic drug (ISO) arsenite(3-) (ISO) atorvastatin calcium (EXP) atrazine (ISO) Azoxymethane (ISO) benazepril (ISO) benzo[a]pyrene (EXP,ISO) beta-naphthoflavone (EXP) bezafibrate (EXP) bis(2-chloroethyl) sulfide (EXP,ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bleomycin A2 (EXP) boric acid (ISO) bortezomib (ISO) Butralin (EXP) cadmium dichloride (EXP) caffeine (EXP) candesartan (EXP) cannabidiol (ISO) captan (ISO) captopril (EXP,ISO) carbon nanotube (ISO) carvedilol (EXP,ISO) chlorpyrifos (EXP) chromium atom (EXP) chromium(6+) (ISO) cilazapril monohydrate (ISO) cisplatin (EXP) cobalt dichloride (ISO) cocaine (ISO) corticosterone (EXP) Cuprizon (EXP) curcumin (EXP) cyclophosphamide (EXP) D-glucose (EXP,ISO) DDT (EXP) dexamethasone (EXP,ISO) dextran sulfate (ISO) diisononyl phthalate (ISO) dioxygen (ISO) doxorubicin (EXP) EC 3.4.15.1 (peptidyl-dipeptidase A) inhibitor (EXP) enalapril (EXP,ISO) enalaprilat dihydrate (ISO) ethanol (EXP) ethylbenzene (ISO) ethylenediaminetetraacetic acid (ISO) fenvalerate (ISO) flavonoids (EXP) folic acid (EXP,ISO) folpet (ISO) formaldehyde (ISO) fructose (EXP) furan (EXP) genistein (EXP) gentamycin (EXP) glucose (EXP,ISO) glycidol (EXP) goralatide (ISO) GW 4064 (ISO) herbimycin (ISO) hydralazine (EXP) hydrazines (ISO) hydrochlorothiazide (EXP) hydrogen peroxide (ISO) indometacin (ISO) indoxyl sulfate (EXP) inulin (ISO) isoprenaline (EXP) ketamine (EXP) L-ascorbic acid (ISO) Lasiocarpine (ISO) lead diacetate (EXP) lead(0) (EXP) lipoic acid (EXP,ISO) lisinopril dihydrate (ISO) lithium chloride (EXP) losartan (EXP,ISO) lycopene (EXP) Magnolol (EXP) maneb (ISO) manganese(II) chloride (EXP) manidipine (EXP) metformin (ISO) methoxychlor (EXP) metoprolol (ISO) microcystin RR (ISO) mifepristone (EXP) monocrotaline (EXP) N(4)-hydroxycytidine (ISO) N(gamma)-nitro-L-arginine methyl ester (EXP) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) N-methylnicotinate (EXP,ISO) N-nitrosodiethylamine (EXP) Nandrolone decanoate (EXP) naringin (EXP) nicotianamine (ISO) nicotinamide (ISO) nicotine (ISO) nicotinic acid (EXP) nitric oxide (EXP) nitrofen (EXP) NS-398 (ISO) oleic acid (EXP) oleuropein (EXP) oltipraz (EXP,ISO) omapatrilat (ISO) Ondansetron (EXP) ouabain (EXP) ozone (ISO) paracetamol (EXP,ISO) paraquat (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) perindopril (ISO) phenylephrine (ISO) phorbol 13-acetate 12-myristate (ISO) pioglitazone (EXP) pirfenidone (EXP) pirinixic acid (ISO) potassium dichromate (ISO) pravastatin (EXP) pregabalin (EXP) proanthocyanidin (EXP) prostaglandin E2 (ISO) prostaglandin I2 (ISO) quercetin (EXP,ISO) quinapril hydrochloride (EXP,ISO) raloxifene (ISO) ramipril (EXP,ISO) rebaudioside A (ISO) resveratrol (EXP,ISO) rivastigmine (EXP) silicon atom (ISO) silicon dioxide (ISO) silver atom (EXP) silver(0) (EXP) sodium arsenite (ISO) sodium chloride (ISO) sodium dichromate (EXP) sodium fluoride (ISO) spironolactone (EXP) steviol (ISO) stevioside (ISO) streptozocin (EXP,ISO) sunitinib (ISO) telmisartan (EXP) testosterone (EXP,ISO) tetrachloromethane (EXP) titanium dioxide (EXP,ISO) toluene (ISO) trandolapril (EXP) tributylstannane (ISO) triclosan (ISO) triptonide (ISO) tyrphostin AG 1478 (EXP) valproic acid (ISO) valsartan (EXP) venlafaxine hydrochloride (EXP) vinclozolin (EXP) zinc atom (ISO) zinc sulfate (ISO) zinc(0) (ISO)
Biological Process
amyloid-beta metabolic process (IEA,ISO) angiogenesis involved in coronary vascular morphogenesis (IMP) angiotensin maturation (IEA,ISO,ISS) angiotensin-activated signaling pathway (IEA,ISO) animal organ regeneration (IMP) arachidonate secretion (IEA,ISO) bradykinin catabolic process (IDA,IEA,IMP,ISO) cell proliferation in bone marrow (IEA,ISO) cellular response to aldosterone (IEP) cellular response to glucose stimulus (IEP) eating behavior (IMP) embryo development ending in birth or egg hatching (IMP) female pregnancy (IEP) heart contraction (IEA,ISO) hormone catabolic process (IEA,ISO,ISS) hormone metabolic process (IEA,ISO,ISS) kidney development (IEA,IEP,ISO,ISS) lung alveolus development (IMP) lung development (IEP) male gonad development (IEA,IEP,ISO) negative regulation of calcium ion import (IMP) negative regulation of D-glucose import (IMP) negative regulation of gap junction assembly (IEA,ISO) negative regulation of gene expression (IEA,ISO) neutrophil mediated immunity (IEA,ISO) peptide catabolic process (IDA,IEA,ISO) peptide metabolic process (IMP) positive regulation of apoptotic process (IMP) positive regulation of blood pressure (IMP) positive regulation of neurogenesis (IMP) positive regulation of systemic arterial blood pressure (IBA,IEA,IMP,ISO) positive regulation of vasoconstriction (IMP) post-transcriptional regulation of gene expression (IEA,ISO) proteolysis (IEA) regulation of angiotensin metabolic process (IEA,ISO) regulation of blood pressure (IDA,IEA,ISO,TAS) regulation of heart rate by cardiac conduction (IEA,ISO) regulation of hematopoietic stem cell proliferation (IEA,ISO) regulation of smooth muscle cell migration (IDA) regulation of synaptic plasticity (IEA,ISO,ISS) regulation of systemic arterial blood pressure by renin-angiotensin (IBA,IEA,ISO) response to dexamethasone (IEP) response to hypoxia (IEP) response to laminar fluid shear stress (IEP) response to lipopolysaccharide (IMP) response to nutrient levels (IEP) response to thyroid hormone (IEP) response to xenobiotic stimulus (IEP) spermatogenesis (IEA,ISO) substance P catabolic process (IEA,ISO,ISS) vasoconstriction (IMP)
Cellular Component
basal plasma membrane (IDA) brush border membrane (IDA) cytoplasm (IEA,ISO) endosome (IEA,ISO) external side of plasma membrane (IEA,ISO) extracellular exosome (IEA,ISO) extracellular region (IEA,ISO) extracellular space (IDA,IEA,ISO,ISS) lysosome (IEA,ISO) membrane (IEA) plasma membrane (IBA,IEA,ISO,ISS) sperm midpiece (IDA) vesicle (IDA)
Molecular Function
actin binding (ISO) bradykinin receptor binding (IEA,ISO) calmodulin binding (IEA) carboxypeptidase activity (IEA) chloride ion binding (IEA,ISO,ISS) endopeptidase activity (IEA,ISO) exopeptidase activity (IEA,ISO) heterocyclic compound binding (IDA) hydrolase activity (IEA) metal ion binding (IEA) metallocarboxypeptidase activity (IEA,ISO) metallodipeptidase activity (IEA,ISO,ISS) metalloendopeptidase activity (IEA,ISO,ISS) metallopeptidase activity (IBA,IEA,IMP,ISO) mitogen-activated protein kinase binding (IEA,ISO) mitogen-activated protein kinase kinase binding (IEA,ISO) peptidase activity (IDA,IEA,ISO) peptidyl-dipeptidase activity (IBA,IDA,IEA,ISO,ISS) protein binding (ISO) tripeptidyl-peptidase activity (IEA,ISO) zinc ion binding (IEA,ISO)
1.
Protective effect of captopril against clozapine-induced myocarditis in rats: role of oxidative stress, proinflammatory cytokines and DNA damage.
Abdel-Wahab BA, etal., Chem Biol Interact. 2014 Jun 5;216:43-52. doi: 10.1016/j.cbi.2014.03.012. Epub 2014 Apr 5.
2.
Mechanisms of angiotensin converting enzyme inhibitor-induced IOP reduction in normotensive rats.
Agarwal R, etal., Eur J Pharmacol. 2014 May 5;730:8-13. doi: 10.1016/j.ejphar.2014.02.021. Epub 2014 Feb 26.
3.
Is serum angiotensin converting enzyme level a useful non-invasive marker for liver fibrosis in patients with chronic hepatitis C?
Akar T, Rev Assoc Med Bras (1992). 2018 Mar;64(3):224-229. doi: 10.1590/1806-9282.64.03.224.
4.
The effect of maternal administration of captopril on fetal development in rat.
al-Shabanah OA, etal., Res Commun Chem Pathol Pharmacol. 1991 Aug;73(2):221-30.
5.
Elevated serum angiotensin converting enzyme levels as a reflection of bone marrow renin-angiotensin system activation in multiple myeloma.
Albayrak M, etal., J Renin Angiotensin Aldosterone Syst. 2012 Jun;13(2):259-64. doi: 10.1177/1470320312437070. Epub 2012 Feb 16.
6.
Angiotensin-converting enzyme insertion/deletion gene polymorphism in patients with familial multiple cerebral cavernous malformations.
Altas M, etal., J Clin Neurosci. 2010 Aug;17(8):1034-7. doi: 10.1016/j.jocn.2009.12.002. Epub 2010 May 21.
7.
Effects of blockade of the renin-angiotensin and endothelin systems on experimental bronchiolitis obliterans.
Antus B, etal., J Heart Lung Transplant. 2006 Nov;25(11):1324-9.
8.
Antihypertensives as novel antineoplastics: angiotensin-I-converting enzyme inhibitors and angiotensin II type 1 receptor blockers in pancreatic ductal adenocarcinoma.
Arafat HA, etal., J Am Coll Surg. 2007 May;204(5):996-1005; discussion 1005-6.
9.
Angiotensin I-converting enzyme activity in puromycin aminonucleoside-nephrotic syndrome.
Arevalo AE, etal., Clin Chim Acta. 1990 Nov 5;191(3):175-84.
10.
Angiotensin-converting enzyme genotype predicts valve damage in acute rheumatic fever.
Atalar E, etal., J Heart Valve Dis. 2003 Jan;12(1):7-10.
11.
Polymorphism of angiotensin converting enzyme is associated with severe circulatory compromise in febrile neutropenic children with cancer.
Bardi E, etal., Pediatr Blood Cancer. 2005 Aug;45(2):217-21.
12.
ACE activity is modulated by the enzyme a-galactosidase A.
Batista EC, etal., J Mol Med (Berl). 2011 Jan;89(1):65-74. doi: 10.1007/s00109-010-0686-2. Epub 2010 Oct 13.
13.
Effects on cytokines and histology by treatment with the ACE inhibitor captopril and the antioxidant retinoic acid in the monocrotaline model of experimentally induced lung fibrosis.
Baybutt RC, etal., Curr Pharm Des. 2007;13(13):1327-33.
14.
The genetic association database.
Becker KG, etal., Nat Genet. 2004 May;36(5):431-2.
15.
No contribution of angiotensin-converting enzyme (ACE) gene variants to severe obesity: a model for comprehensive case/control and quantitative cladistic analysis of ACE in human diseases.
Bell CG, etal., Eur J Hum Genet. 2007 Mar;15(3):320-7. Epub 2006 Dec 13.
16.
Inhibiting angiotensin-converting enzyme promotes renal repair by limiting progenitor cell proliferation and restoring the glomerular architecture.
Benigni A, etal., Am J Pathol. 2011 Aug;179(2):628-38. doi: 10.1016/j.ajpath.2011.04.003. Epub 2011 Jun 2.
17.
Beneficial effect of TGFbeta antagonism in treating diabetic nephropathy depends on when treatment is started.
Benigni A, etal., Nephron Exp Nephrol. 2006;104(4):e158-68. Epub 2006 Aug 10.
18.
Separate metabolic pathways for Leu-enkephalin and Met-enkephalin-Arg(6)-Phe(7) degradation by rat striatal synaptosomal membranes.
Benuck M, etal., Neurochem Int. 1982;4(5):389-96. doi: 10.1016/0197-0186(82)90081-x.
19.
Elevated levels of circulating angiotensin converting enzyme in patients with hepatoportal sclerosis.
Beyazit Y, etal., Dig Dis Sci. 2011 Jul;56(7):2160-5. doi: 10.1007/s10620-011-1580-7. Epub 2011 Feb 3.
20.
Comparison of the incidence of imidapril and enalapril induced cough.
Boonyapisit W and Tresukosol D, J Med Assoc Thai. 2010 Jan;93 Suppl 1:S48-53.
21.
Involvement of renal ACE activity in proteinuria-associated renal damage in untreated and treated adriamycin nephrotic rats.
Bos H, etal., J Renin Angiotensin Aldosterone Syst 2003 Jun;4(2):106-12.
22.
Acute kidney injury in the rat causes cardiac remodelling and increases angiotensin-converting enzyme 2 expression.
Burchill L, etal., Exp Physiol. 2008 May;93(5):622-30. doi: 10.1113/expphysiol.2007.040386. Epub 2008 Jan 25.
23.
Myocardial infarction increases ACE2 expression in rat and humans.
Burrell LM, etal., Eur Heart J 2005 Feb;26(4):369-75; discussion 322-4. Epub 2005 Jan 25.
24.
Effects of maternal captopril treatment during late pregnancy on neonatal lung development in rats.
Capelari DN, etal., Regul Pept. 2012 Aug 20;177(1-3):97-106. Epub 2012 May 12.
25.
Enalapril and losartan restored blood pressure and vascular reactivity in intrauterine undernourished rats.
Ceravolo GS, etal., Life Sci. 2007 Jan 30;80(8):782-7. Epub 2006 Nov 10.
26.
Time course involvement of matrix metalloproteinases in the vascular alterations of renovascular hypertension.
Ceron CS, etal., Matrix Biol. 2012 May;31(4):261-70. Epub 2012 Feb 10.
27.
Angiotensin I-converting enzyme genotype influences arterial response to injury in normotensive rats.
Challah M, etal., Arterioscler Thromb Vasc Biol. 1998 Feb;18(2):235-43.
28.
Cardiac angiotensin converting enzyme overproduction indicates interstitial activation in renovascular hypertension.
Challah M, etal., Cardiovasc Res. 1995 Aug;30(2):231-9.
29.
Renin released from mast cells activated by circulating MCP-1 initiates the microvascular phase of the systemic inflammation of alveolar hypoxia.
Chao J, etal., Am J Physiol Heart Circ Physiol. 2011 Dec;301(6):H2264-70. Epub 2011 Sep 30.
30.
Release of angiotensin-(1-7) from the rat hindlimb: influence of angiotensin-converting enzyme inhibition.
Chappell MC, etal., Hypertension. 2000 Jan;35(1 Pt 2):348-52.
31.
Role of angiotensin II in retinal leukostasis in the diabetic rat.
Chen P, etal., Exp Eye Res. 2006 Nov;83(5):1041-51. Epub 2006 Jul 5.
32.
Effect of angiotensin I-converting enzyme inhibitory peptide from rice dregs protein on antihypertensive activity in spontaneously hypertensive rats.
Chen Q, etal., Asia Pac J Clin Nutr. 2007;16 Suppl:281-5.
33.
Role of angiotensin-converting enzyme gene polymorphisms in children with sepsis and septic shock.
Cogulu O, etal., Pediatr Int. 2008 Aug;50(4):477-80. doi: 10.1111/j.1442-200X.2008.02583.x.
34.
Sex-specific effects of low protein diet on in utero programming of renal G-protein coupled receptors.
Cooke CL, etal., J Dev Orig Health Dis. 2014 Feb;5(1):36-44. doi: 10.1017/S2040174413000524.
35.
Regulation of ACE gene expression and plasma levels during rat postnatal development.
Costerousse O, etal., Am J Physiol. 1994 Nov;267(5 Pt 1):E745-53.
36.
Angiotensin I-converting enzyme inhibition but not angiotensin II suppression alters angiotensin I-converting enzyme gene expression in vessels and epithelia.
Costerousse O, etal., J Pharmacol Exp Ther. 1998 Mar;284(3):1180-7.
37.
Age-related progressive renal fibrosis in rats and its prevention with ACE inhibitors and taurine.
Cruz CI, etal., Am J Physiol Renal Physiol. 2000 Jan;278(1):F122-9.
38.
Effects of E. coli endotoxin on rat plasma angiotensin converting enzyme activity in vitro and in vivo.
Deitz DM, etal., Circ Shock. 1987;21(1):23-9.
39.
COVID-19 infections are also affected by human ACE1 D/I polymorphism.
Delanghe JR, etal., Clin Chem Lab Med. 2020 Jun 25;58(7):1125-1126. doi: 10.1515/cclm-2020-0425.
40.
Pathways of bradykinin degradation in blood and plasma of normotensive and hypertensive rats.
Dendorfer A, etal., Am J Physiol Heart Circ Physiol. 2001 May;280(5):H2182-8.
41.
Locus for the inducible, but not a constitutive, nitric oxide synthase cosegregates with blood pressure in the Dahl salt-sensitive rat.
Deng AY and Rapp JP, J Clin Invest 1995 May;95(5):2170-7
42.
Cosegregation of blood pressure with angiotensin converting enzyme and atrial natriuretic peptide receptor genes using Dahl salt-sensitive rats.
Deng Y and Rapp JP, Nat Genet 1992 Jul;1(4):267-72
43.
Association study of ACE and eNOS single nucleotide polymorphisms with Henoch-Schonlein purpura nephritis.
Di B, etal., Mol Med Rep. 2012 Nov;6(5):1171-7. doi: 10.3892/mmr.2012.1032. Epub 2012 Aug 10.
44.
Effect of enalapril on exercise cardiopulmonary performance in chronic obstructive pulmonary disease: A pilot study.
Di Marco F, etal., Pulm Pharmacol Ther. 2010 Jun;23(3):159-64. Epub 2010 Jan 22.
45.
Correlations between ACE single nucleotide polymorphisms and prognosis of patients with septic shock.
Dou XM, etal., Biosci Rep. 2017 Apr 28;37(2). pii: BSR20170145. doi: 10.1042/BSR20170145. Print 2017 Apr 30.
46.
Effect of valsartan versus lisinopril on peritoneal sclerosis in rats.
Duman S, etal., Int J Artif Organs. 2005 Feb;28(2):156-63.
47.
Angiotensin 1-7 improves insulin sensitivity by increasing skeletal muscle glucose uptake in vivo.
Echeverria-Rodriguez O, etal., Peptides. 2014 Jan;51:26-30. doi: 10.1016/j.peptides.2013.10.022. Epub 2013 Oct 31.
48.
Effect of captopril treatment on recuperation from ischemia/reperfusion-induced acute renal injury.
Efrati S, etal., Nephrol Dial Transplant. 2012 Jan;27(1):136-45. Epub 2011 Jun 16.
49.
Angiotensin converting enzyme gene polymorphism in Turkish asthmatic patients.
Eryuksel E, etal., J Asthma. 2009 May;46(4):335-8.
50.
Influence of angiotensin-converting enzyme I/D gene polymorphism on clinical and histological correlates of chronic hepatitis C.
Fabris C, etal., Hepatol Res. 2009 Aug;39(8):795-804. doi: 10.1111/j.1872-034X.2009.00518.x. Epub 2009 Apr 23.
51.
Hepatotoxicity effect of short-term Bradykinin potentiating factor in cholestatic rats.
Fahmy SR, etal., Toxicol Lett. 2019 Feb;301:73-78. doi: 10.1016/j.toxlet.2018.11.006. Epub 2018 Nov 17.
52.
Angiotensin-converting enzyme DD genotype, angiotensin type 1 receptor CC genotype, and hyperhomocysteinemia increase first-trimester fetal-loss susceptibility.
Fatini C, etal., Blood Coagul Fibrinolysis. 2000 Oct;11(7):657-62.
53.
AGT and ACE genes influence classic mitral valve prolapse predisposition in Marfan patients.
Fatini C, etal., Int J Cardiol. 2008 Jan 24;123(3):293-7. Epub 2007 Mar 26.
54.
Effects of curcumin on angiotensin-converting enzyme gene expression, oxidative stress and anti-oxidant status in thioacetamide-induced hepatotoxicity.
Fazal Y, etal., J Renin Angiotensin Aldosterone Syst. 2015 Dec;16(4):1046-51. doi: 10.1177/1470320314545777. Epub 2014 Aug 20.
55.
The angiotensin-I-converting enzyme inhibitor enalapril and aspirin delay progression of pancreatic intraepithelial neoplasia and cancer formation in a genetically engineered mouse model of pancreatic cancer.
Fendrich V, etal., Gut. 2010 May;59(5):630-7. Epub 2009 Nov 1.
56.
Unexpected role of the human cytomegalovirus contribute to essential hypertension in the Kazakh Chinese population of Xinjiang.
Feng Q, etal., Biosci Rep. 2018 Jun 27;38(3). pii: BSR20171522. doi: 10.1042/BSR20171522. Print 2018 Jun 29.
57.
Genetic polymorphisms of the renin-angiotensin system in breast cancer patients.
Fishchuk LE and Gorovenko NG, Exp Oncol. 2013 Jun;35(2):101-4.
58.
Serial micropuncture analysis of glomerular function in two rat models of glomerular sclerosis.
Fogo A, etal., J Clin Invest. 1988 Jul;82(1):322-30.
59.
Relationship between polymorphisms in the renin-angiotensin system and nephropathy in type 2 diabetic patients.
Fradin S, etal., Diabetes Metab. 2002 Feb;28(1):27-32.
60.
Angiotensin I-converting enzyme gene polymorphism is associated with myocardial infarction, but not with retinopathy or nephropathy, in NIDDM.
Fujisawa T, etal., Diabetes Care. 1995 Jul;18(7):983-5.
61.
Angiotensin converting enzyme activity is positively associated with IL-17a levels in patients with schizophrenia.
Gadelha A, etal., Psychiatry Res. 2015 Oct 30;229(3):702-7. doi: 10.1016/j.psychres.2015.08.018. Epub 2015 Aug 12.
62.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
63.
[Effect of carvedilol and perindopril on Ca(2+) pump activity and Ca(2+)-release channel density in myocardial sarcoplasmic reticulum in rats with chronic heart failure following myocardial infarction]
Geng ZH, etal., Nan Fang Yi Ke Da Xue Xue Bao. 2009 Jul;29(7):1461-4.
64.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
65.
Risk of venous thromboembolism associated with the insertion/deletion polymorphism in the angiotensin-converting enzyme gene.
Gonzalez Ordonez AJ, etal., Blood Coagul Fibrinolysis. 2000 Jul;11(5):485-90.
66.
Renin-angiotensin System Activation in Congenital Hepatic Fibrosis in the PCK Rat Model of Autosomal Recessive Polycystic Kidney Disease.
Goto M, etal., J Pediatr Gastroenterol Nutr. 2010 Apr 14.
67.
The renin-angiotensin system and hypertension in autosomal recessive polycystic kidney disease.
Goto M, etal., Pediatr Nephrol. 2010 Dec;25(12):2449-57. doi: 10.1007/s00467-010-1621-z. Epub 2010 Aug 27.
68.
Angiotensin-converting enzyme (ACE)-inhibition in cirrhosis. Pharmacokinetics and dynamics of the ACE-inhibitor cilazapril (Ro 31-2848).
Gross V, etal., J Hepatol. 1993 Jan;17(1):40-7. doi: 10.1016/s0168-8278(05)80519-7.
69.
Clinical course of sarcoidosis in dependence on HLA-DRB1 allele frequencies, inflammatory markers, and the presence of M. tuberculosis DNA fragments.
Grosser M, etal., Sarcoidosis Vasc Diffuse Lung Dis. 2005 Mar;22(1):66-74.
70.
Association between renin-angiotensin system gene polymorphism and recurrent wheezing in Chinese children: a 4-year follow-up study.
Guo S, etal., J Int Med Res. 2009 Mar-Apr;37(2):351-8.
71.
Effects of an angiotensin-converting enzyme inhibitor on the inflammatory response in in vivo and in vitro models.
Hagiwara S, etal., Crit Care Med. 2009 Feb;37(2):626-33.
72.
I/D ACE gene polymorphism in survival of leukemia patients -- hypothesis and pilot study.
Hajek D, etal., Med Hypotheses. 2003 Jul;61(1):80-5.
73.
[Increase of activity of angiotensin-converting enzyme in insulin-dependent diabetic patients with permanent microalbuminuria].
Hallab M, etal., Arch Mal Coeur Vaiss. 1992 Aug;85(8):1185-8.
74.
Aldosterone induces angiotensin-converting-enzyme gene expression in cultured neonatal rat cardiocytes.
Harada E, etal., Circulation. 2001 Jul 10;104(2):137-9.
75.
Heart mass and blood pressure have separate genetic determinants in the New Zealand genetically hypertensive (GH) rat.
Harris EL, etal., J Hypertens 1995 Apr;13(4):397-404.
76.
Long-term angiotensin-converting enzyme inhibitor perindopril therapy improves cerebral perfusion reserve in patients with previous minor stroke.
Hatazawa J, etal., Stroke. 2004 Sep;35(9):2117-22. doi: 10.1161/01.STR.0000136034.86144.e9. Epub 2004 Jul 15.
77.
Attenuation in rat brain nitric oxide synthase activity in the coarctation model of hypertension.
Hegde LG, etal., Pharmacol Res. 1997 Aug;36(2):109-14.
78.
Hemopressin is an inverse agonist of CB1 cannabinoid receptors.
Heimann AS, etal., Proc Natl Acad Sci U S A. 2007 Dec 18;104(51):20588-93. doi: 10.1073/pnas.0706980105. Epub 2007 Dec 12.
79.
Portal pressure responses and angiotensin peptide production in rat liver are determined by relative activity of ACE and ACE2.
Herath CB, etal., Am J Physiol Gastrointest Liver Physiol. 2009 Jul;297(1):G98-G106. Epub 2009 Apr 23.
80.
The angiotensin I-converting enzyme (ACE) locus is strongly associated with age and duration of diabetes in patients with type I diabetes.
Hibberd ML, etal., J Diabetes Complications. 1997 Jan-Feb;11(1):2-8.
81.
Association of 3 gene polymorphisms with atopic diseases.
Holla L, etal., J Allergy Clin Immunol. 1999 Apr;103(4):702-8.
82.
Altered angiotensin-converting enzyme and its effects on the brain in a rat model of Alzheimer disease.
Hou DR, etal., Chin Med J (Engl). 2008 Nov 20;121(22):2320-3.
83.
ACE/ACE2 ratio and MMP-9 activity as potential biomarkers in tuberculous pleural effusions.
Hsieh WY, etal., Int J Biol Sci. 2012;8(8):1197-205. doi: 10.7150/ijbs.5087. Epub 2012 Oct 17.
84.
Maternal Resveratrol Therapy Protects Male Rat Offspring against Programmed Hypertension Induced by TCDD and Dexamethasone Exposures: Is It Relevant to Aryl Hydrocarbon Receptor?
Hsu CN, etal., Int J Mol Sci. 2018 Aug 20;19(8):2459. doi: 10.3390/ijms19082459.
85.
BML-111 equilibrated ACE-AngII-AT1R and ACE2-Ang-(1-7)-Mas axis to protect hepatic fibrosis in rats.
Hu Q, etal., Prostaglandins Other Lipid Mediat. 2017 Jul;131:75-82. doi: 10.1016/j.prostaglandins.2017.08.008. Epub 2017 Aug 16.
86.
Expression of angiotensin-converting enzyme 2 in CCL4-induced rat liver fibrosis.
Huang Q, etal., Int J Mol Med. 2009 Jun;23(6):717-23. doi: 10.3892/ijmm_00000185.
87.
[Expression and correlation of angiotensin-converting enzyme 2 in CCl4-induced rat liver fibrosis].
Huang Q, etal., Zhonghua Gan Zang Bing Za Zhi. 2013 Jan;21(1):47-52. doi: 10.3760/cma.j.issn.1007-3418.2013.01.013.
88.
Effect of Antiviral Therapy on Serum Activity of Angiotensin Converting Enzyme in Patients with Chronic Hepatitis C.
Husic-Selimovic A, etal., Med Arch. 2016 Apr;70(2):92-6. doi: 10.5455/medarh.2016.70.92-96. Epub 2016 Apr 1.
89.
Carbonic adsorbent AST-120 retards progression of renal failure by additive effect with ACEI and protein restriction diet.
Imai E, etal., Clin Exp Nephrol. 2003 Jun;7(2):113-9.
90.
Significant association between insertion/deletion polymorphism of the angiotensin-convertig enzyme gene and ankylosing spondylitis.
Inanir A, etal., Mol Vis. 2012;18:2107-13. Epub 2012 Jul 26.
91.
Blockade of sensory abnormalities and kinin B(1) receptor expression by N-acetyl-L-cysteine and ramipril in a rat model of insulin resistance.
Ismael MA, etal., Eur J Pharmacol. 2008 Jul 28;589(1-3):66-72. Epub 2008 May 16.
92.
Genetic mapping of a gene causing hypertension in the stroke-prone spontaneously hypertensive rat.
Jacob HJ, etal., Cell 1991 Oct 4;67(1):213-24
93.
Ramipril mitigates radiation-induced impairment of neurogenesis in the rat dentate gyrus.
Jenrow KA, etal., Radiat Oncol. 2010 Feb 1;5:6.
94.
Chronic treatment with lisinopril decreases proliferative and apoptotic pathways in autosomal recessive polycystic kidney disease.
Jia G, etal., Pediatr Nephrol. 2010 Jun;25(6):1139-46. Epub 2010 Mar 13.
95.
Activation of the renin-angiotensin system in hyperoxia-induced lung fibrosis in neonatal rats.
Jiang JS, etal., Neonatology. 2012;101(1):47-54. doi: 10.1159/000329451. Epub 2011 Jul 26.
96.
Chronic infusion of enalaprilat into hypothalamic paraventricular nucleus attenuates angiotensin II-induced hypertension and cardiac hypertrophy by restoring neurotransmitters and cytokines.
Kang YM, etal., Toxicol Appl Pharmacol. 2014 Feb 1;274(3):436-44. doi: 10.1016/j.taap.2013.12.001. Epub 2013 Dec 14.
97.
Effect of lisinopril on renal tissue damage in unilateral ureteral obstruction in rats.
Karabuga I, etal., Urol Res. 2012 Feb;40(1):27-34. doi: 10.1007/s00240-011-0393-7. Epub 2011 Jun 11.
98.
Effects of spironolactone and eprosartan on cardiac remodeling and angiotensin-converting enzyme isoforms in rats with experimental heart failure.
Karram T, etal., Am J Physiol Heart Circ Physiol. 2005 Oct;289(4):H1351-8. Epub 2005 May 13.
99.
Influence of angiotensin I-converting enzyme polymorphism on development of post-transplant erythrocytosis in renal graft recipients.
Kedzierska K, etal., Clin Transplant. 2008 Mar-Apr;22(2):156-61. doi: 10.1111/j.1399-0012.2007.00760.x.
100.
Association between polymorphisms of the angiotensin-converting enzyme and angiotensinogen genes and allergic rhinitis in a Korean population.
Kim JJ, etal., Ann Otol Rhinol Laryngol. 2004 Apr;113(4):297-302.
101.
Preventive effects of the angiotensin-converting enzyme inhibitor, captopril, on the development of azoxymethane-induced colonic preneoplastic lesions in diabetic and hypertensive rats.
Kochi T, etal., Oncol Lett. 2014 Jul;8(1):223-229. Epub 2014 May 12.
102.
Angiotensin blockade and the progression of renal damage in the spontaneously hypertensive rat.
Kohara K, etal., Hypertension. 1993 Jun;21(6 Pt 2):975-9.
103.
Angiotensin converting enzyme and genetic hypertension: cloning of rat cDNAs and characterization of the enzyme.
Koike G, etal., Biochem Biophys Res Commun 1994 Jan 14;198(1):380-6.
104.
Reciprocal interactions of obstructive sleep apnea and hypertension associated with ACE I/D polymorphism in males.
Koyama RG, etal., Sleep Med. 2009 Dec;10(10):1107-11. Epub 2009 May 23.
105.
Renal vasoconstriction in rats causes a decrease in capillary density and an increase in alkaline phosphatase expression in cardiac capillary nets.
Koyama T and Taka A, Adv Exp Med Biol. 2010;662:83-8.
106.
Genetic linkage of the ACE gene to plasma angiotensin-converting enzyme activity but not to blood pressure. A quantitative trait locus confers identical complex phenotypes in human and rat hypertension.
Kreutz R, etal., Circulation 1995 Nov 1;92(9):2381-4.
107.
Angiotensinogen and angiotensin-converting enzyme mRNA decrease and AT1 receptor mRNA and protein increase in epididymal fat tissue accompany age-induced elevation of adiposity and reductions in expression of GLUT4 and peroxisome proliferator-activated receptor (PPARgamma).
Krskova K, etal., J Physiol Pharmacol. 2011 Aug;62(4):403-10.
108.
Effects of angiotensin-converting enzyme gene polymorphism and serum vitamin D levels on ambulatory blood pressure measurement and left ventricular mass in Turkish hypertensive population.
Kulah E, etal., Blood Press Monit. 2007 Aug;12(4):207-13.
109.
Perinatal DDT Exposure Induces Hypertension and Cardiac Hypertrophy in Adult Mice.
La Merrill MA, etal., Environ Health Perspect. 2016 Nov;124(11):1722-1727. doi: 10.1289/EHP164. Epub 2016 Jun 21.
110.
Disease marker combination enhances patient characterization in the Finnish sarcoidosis patients.
Lahtela E, etal., Respir Med. 2017 Nov;132:92-94. doi: 10.1016/j.rmed.2017.09.014. Epub 2017 Oct 3.
111.
Association of angiotensin converting enzyme and angiotensin type 2 receptor gene polymorphisms with renal damage in posterior urethral valves.
Laksmi NK, etal., J Pediatr Urol. 2010 Dec;6(6):560-6. Epub 2010 Feb 10.
112.
Cellular and subcellular immunohistochemical localization of angiotensin-converting enzyme in the rat adrenal gland.
Laliberte F, etal., Lab Invest. 1987 Apr;56(4):364-71.
113.
Immunohistochemistry of angiotensin I-converting enzyme in rat eye structures involved in aqueous humor regulation.
Laliberte MF, etal., Lab Invest. 1988 Aug;59(2):263-70.
114.
Upregulation of a local renin-angiotensin system in the rat carotid body during chronic intermittent hypoxia.
Lam SY, etal., Exp Physiol. 2014 Jan;99(1):220-31. doi: 10.1113/expphysiol.2013.074591. Epub 2013 Sep 13.
115.
Regulation of the angiotensin-converting enzyme activity by a time-course hypoxia in the carotid body.
Lam SY, etal., J Appl Physiol 2004 Feb;96(2):809-13. Epub 2003 Oct 3.
116.
Mechanism of high glucose induced angiotensin II production in rat vascular smooth muscle cells.
Lavrentyev EN, etal., Circ Res. 2007 Aug 31;101(5):455-64. Epub 2007 Jul 12.
117.
Targeting the renin-angiotensin system: what's new?
Leckie BJ Curr Med Chem Cardiovasc Hematol Agents. 2005 Jan;3(1):23-32.
118.
[Serum angiotensin converting enzyme activity in sarcoidosis. A review of seventy cases].
Leclerc P, etal., Sem Hop. 1982 May 27;58(21):1291-4.
119.
Enalapril inhibits nuclear factor-κB signaling in intestinal epithelial cells and peritoneal macrophages and attenuates experimental colitis in mice.
Lee C, etal., Life Sci. 2014 Jan 24;95(1):29-39. doi: 10.1016/j.lfs.2013.11.005. Epub 2013 Nov 15.
120.
Association of angiotensin-converting enzyme inhibitor therapy initiation with a reduction in hemoglobin levels in patients without renal failure.
Leshem-Rubinow E, etal., Mayo Clin Proc. 2012 Dec;87(12):1189-95. doi: 10.1016/j.mayocp.2012.07.020. Epub 2012 Nov 7.
121.
Angiotensin-Converting Enzyme N-Terminal Inactivation Alleviates Bleomycin-Induced Lung Injury.
Li P, etal., Am J Pathol. 2010 Jul 22.
122.
Balancing Effect of Biejiajian Oral Liquid () on ACE-Ang II-AT1R Axis and ACE2-Ang-(1-7)-Mas Axis in Rats with CCl4-Induced Hepatic Fibrosis.
Li XY, etal., Chin J Integr Med. 2018 Nov;24(11):853-859. doi: 10.1007/s11655-017-2909-7. Epub 2018 Jan 15.
123.
Association of angiotensin-converting enzyme gene 2350 G/A polymorphism with diabetic retinopathy in Chinese Han population.
Liang S, etal., Mol Biol Rep. 2013 Jan;40(1):463-8. doi: 10.1007/s11033-012-2081-2. Epub 2012 Oct 13.
124.
Inhibition of beta-myosin heavy chain gene expression in pressure overload rat heart by losartan and captopril.
Ling Q, etal., Zhongguo Yao Li Xue Bao. 1997 Jan;18(1):63-6.
125.
Sini decoction alleviates E. coli induced acute lung injury in mice via equilibrating ACE-AngII-AT1R and ACE2-Ang-(1-7)-Mas axis.
Liu J, etal., Life Sci. 2018 Sep 1;208:139-148. doi: 10.1016/j.lfs.2018.07.013. Epub 2018 Jul 7.
126.
Angiotensin-converting enzyme is a modifier of hypertensive end organ damage.
Liu X, etal., J Biol Chem. 2009 Jun 5;284(23):15564-72. Epub 2009 Mar 23.
127.
Podocyte repopulation contributes to regression of glomerular injury induced by ACE inhibition.
Macconi D, etal., Am J Pathol. 2009 Mar;174(3):797-807. Epub 2009 Jan 22.
128.
Renin-angiotensin-aldosterone system genes and nonarteritic anterior ischemic optic neuropathy.
Markoula S, etal., Mol Vis. 2011;17:1254-60. Epub 2011 May 6.
129.
Relationships between angiotensin I converting enzyme gene polymorphism, plasma levels, and diabetic retinal and renal complications.
Marre M, etal., Diabetes. 1994 Mar;43(3):384-8.
130.
Detection of the association between a deletion polymorphism in the gene encoding angiotensin I-converting enzyme and advanced diabetic retinopathy.
Matsumoto A, etal., Diabetes Res Clin Pract. 2000 Dec;50(3):195-202.
131.
Upregulation of SERCA2a following short-term ACE inhibition (by enalaprilat) alters contractile performance and arrhythmogenicity of healthy myocardium in rat.
Matus M, etal., Mol Cell Biochem. 2015 May;403(1-2):199-208. doi: 10.1007/s11010-015-2350-1. Epub 2015 Feb 8.
132.
Angiotensin-converting enzyme 2/angiotensin-(1-7)/Mas axis protects against lung fibrosis by inhibiting the MAPK/NF-kappaB pathway.
Meng Y, etal., Am J Respir Cell Mol Biol. 2014 Apr;50(4):723-36. doi: 10.1165/rcmb.2012-0451OC.
133.
Germinal angiotensin I-converting enzyme is totally shed from the rodent sperm membrane during epididymal maturation.
Metayer S, etal., Biol Reprod 2002 Dec;67(6):1763-7.
134.
Angiotensin-converting enzyme in non-neoplastic kidney diseases.
Metzger R, etal., Kidney Int. 1999 Oct;56(4):1442-54.
135.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
136.
[Changing factors of the activity of angiotensin converting enzyme of renal brush border in rats].
Michel B, etal., Arch Mal Coeur Vaiss. 1991 Aug;84(8):1201-4.
137.
Elevated serum levels of angiotensin-converting enzyme in patients with diabetic retinopathy.
Migdalis IN, etal., South Med J. 1990 Apr;83(4):425-7.
138.
Effect of an angiotensin II receptor blocker and two angiotensin converting enzyme inhibitors on transforming growth factor-beta (TGF-beta) and alpha-actomyosin (alpha SMA), important mediators of radiation-induced pneumopathy and lung fibrosis.
Molteni A, etal., Curr Pharm Des. 2007;13(13):1307-16.
139.
Renal ACE and ACE2 expression in early diabetic rats.
Moon JY, etal., Nephron Exp Nephrol. 2008;110(1):e8-e16. Epub 2008 Aug 4.
140.
The kallikrein-kinin system: current and future pharmacological targets.
Moreau ME, etal., J Pharmacol Sci. 2005 Sep;99(1):6-38.
141.
Impact of statins and ACE inhibitors on mortality after COPD exacerbations.
Mortensen EM, etal., Respir Res. 2009 Jun 3;10:45.
142.
Is angiotensin I-converting enzyme a "master" disease gene?
Moskowitz DW, Diabetes Technol Ther. 2002;4(5):683-711. doi: 10.1089/152091502320798321.
143.
Upregulation of Th1 cytokine profile in bronchoalveolar lavage fluid of patients with hypersensitivity pneumonitis.
Mroz RM, etal., J Physiol Pharmacol. 2008 Dec;59 Suppl 6:499-505.
144.
Antihypertensive medications and risk of community-acquired pneumonia.
Mukamal KJ, etal., J Hypertens. 2010 Feb;28(2):401-5.
145.
Oral administration of an angiotensin-converting enzyme 2 activator ameliorates diabetes-induced cardiac dysfunction.
Murca TM, etal., Regul Pept. 2012 Aug 20;177(1-3):107-15. doi: 10.1016/j.regpep.2012.05.093. Epub 2012 May 14.
146.
The impact of statins, ACE inhibitors and gastric acid suppressants on pneumonia mortality in a UK general practice population cohort.
Myles PR, etal., Pharmacoepidemiol Drug Saf. 2009 Aug;18(8):697-703.
147.
The impact of host's genetic susceptibility on Helicobacter pylori infection in children.
Mărginean MO, etal., Medicine (Baltimore). 2017 Jul;96(30):e7612. doi: 10.1097/MD.0000000000007612.
148.
Association of angiotensin converting enzyme gene insertion/deletion polymorphism with lung cancer in Turkey.
Nacak M, etal., Cancer Genet Cytogenet. 2010 Apr 1;198(1):22-6.
149.
Evidence for the involvement of NADPH oxidase in ischemia/reperfusion-induced gastric damage via angiotensin II.
Nakagiri A, etal., J Physiol Pharmacol. 2010 Apr;61(2):171-9.
150.
Effects of angiotensin inhibitors on renal injury and angiotensin receptor expression in early hypertensive nephrosclerosis.
Nakaya H, etal., Hypertens Res. 1999 Nov;22(4):303-12.
151.
Glomerular abundance of nephrin and podocin in experimental nephrotic syndrome: different effects of antiproteinuric therapies.
Nakhoul F, etal., Am J Physiol Renal Physiol. 2005 Oct;289(4):F880-90. Epub 2005 Jun 7.
152.
Tissue levels, tissue angiotensin converting enzyme inhibition and antihypertensive effect of the novel antihypertensive agent alacepril in renal hypertensive rats.
Nambu K, etal., Arzneimittelforschung. 1986;36(1):47-51.
153.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
154.
Changes in the renin angiotensin system during the development of colorectal cancer liver metastases.
Neo JH, etal., BMC Cancer. 2010 Apr 10;10:134. doi: 10.1186/1471-2407-10-134.
155.
Cardiac angiotensin II participates in coronary microvessel inflammation of unstable angina and strengthens the immunomediated component.
Neri Serneri GG, etal., Circ Res. 2004 Jun 25;94(12):1630-7. Epub 2004 May 6.
156.
Activation of cardiac renin-angiotensin system in unstable angina.
Neri Serneri GG, etal., J Am Coll Cardiol. 2001 Jul;38(1):49-55.
157.
ACE2 and ANG-(1-7) in the rat uterus during early and late gestation.
Neves LA, etal., Am J Physiol Regul Integr Comp Physiol. 2008 Jan;294(1):R151-61. Epub 2007 Oct 31.
158.
Serum angiotensin-converting enzyme level for evaluating significant fibrosis in chronic hepatitis B.
Noguchi R, etal., World J Gastroenterol. 2017 Sep 28;23(36):6705-6714. doi: 10.3748/wjg.v23.i36.6705.
159.
Enalapril attenuates downregulation of Angiotensin-converting enzyme 2 in the late phase of ventricular dysfunction in myocardial infarcted rat.
Ocaranza MP, etal., Hypertension. 2006 Oct;48(4):572-8. Epub 2006 Aug 14.
160.
Isoproterenol and angiotensin I-converting enzyme in lung, left ventricle, and plasma during myocardial hypertrophy and fibrosis.
Ocaranza MP, etal., J Cardiovasc Pharmacol. 2002 Aug;40(2):246-54.
161.
Angiotensin I-converting enzyme gene polymorphism influences chronic hypertensive response in the rat Goldblatt model.
Ocaranza MP, etal., J Hypertens 2002 Mar;20(3):413-20.
162.
Effect of hypertension on angiotensin-(1-7) levels in rats with different angiotensin-I converting enzyme polymorphism.
Ocaranza MP, etal., Life Sci. 2006 Feb 28;78(14):1535-42. Epub 2005 Oct 17.
163.
Insertion/deletion polymorphism and serum activity of the angiotensin-converting enzyme in Turkish patients with obstructive sleep apnea syndrome.
Ogus C, etal., Biochem Genet. 2010 Jun;48(5-6):516-23. Epub 2010 Feb 25.
164.
Effects of an angiotensin-converting enzyme inhibitor-based regimen on pneumonia risk.
Ohkubo T, etal., Am J Respir Crit Care Med. 2004 May 1;169(9):1041-5. Epub 2004 Feb 27.
165.
Modulation of plasminogen activator inhibitor-1 in vivo: a new mechanism for the anti-fibrotic effect of renin-angiotensin inhibition.
Oikawa T, etal., Kidney Int. 1997 Jan;51(1):164-72.
166.
Lisinopril reduces cardiac hypertrophy and mortality in rats with aortocaval fistula.
Oka T, etal., Eur J Pharmacol. 1993 Mar 30;234(1):55-60.
167.
Antenatal glucocorticoid therapy suppresses angiotensin-converting enzyme activity in rats with nitrofen-induced congenital diaphragmatic hernia.
Okoye BO, etal., J Pediatr Surg. 1998 Feb;33(2):286-91.
168.
Mild but prolonged elevation of serum angiotensin converting enzyme (ACE) activity in alcoholics.
Okuno F, etal., Alcohol. 1986 Nov-Dec;3(6):357-9. doi: 10.1016/0741-8329(86)90053-4.
169.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
170.
The renin-angiotensin system genetic polymorphisms and rheumatic mitral valve disease.
Ozisik K, etal., J Heart Valve Dis. 2004 Jan;13(1):33-7.
171.
Angiotensin-converting enzyme gene polymorphism in Behcet's disease.
Ozturk MA, etal., Clin Rheumatol. 2004 Apr;23(2):142-6. Epub 2004 Feb 24.
172.
Angiotensin-converting enzyme I/D polymorphism in chronic obstructive pulmonary disease.
Pabst S, etal., Eur J Med Res. 2009 Dec 7;14 Suppl 4:177-81.
173.
Enalapril attenuates ischaemic brain oedema and protects the blood-brain barrier in rats via an anti-oxidant action.
Panahpour H, etal., Clin Exp Pharmacol Physiol. 2014 Mar;41(3):220-6. doi: 10.1111/1440-1681.12210.
174.
Polymorphism of the ACE Gene in dialysis patients: overexpression of DD genotype in type 2 diabetic end-stage renal failure patients.
Park HC, etal., Yonsei Med J. 2005 Dec 31;46(6):779-87.
175.
Effects of captopril and angiotensin II receptor blockers (AT1, AT2) on myocardial ischemia-reperfusion induced infarct size.
Parlakpinar H, etal., Cytokine. 2011 Dec;56(3):688-94. Epub 2011 Oct 4.
176.
Gene polymorphisms and febrile neutropenia in acute leukemia--no association with IL-4, CCR-5, IL-1RA, but the MBL-2, ACE, and TLR-4 are associated with the disease in Turkish patients: a preliminary study.
Pehlivan M, etal., Genet Test Mol Biomarkers. 2014 Jul;18(7):474-81. doi: 10.1089/gtmb.2014.0004. Epub 2014 May 12.
177.
Reduced circulating levels of angiotensin-(1--7) in systemic sclerosis: a new pathway in the dysregulation of endothelial-dependent vascular tone control.
Pignone A, etal., Ann Rheum Dis. 2007 Oct;66(10):1305-10. Epub 2007 Mar 14.
178.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
179.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
180.
Angiotensin-converting enzyme inhibitor versus angiotensin II, AT1 receptor antagonist. Effects on smooth muscle cell migration and proliferation after balloon catheter injury.
Prescott MF, etal., Am J Pathol. 1991 Dec;139(6):1291-6.
181.
Diminazene aceturate enhances angiotensin-converting enzyme 2 activity and attenuates ischemia-induced cardiac pathophysiology.
Qi Y, etal., Hypertension. 2013 Oct;62(4):746-52. doi: 10.1161/HYPERTENSIONAHA.113.01337. Epub 2013 Aug 19.
182.
Zhonghua lao dong wei sheng zhi ye bing za zhi = Zhonghua laodong weisheng zhiyebing zazhi = Chinese journal of industrial hygiene and occupational diseases
Qiu QM, etal., Zhonghua Lao Dong Wei Sheng Zhi Ye Bing Za Zhi. 2010 Apr;28(4):275-9.
183.
Renin-angiotensin polymorphisms and QTc interval prolongation in end-stage renal disease.
Raizada V, etal., Kidney Int. 2005 Sep;68(3):1186-9.
184.
Atrial fibrosis in a chronic murine model of obstructive sleep apnea: mechanisms and prevention by mesenchymal stem cells.
Ramos P, etal., Respir Res. 2014 Apr 28;15:54. doi: 10.1186/1465-9921-15-54.
185.
[Angiotensin converting enzyme and left ventricular hypertrophy in uremic patients: correlation and therapeutic options].
Rasic S, etal., Acta Med Croatica. 2004;58(3):193-6.
186.
GOA pipeline
RGD automated data pipeline
187.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
188.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
189.
Role of angiotensin II in ischemia/reperfusion-induced leukocyte-endothelium interactions in the colon.
Riaz AA, etal., FASEB J. 2004 May;18(7):881-3. doi: 10.1096/fj.03-0502fje. Epub 2004 Mar 4.
190.
Evaluation of angiotensin-converting enzyme (ACE), its homologue ACE2 and neprilysin in angiotensin peptide metabolism.
Rice GI, etal., Biochem J. 2004 Oct 1;383(Pt 1):45-51.
191.
Suppression of angiotensin-converting enzyme expression and activity by shear stress.
Rieder MJ, etal., Circ Res. 1997 Mar;80(3):312-9.
192.
Novel natural peptide substrates for endopeptidase 24.15, neurolysin, and angiotensin-converting enzyme.
Rioli V, etal., J Biol Chem. 2003 Mar 7;278(10):8547-55. doi: 10.1074/jbc.M212030200. Epub 2002 Dec 24.
193.
Angiotensin-converting enzyme 2 (ACE2) and ACE activities display tissue-specific sensitivity to undernutrition-programmed hypertension in the adult rat.
Riviere G, etal., Hypertension. 2005 Nov;46(5):1169-74. Epub 2005 Oct 3.
194.
N-domain angiotensin-converting enzyme isoform expression in tissues of Wistar and spontaneously hypertensive rats.
Ronchi FA, etal., J Hypertens. 2005 Oct;23(10):1869-78.
195.
Inhibitory effect of alphaS1- and alphaS2-casein hydrolysates on angiotensin I-converting enzyme in human endothelial cells in vitro, rat aortic tissue ex vivo, and renovascular hypertensive rats in vivo.
Rousseau-Ralliard D, etal., J Dairy Sci. 2010 Jul;93(7):2906-21. doi: 10.3168/jds.2010-3060.
196.
No significant correlation between ACE Ins/Del genetic polymorphism and COVID-19 infection.
Saadat M, Clin Chem Lab Med. 2020 Jun 25;58(7):1127-1128. doi: 10.1515/cclm-2020-0577.
197.
Involvement of the renin-angiotensin system in the development of vascular damage in a rat model of arthritis: effect of angiotensin receptor blockers.
Sakuta T, etal., Arthritis Rheum. 2010 May;62(5):1319-28.
198.
Local corticosterone production and angiotensin-I converting enzyme shedding in a mouse model of intestinal inflammation.
Salmenkari H, etal., World J Gastroenterol. 2015 Sep 21;21(35):10072-9. doi: 10.3748/wjg.v21.i35.10072.
199.
An experimental model of encapsulating peritoneal sclerosis.
Sawada T, etal., Perit Dial Int. 2009 Feb;29 Suppl 2:S49-50.
200.
Effects of imatinib mesylate on renin-angiotensin system (RAS) activity during the clinical course of chronic myeloid leukaemia.
Sayitoglu M, etal., J Int Med Res. 2009 Jul-Aug;37(4):1018-28.
201.
Angiotensin-converting enzyme (ACE) gene polymorphisms and familial occurrence of sarcoidosis.
Schürmann M, etal., J Intern Med. 2001 Jan;249(1):77-83. doi: 10.1046/j.1365-2796.2001.00776.x.
202.
[To sanitize liv stock raising of helminthiases].
Sedov VA, Veterinariia. 1978 Dec;(12):10-2.
203.
Association of ACE and MTHFR genetic polymorphisms with type 2 diabetes mellitus: Susceptibility and complications.
Settin A, etal., J Renin Angiotensin Aldosterone Syst. 2014 Jan 22.
204.
Angiotensin converting enzyme (ACE) gene expression in experimentally induced liver cirrhosis in rats.
Shahid SM, etal., Pak J Pharm Sci. 2013 Sep;26(5):853-7.
205.
Effect of caloric restriction on nitric oxide production, ACE activity, and blood pressure regulation in rats.
Sharifi AM, etal., Acta Physiol Hung. 2008 Mar;95(1):55-63.
206.
The ACE2/Ang-(1-7)/Mas Axis Confers Cardiopulmonary Protection against Lung Fibrosis and Pulmonary Hypertension.
Shenoy V, etal., Am J Respir Crit Care Med. 2010 Jun 25.
207.
Prevention of osteoporosis by angiotensin-converting enzyme inhibitor in spontaneous hypertensive rats.
Shimizu H, etal., Hypertens Res. 2009 Sep;32(9):786-90. Epub 2009 Jul 10.
208.
Preparation and antagonistic effect of ACE inhibitory peptide from cashew.
Shu Y, etal., J Sci Food Agric. 2019 Dec;99(15):6822-6832. doi: 10.1002/jsfa.9967. Epub 2019 Sep 18.
209.
Elevation of angiotensin-converting enzyme in granulomatous lymph nodes and serum in sarcoidosis: clinical and possible pathogenic significance.
Silverstein E, etal., Ann N Y Acad Sci. 1976;278:498-513. doi: 10.1111/j.1749-6632.1976.tb47062.x.
210.
Reduced severity of a mouse colitis model with angiotensin converting enzyme inhibition.
Spencer AU, etal., Dig Dis Sci. 2007 Apr;52(4):1060-70. doi: 10.1007/s10620-006-9124-2. Epub 2007 Mar 7.
211.
Angiotensin I-Converting Enzyme Insertion/Deletion Polymorphism and Increased Risk of Gall Bladder Cancer in Women.
Srivastava K, etal., DNA Cell Biol. 2010 May 3.
212.
The deletion/insertion polymorphism of the angiotensin converting enzyme gene and cardiovascular-renal risk.
Staessen JA, etal., J Hypertens. 1997 Dec;15(12 Pt 2):1579-92.
213.
Statins and Angiotensin-Converting Enzyme Inhibitors are Associated with Reduced Mortality and Morbidity in Chronic Liver Disease.
Stokkeland K, etal., Basic Clin Pharmacol Toxicol. 2018 Jan;122(1):104-110. doi: 10.1111/bcpt.12844. Epub 2017 Jul 30.
214.
Differential ontogeny of rat brain peptidases: prenatal expression of enkephalin convertase and postnatal development of angiotensin-converting enzyme.
Strittmatter SM, etal., Brain Res. 1986 Oct;394(2):207-15.
215.
Influences of chymase and angiotensin I-converting enzyme gene polymorphisms on gastric cancer risks in Japan.
Sugimoto M, etal., Cancer Epidemiol Biomarkers Prev. 2006 Oct;15(10):1929-34. doi: 10.1158/1055-9965.EPI-06-0339.
216.
ACE-inhibitor suppresses the apoptosis induced by endoplasmic reticulum stress in renal tubular in experimental diabetic rats.
Sun HL, etal., Exp Clin Endocrinol Diabetes. 2009 Jul;117(7):336-44. Epub 2009 Mar 19.
217.
Evaluation of the roles of the Leiden V mutation and ACE I/D polymorphism in subtypes of ischaemic stroke.
Szolnoki Z, etal., J Neurol. 2001 Sep;248(9):756-61.
218.
Angiotensin converting enzyme genotype affects development and course of sarcoidosis in Asian Indians.
Tahir M, etal., Sarcoidosis Vasc Diffuse Lung Dis. 2007 Sep;24(2):106-12.
219.
Lack of relationship between an insertion/deletion polymorphism in the angiotensin I-converting enzyme gene and diabetic nephropathy and proliferative retinopathy in IDDM patients.
Tarnow L, etal., Diabetes. 1995 May;44(5):489-94.
220.
The restoration of kidney mitochondria function by inhibition of angiotensin-II production in rats with acute adriamycin-induced nephrotoxicity.
Taskin E, etal., Ren Fail. 2014 May;36(4):606-12. doi: 10.3109/0886022X.2014.882737. Epub 2014 Feb 6.
221.
Angiotensin-converting enzyme and angiotensin II type 1 receptor gene polymorphisms in children with subacute sclerosing panencephalitis.
Taşdemir N, etal., Am J Med Genet B Neuropsychiatr Genet. 2006 Jul 5;141B(5):445-8. doi: 10.1002/ajmg.b.30343.
222.
Role of angiotensin converting enzyme in the vascular effects of an endopeptidase 24.15 inhibitor.
Telford SE, etal., Br J Pharmacol. 1995 Mar;114(6):1185-92.
223.
Prevention and intervention studies with telmisartan, ramipril and their combination in different rat stroke models.
Thoene-Reineke C, etal., PLoS One. 2011;6(8):e23646. Epub 2011 Aug 25.
224.
Central angiotensin converting enzyme facilitates memory impairment in intracerebroventricular streptozotocin treated rats.
Tota S, etal., Behav Brain Res. 2012 Jan 1;226(1):317-30. Epub 2011 Aug 16.
225.
Severe acute respiratory syndrome coronavirus infection of mice transgenic for the human Angiotensin-converting enzyme 2 virus receptor.
Tseng CT, etal., J Virol. 2007 Feb;81(3):1162-73. Epub 2006 Nov 15.
226.
Angiotensin-converting enzyme I/D polymorphism in Behcet's disease.
Turgut S, etal., Med Princ Pract. 2005 Jul-Aug;14(4):213-6.
227.
Angiotensin-converting enzyme gene polymorphism (insertion/deletion) and liver fibrosis in Turkish patients from the western Black Sea region, Turkey.
Turhan NK, etal., Genet Mol Res. 2015 Dec 16;14(4):17079-90. doi: 10.4238/2015.December.16.8.
228.
Polymorphisms of the angiotensin converting enzyme gene in early-onset and late-onset pre-eclampsia.
Uma R, etal., J Matern Fetal Neonatal Med. 2010 Aug;23(8):874-9. doi: 10.3109/14767050903456667.
229.
Upregulation of caveolin-1 expression is associated with structural modifications of endothelial cells in diabetic lung.
Uyy E, etal., Microvasc Res. 2010 Mar;79(2):154-9. Epub 2010 Jan 6.
230.
Angiotensin-converting enzyme (ACE) I/D corrected serum ACE activity and severity assessment of community-acquired pneumonia.
van de Garde EM, etal., Clin Chem Lab Med. 2007;45(10):1326-31.
231.
Genetic polymorphisms of the renin-angiotensin system and complications of insulin-dependent diabetes mellitus.
van Ittersum FJ, etal., Nephrol Dial Transplant. 2000 Jul;15(7):1000-7.
232.
Metabolic effects of low dose angiotensin converting enzyme inhibitor in dietary obesity in the rat.
Velkoska E, etal., Nutr Metab Cardiovasc Dis. 2010 Jan;20(1):49-55. Epub 2009 Apr 9.
233.
Angiotensin I converting enzyme activity in adriamycin induced nephrosis in rats.
Venkatesan N, etal., Toxicology. 1993 Dec 31;85(2-3):137-48.
234.
Malaria infection promotes a selective expression of kinin receptors in murine liver.
Ventura PDS, etal., Malar J. 2019 Jun 24;18(1):213. doi: 10.1186/s12936-019-2846-3.
235.
[Role of angiotensin II type 1 receptor in activation of nuclear factor-kappaB and activator protein-1 in lung of mice with acute lung injury].
Wang F, etal., Zhonghua Shao Shang Za Zhi. 2010 Apr;26(2):113-6.
236.
Expression of ACE and ACE2 in patients with hypertensive nephrosclerosis.
Wang G, etal., Kidney Blood Press Res. 2011;34(3):141-9. doi: 10.1159/000324521. Epub 2011 Feb 24.
237.
Sustained inhibition of angiotensin I-converting enzyme (ACE) expression and long-term antihypertensive action by virally mediated delivery of ACE antisense cDNA.
Wang H, etal., Circ Res. 1999 Oct 1;85(7):614-22.
238.
A selective cyclooxygenase-2 inhibitor decreases proteinuria and retards progressive renal injury in rats.
Wang JL, etal., Kidney Int. 2000 Jun;57(6):2334-42.
239.
[An experimental study of expression of angiotension converting enzyme 2 in myocardium and effect of telmisartan treatment in pressure-overloaded rats].
Wang LJ, etal., Zhongguo Wei Zhong Bing Ji Jiu Yi Xue. 2008 Apr;20(4):218-22.
240.
Inhibition of ACE activity contributes to the intestinal structural compensation in a massive intestinal resection rat model.
Wang W, etal., Pediatr Surg Int. 2012 May;28(5):533-41. Epub 2012 Mar 24.
241.
Antiproteinuric effect predicts renal protection by angiotensin-converting enzyme inhibition in rats with established adriamycin nephrosis.
Wapstra FH, etal., Clin Sci (Lond). 1996 May;90(5):393-401.
242.
ACE I/D polymorphism associated with abnormal atrial and atrioventricular conduction in lone atrial fibrillation and structural heart disease: implications for electrical remodeling.
Watanabe H, etal., Heart Rhythm. 2009 Sep;6(9):1327-32. doi: 10.1016/j.hrthm.2009.05.014. Epub 2009 May 15.
243.
Cardiac kallikrein-kinin system is upregulated in chronic volume overload and mediates an inflammatory induced collagen loss.
Wei CC, etal., PLoS One. 2012;7(6):e40110. doi: 10.1371/journal.pone.0040110. Epub 2012 Jun 29.
244.
Angiotensin-converting enzyme in sarcoid uveitis.
Weinreb RN, etal., Invest Ophthalmol Vis Sci. 1979 Dec;18(12):1285-7.
245.
Hormonal determinants of sodium excretion in rats with experimental high-output heart failure.
Winaver J, etal., Am J Physiol. 1988 May;254(5 Pt 2):R776-84.
246.
Ventilator-induced inflammatory response in lipopolysaccharide-exposed rat lung is mediated by angiotensin-converting enzyme.
Wosten-van Asperen RM, etal., Am J Pathol. 2010 May;176(5):2219-27. Epub 2010 Mar 19.
247.
Renin-angiotensin system gene polymorphisms and diastolic heart failure.
Wu CK, etal., Eur J Clin Invest. 2008 Nov;38(11):789-97. doi: 10.1111/j.1365-2362.2008.02017.x.
248.
Demonstrating the pharmacogenetic effects of angiotensin-converting enzyme inhibitors on long-term prognosis of diastolic heart failure.
Wu CK, etal., Pharmacogenomics J. 2010 Feb;10(1):46-53. doi: 10.1038/tpj.2009.39. Epub 2009 Sep 15.
249.
Inhibition of AAA in a rat model by treatment with ACEI perindopril.
Xiong F, etal., J Surg Res. 2014 Jun 1;189(1):166-73. doi: 10.1016/j.jss.2014.01.057. Epub 2014 Feb 5.
250.
Lack of association of polymorphisms of the angiotensin converting enzyme and angiotensinogen genes with nonfamilial hypertrophic or dilated cardiomyopathy.
Yamada Y, etal., Am J Hypertens. 1997 Aug;10(8):921-8.
251.
Beneficial effects of beta-conglycinin on renal function and nephrin expression in early streptozotocin-induced diabetic nephropathy rats.
Yang HY, etal., Br J Nutr. 2014 Jan 14;111(1):78-85. doi: 10.1017/S0007114513001876. Epub 2013 Jun 27.
252.
Angiotensin-converting enzyme gene polymorphism is associated with anemia in non small-cell lung cancer.
Yaren A, etal., Exp Biol Med (Maywood). 2008 Jan;233(1):32-7.
253.
Angiotensin-converting enzyme inhibition promotes coronary angiogenesis in the failing heart of Dahl salt-sensitive hypertensive rats.
Yazawa H, etal., J Card Fail. 2011 Dec;17(12):1041-50. Epub 2011 Oct 17.
254.
Epistatic interaction between variations in the angiotensin I converting enzyme and angiotensin II type 1 receptor genes in relation to extent of coronary atherosclerosis.
Ye S, etal., Heart. 2003 Oct;89(10):1195-9.
255.
The role of IL-4 gene 70 bp VNTR and ACE gene I/D variants in Familial Mediterranean fever.
Yigit S, etal., Cytokine. 2014 May;67(1):1-6. doi: 10.1016/j.cyto.2014.01.007. Epub 2014 Feb 22.
256.
Interdependent effect of angiotensin-converting enzyme and platelet-activating factor acetylhydrolase gene polymorphisms on the progression of immunoglobulin A nephropathy.
Yoon HJ, etal., Clin Genet. 2002 Aug;62(2):128-34.
257.
AT1 receptor blocker added to ACE inhibitor provides benefits at advanced stage of hypertensive diastolic heart failure.
Yoshida J, etal., Hypertension. 2004 Mar;43(3):686-91. doi: 10.1161/01.HYP.0000118017.02160.fa. Epub 2004 Feb 2.
258.
Some characteristics of a peptidyl dipeptidase (kininase II) from rat CSF: differential effects of NaCl on the sequential degradation steps of bradykinin.
Yoshida T and Nosaka S, J Neurochem. 1990 Dec;55(6):1861-9.
259.
Interferon augments the anti-fibrotic activity of an angiotensin-converting enzyme inhibitor in patients with refractory chronic hepatitis C.
Yoshiji H, etal., World J Gastroenterol. 2006 Nov 14;12(42):6786-91. doi: 10.3748/wjg.v12.i42.6786.
260.
Role of rat intestinal brush-border membrane angiotensin-converting enzyme in dietary protein digestion.
Yoshioka M, etal., Am J Physiol. 1987 Dec;253(6 Pt 1):G781-6.
261.
Deletion polymorphism of the angiotensin converting enzyme gene predicts persistent proteinuria in Henoch-Schonlein purpura nephritis.
Yoshioka T, etal., Arch Dis Child. 1998 Nov;79(5):394-9.
262.
Polski tygodnik lekarski (Warsaw, Poland : 1960)
Zderkiewicz E Pol Tyg Lek 1978 Jul 17;33(29):1157-9.
263.
Relationship between polymorphism of angiotensin-converting enzyme gene insertion/deletion and risk of hepatocellular carcinoma in a Chinese Dai population.
Zha Y, etal., J Renin Angiotensin Aldosterone Syst. 2015 Sep;16(3):695-9. doi: 10.1177/1470320314539829. Epub 2014 Sep 10.
264.
Interaction of angiotensin I-converting enzyme insertion-deletion polymorphism and daily salt intake influences hypertension in Japanese men.
Zhang L, etal., Hypertens Res. 2006 Oct;29(10):751-8.
265.
Association of angiotensin-converting enzyme gene I/D and CYP11B2 gene -344T/C polymorphisms with lone atrial fibrillation and its recurrence after catheter ablation.
Zhang XL, etal., Exp Ther Med. 2012 Oct;4(4):741-747. Epub 2012 Jul 31.
266.
Angiotensin-converting enzyme gene insertion/deletion polymorphism in children with Henoch-Schonlein purpua nephritis.
Zhou J, etal., J Huazhong Univ Sci Technolog Med Sci. 2004;24(2):158-61.
Ace Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 91,410,129 - 91,430,246 (+) NCBI GRCr8 mRatBN7.2 10 90,910,316 - 90,930,437 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 90,910,316 - 90,931,131 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 95,964,627 - 95,984,783 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 95,427,801 - 95,447,951 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 90,839,016 - 90,859,102 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 94,170,766 - 94,213,831 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 94,170,766 - 94,187,822 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 93,922,062 - 93,965,127 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 95,361,338 - 95,381,455 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 10 89,588,544 - 89,608,666 (+) NCBI Celera Cytogenetic Map 10 q32.1 NCBI
ACE Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 63,477,061 - 63,498,373 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 63,477,061 - 63,498,380 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 61,554,422 - 61,575,734 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 58,908,166 - 58,928,711 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 58,915,908 - 58,952,935 NCBI Celera 17 55,942,475 - 55,963,778 (+) NCBI Celera Cytogenetic Map 17 q23.3 NCBI HuRef 17 56,922,781 - 56,944,100 (+) NCBI HuRef CHM1_1 17 61,618,550 - 61,639,869 (+) NCBI CHM1_1 T2T-CHM13v2.0 17 64,347,269 - 64,368,872 (+) NCBI T2T-CHM13v2.0
Ace Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 105,858,774 - 105,880,790 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 105,858,771 - 105,880,790 (+) Ensembl GRCm39 Ensembl GRCm38 11 105,967,948 - 105,989,964 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 105,967,945 - 105,989,964 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 105,829,261 - 105,851,259 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 105,784,049 - 105,805,350 (+) NCBI MGSCv36 mm8 Celera 11 117,699,475 - 117,721,491 (+) NCBI Celera Cytogenetic Map 11 E1 NCBI cM Map 11 68.84 NCBI
ACE Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 79,648,057 - 79,669,151 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 84,465,633 - 84,486,649 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 57,556,294 - 57,577,294 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 62,710,398 - 62,724,018 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 62,702,341 - 62,733,853 (+) Ensembl panpan1.1 panPan2
ACE Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 11,497,182 - 11,516,362 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 11,497,182 - 11,516,358 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 12,457,866 - 12,477,045 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 13,160,704 - 13,179,888 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 13,160,704 - 13,200,795 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 12,105,344 - 12,124,523 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 15,407,255 - 15,426,429 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 15,410,134 - 15,429,354 (-) NCBI UU_Cfam_GSD_1.0
LOC101968921 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 15,017,159 - 15,036,742 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936541 4,157,393 - 4,178,177 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936541 4,157,847 - 4,178,156 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ACE Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 12 15,394,487 - 15,414,703 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 12 15,394,487 - 15,414,609 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 12 15,381,362 - 15,401,171 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
Ace
.
1549846 Scl47 Serum cholesterol level QTL 47 3.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 50574707 95574707 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 61449 Ciaa2 CIA Autoantibody QTL 2 7.1 blood autoantibody amount (VT:0003725) calculated serum anti-type 2 collagen antibody titer (CMO:0001279) 10 63221094 107211142 Rat 631555 Bp134 Blood pressure QTL 134 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 80515287 91230079 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1298078 Stresp5 Stress response QTL 5 2.99 0.00025 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 42045676 104670812 Rat 1549831 Bss6 Bone structure and strength QTL 6 4 lumbar vertebra strength trait (VT:0010574) vertebra ultimate force (CMO:0001678) 10 57576521 102576521 Rat 1579915 Bp280 Blood pressure QTL 280 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 90404397 107211142 Rat 70164 Bw21 Body weight QTL 21 4.36 0.00005 body mass (VT:0001259) body weight (CMO:0000012) 10 53797494 98952626 Rat 4889948 Bss91 Bone structure and strength QTL 91 4 tibia area (VT:1000281) tibia midshaft total cross-sectional area (CMO:0001715) 10 82564856 92369470 Rat 2298548 Neuinf7 Neuroinflammation QTL 7 3.4 nervous system integrity trait (VT:0010566) spinal cord RT1-B protein level (CMO:0002132) 10 72224939 107211142 Rat 1579919 Bp281 Blood pressure QTL 281 0.01 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 74372084 94965338 Rat 1302404 Cia27 Collagen induced arthritis QTL 27 2.6 0.0045 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 10 76452683 107211142 Rat 1300107 Rf18 Renal function QTL 18 3.41 urine output (VT:0003620) timed urine volume (CMO:0000260) 10 78775516 98279596 Rat 2300218 Hpcl2 Hepatic cholesterol level QTL 2 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 45029650 95600334 Rat 2317754 Glom25 Glomerulus QTL 25 3.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 82685200 107211142 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 70171 Cari1 Carrageenan-induced inflammation QTL 1 4.9 0.0005 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 10 53797385 107211142 Rat 10450495 Bp383 Blood pressure QTL 383 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 76246085 94965338 Rat 2313856 Bp342 Blood pressure QTL 342 4.4 0.0001 life span trait (VT:0005372) age at time of death (CMO:0001193) 10 87307617 96121100 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2292617 Ept18 Estrogen-induced pituitary tumorigenesis QTL 18 3.9 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 10 73453136 96120911 Rat 2313103 Bss80 Bone structure and strength QTL 80 2 0.0001 tibia strength trait (VT:1000284) tibia midshaft endosteal cross-sectional area (CMO:0001716) 10 62057807 107057807 Rat 2293646 Bss25 Bone structure and strength QTL 25 10.96 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 10 69738412 107211142 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 2300172 Bmd57 Bone mineral density QTL 57 9.8 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 10 69738412 107211142 Rat 70193 Mcs7 Mammary carcinoma susceptibility QTL 7 2.38 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 10 72224939 107211142 Rat 2313105 Bss79 Bone structure and strength QTL 79 1.8 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 62057807 107057807 Rat 61363 Oia3 Oil induced arthritis QTL 3 0.001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 87307617 107211142 Rat 1357344 Bp249 Blood pressure QTL 249 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 66743655 98003205 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 2306970 Anxrr22 Anxiety related response QTL 22 5.95 fear/anxiety-related behavior trait (VT:1000241) number of periods of voluntary immobility (CMO:0001045) 10 61345276 98211570 Rat 724530 Bp149 Blood pressure QTL 149 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 90627439 107211142 Rat 1300137 Bp186 Blood pressure QTL 186 3.57 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 10 90627439 107057807 Rat 1359017 Hrtrt21 Heart rate QTL 21 2.4 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 10 51772940 96772940 Rat 2293663 Bss33 Bone structure and strength QTL 33 9.34 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 10 69738412 107211142 Rat 7387312 Bw125 Body weight QTL 125 3 0.0047 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight (CMO:0000356) 10 64890616 107211142 Rat 2312672 Insul15 Insulin level QTL 15 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 10 57134272 102134272 Rat 6893357 Bw102 Body weight QTL 102 0.5 0.36 body mass (VT:0001259) body weight (CMO:0000012) 10 80515287 101325465 Rat 12880384 Cm107 Cardiac mass QTL 107 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 90404397 107211142 Rat 12880385 Cm108 Cardiac mass QTL 108 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 90404397 107211142 Rat 2317029 Aia19 Adjuvant induced arthritis QTL 19 2.98 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 66978955 107211142 Rat 2303589 Bw87 Body weight QTL 87 2 body mass (VT:0001259) body weight (CMO:0000012) 10 81285008 107211142 Rat 12880396 Am13 Aortic mass QTL 13 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 10 90404397 107211142 Rat 2306793 Ean5 Experimental allergic neuritis QTL 5 4.7 nervous system integrity trait (VT:0010566) IFNG-secreting splenocyte count (CMO:0002122) 10 72552416 93995749 Rat 12880398 Kidm67 Kidney mass QTL 67 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 10 90404397 107211142 Rat 61387 Bp1 Blood pressure QTL 1 5.1 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 51770177 107211142 Rat 2306792 Ean4 Experimental allergic neuritis QTL 4 4 nervous system integrity trait (VT:0010566) IFNG-secreting splenocyte count (CMO:0002122) 10 84022321 93995963 Rat 2317039 Aia6 Adjuvant induced arthritis QTL 6 4.31 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 66978955 107211142 Rat 12880395 Cm109 Cardiac mass QTL 109 0.001 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 10 90404397 107211142 Rat 61396 Bp9 Blood pressure QTL 9 4.8 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 68420376 107211142 Rat 634320 Niddm49 Non-insulin dependent diabetes mellitus QTL 49 4.41 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 10 88539139 107211142 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 70364 Bp72 Blood pressure QTL 72 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 51121100 96121100 Rat 10450498 Bp384 Blood pressure QTL 384 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 67750049 107211142 Rat 4889492 Pancm2 Pancreatic morphology QTL 2 3.2 pancreatic beta cell morphology trait (VT:0005217) ratio of insulin-positive cell area to total area of splenic region of pancreas (CMO:0001814) 10 76748906 107211142 Rat 6893366 Bw106 Body weight QTL 106 0.3 0.47 body mass (VT:0001259) body weight (CMO:0000012) 10 70199100 107211142 Rat 2293698 Bss43 Bone structure and strength QTL 43 5.33 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 10 59209888 104209888 Rat 631530 Tls3 T-lymphoma susceptibility QTL 3 0 0.0001 thymus integrity trait (VT:0010555) percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911) 10 51774612 95600334 Rat 1354608 Cm33 Cardiac mass QTL 33 2.8 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 10 54809292 99809292 Rat 1558643 Cm44 Cardiac mass QTL 44 4.8 0.0000368 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 61345276 99703528 Rat 631535 Cm51 Cardiac mass QTL 51 3 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 51786282 91669536 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1558652 Bw57 Body weight QTL 57 4.2 0.0008 body mass (VT:0001259) body weight (CMO:0000012) 10 89327017 90930437 Rat 1576308 Schws1 Schwannoma susceptibility QTL 1 0.0041 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 40035094 102359817 Rat 631269 Cia22 Collagen induced arthritis QTL 22 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 631270 Cia23 Collagen induced arthritis QTL 23 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 6893336 Cm75 Cardiac mass QTL 75 0.1 0.87 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 61345276 99703528 Rat 631547 Bp87 Blood pressure QTL 87 4.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 47369470 92369470 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 12880055 Am11 Aortic mass QTL 11 0.004 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 10 84007272 95933025 Rat 2292438 Bp311 Blood pressure QTL 311 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 76246085 107211142 Rat 2312662 Slep8 Serum leptin concentration QTL 8 0.05 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 10 57134272 102134272 Rat 2301398 Kidm38 Kidney mass QTL 38 0.002 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 10 84007272 95933025 Rat 1600367 Mcs15 Mammary carcinoma susceptibility QTL 15 4.5 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 10 85565469 103884409 Rat 1358188 Ept9 Estrogen-induced pituitary tumorigenesis QTL 9 3.9 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 10 73453136 96120911 Rat 631538 Oia5 Oil induced arthritis QTL 5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 87055121 107211142 Rat 1642980 Bp300 Blood pressure QTL 300 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 68383129 107211142 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat 2312668 Scl65 Serum cholesterol level QTL 65 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 57134272 102134272 Rat
D10Mit1
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 10 91,417,685 - 91,417,879 (+) Marker Load Pipeline Rnor_5.0 10 93,929,621 - 93,929,812 NCBI Rnor5.0 RGSC_v3.4 10 95,368,898 - 95,369,088 RGD RGSC3.4 RGSC_v3.1 10 95,383,268 - 95,383,458 RGD SHRSP x BN Map 10 68.71 RGD SHRSP x BN Map 10 68.71 UniSTS FHH x ACI Map 10 75.81 RGD Cytogenetic Map 10 q32.1 UniSTS
D10Wox18
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 10 91,417,696 - 91,417,869 (+) Marker Load Pipeline Rnor_6.0 10 94,178,338 - 94,178,506 NCBI Rnor6.0 Rnor_5.0 10 93,929,634 - 93,929,802 UniSTS Rnor5.0 RGSC_v3.4 10 95,368,909 - 95,369,078 RGD RGSC3.4 RGSC_v3.4 10 95,368,910 - 95,369,078 UniSTS RGSC3.4 RGSC_v3.1 10 95,383,279 - 95,383,448 RGD Celera 10 89,596,121 - 89,596,289 UniSTS RH 3.4 Map 10 978.1 UniSTS RH 3.4 Map 10 978.1 RGD RH 2.0 Map 10 1075.9 RGD Cytogenetic Map 10 q32.1 UniSTS
RH94768
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 90,930,321 - 90,930,437 (+) MAPPER mRatBN7.2 Rnor_6.0 10 94,084,710 - 94,084,825 NCBI Rnor6.0 Rnor_5.0 10 93,840,108 - 93,840,223 UniSTS Rnor5.0 RGSC_v3.4 10 95,381,340 - 95,381,455 UniSTS RGSC3.4 Celera 10 89,608,551 - 89,608,666 UniSTS Cytogenetic Map 10 q32.1 UniSTS
This gene Ace is modified in the following models/strains:
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
6
38
94
56
52
40
6
40
6
136
56
82
34
49
12
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000010627 ⟹ ENSRNOP00000010627
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 90,910,316 - 90,930,476 (+) Ensembl Rnor_6.0 Ensembl 10 94,170,766 - 94,187,822 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000092961
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 90,917,450 - 90,930,476 (+) Ensembl Rnor_6.0 Ensembl 10 94,177,889 - 94,187,822 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000119881 ⟹ ENSRNOP00000084667
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 90,910,316 - 90,931,131 (+) Ensembl
RefSeq Acc Id:
NM_012544 ⟹ NP_036676
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 91,410,129 - 91,430,246 (+) NCBI mRatBN7.2 10 90,910,316 - 90,930,437 (+) NCBI Rnor_6.0 10 94,170,766 - 94,213,831 (+) NCBI Rnor_5.0 10 93,922,062 - 93,965,127 (+) NCBI RGSC_v3.4 10 95,361,338 - 95,381,455 (+) RGD Celera 10 89,588,544 - 89,608,666 (+) RGD
Sequence:
CGCCGCACCGCGCGCACCGCGCCATGGGGGCCGCGTCCGGCCAGCGGGGGCGGTGGCCGTTGTCACCGCCGCTCTTGATGCTGTCGCTGCTGCTGCTGCTGCTGCTGCCGCCGTCGCCCGCCCCGGCG
hide sequence
RefSeq Acc Id:
NP_036676 ⟸ NM_012544
- Peptide Label:
precursor
- UniProtKB:
Q9EQM9 (UniProtKB/Swiss-Prot), Q8CFN1 (UniProtKB/Swiss-Prot), Q7TMC6 (UniProtKB/Swiss-Prot), P47820 (UniProtKB/Swiss-Prot), A6HJZ3 (UniProtKB/TrEMBL)
- Sequence:
MGAASGQRGRWPLSPPLLMLSLLLLLLLPPSPAPALDPGLQPGNFSADEAGAQLFADSYNSSAEVVMFQSTAASWAHDTNITEENARLQEEAALINQEFAEVWGKKAKELYESIWQNFTDQKLRRIIG
hide sequence
Ensembl Acc Id:
ENSRNOP00000010627 ⟸ ENSRNOT00000010627
Ensembl Acc Id:
ENSRNOP00000084667 ⟸ ENSRNOT00000119881
RGD ID: 13697829 Promoter ID: EPDNEW_R8353 Type: multiple initiation site Name: Ace_1 Description: angiotensin I converting enzyme SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R8354 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 94,170,755 - 94,170,815 EPDNEW
RGD ID: 13697846 Promoter ID: EPDNEW_R8354 Type: multiple initiation site Name: Ace_2 Description: angiotensin I converting enzyme SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R8353 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 94,177,884 - 94,177,944 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-03-09
Ace
angiotensin I converting enzyme
LOC102556346
angiotensin-converting enzyme-like
Data merged from RGD:7565702
737654 PROVISIONAL
2013-12-17
LOC102556346
angiotensin-converting enzyme-like
Symbol and Name status set to provisional
70820 PROVISIONAL
2006-03-30
Ace
angiotensin I converting enzyme (peptidyl-dipeptidase A) 1
angiotensin 1 converting enzyme
Name updated
1299863 APPROVED
2004-12-14
Ace
angiotensin 1 converting enzyme
angiotensin 1 converting enzyme 1
Name updated
1299863 APPROVED
2002-06-10
Ace
angiotensin 1 converting enzyme 1
Symbol and Name updated
70585 PROVISIONAL
Note Type
Note
Reference
gene_disease
affects heart mass independent of blood pressure
1357231
gene_process
functions in the renin-angiotensin system
61036
gene_process
plays an important role in the regulation of blood volume and pressure
61036
gene_process
level of plasma enzyme activity does not directly link to blood pressure
619632
