Symbol:
Crebbp
Name:
CREB binding protein
RGD ID:
2401
Description:
Enables several functions, including SMAD binding activity; peroxisome proliferator activated receptor binding activity; and transcription coactivator binding activity. Involved in several processes, including behavioral response to cocaine; long-term memory; and positive regulation of cell adhesion molecule production. Located in nuclear body. Part of transcription regulator complex. Biomarker of alcohol use disorder. Human ortholog(s) of this gene implicated in Rubinstein-Taybi syndrome; acute lymphoblastic leukemia; and acute myeloid leukemia. Orthologous to human CREBBP (CREB binding protein); PARTICIPATES IN aldosterone signaling pathway; androgen signaling pathway; cortisol signaling pathway; INTERACTS WITH 1-[(4-chlorophenyl)-phenylmethyl]-4-methylpiperazine; 17beta-estradiol; 2,2',4,4'-Tetrabromodiphenyl ether.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
CBP; Creb binding protein (CBP); CREB-binding protein; histone lysine acetyltransferase CREBBP; protein-lysine acetyltransferase CREBBP; RSTS; RTS
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CREBBP (CREB binding protein) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):
Crebbp (CREB binding protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Crebbp (CREB binding protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CREBBP (CREB binding protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CREBBP (CREB binding protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Crebbp (CREB binding protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CREBBP (CREB binding protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CREBBP (CREB binding protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Crebbp (CREB binding protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
NHP2 (NHP2 ribonucleoprotein) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
CREBBP (CREB binding protein)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Crebbp (CREB binding protein)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
crebbpb (CREB binding protein b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
crebbpa (CREB binding protein a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
cbp-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
nej
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
crebbp
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
phf5a
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Is Marker For:
Strains:
SD
Candidate Gene For:
Alc5 Alc9
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 11,842,307 - 11,968,266 (+) NCBI GRCr8 mRatBN7.2 10 11,335,551 - 11,461,888 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 11,335,953 - 11,461,888 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 16,043,424 - 16,169,884 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 15,532,272 - 15,658,715 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 11,201,637 - 11,327,626 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 11,590,994 - 11,721,039 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 11,595,044 - 11,721,039 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 10,349,914 - 10,475,506 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 11,598,680 - 11,724,122 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 11,598,679 - 11,724,107 (+) NCBI Celera 10 10,292,190 - 10,418,453 (+) NCBI Celera Cytogenetic Map 10 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Crebbp Rat (-)-anisomycin increases expression ISO CREBBP (Homo sapiens) 6480464 Anisomycin results in increased expression of CREBBP mRNA CTD PMID:24247028 Crebbp Rat (-)-epigallocatechin 3-gallate increases expression ISO CREBBP (Homo sapiens) 6480464 epigallocatechin gallate results in increased expression of CREBBP protein CTD PMID:31195006 Crebbp Rat (S)-nicotine increases expression ISO Crebbp (Mus musculus) 6480464 Nicotine results in increased expression of CREBBP mRNA CTD PMID:31945395 Crebbp Rat 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane increases activity ISO CREBBP (Homo sapiens) 6480464 o and p'-DDT results in increased activity of CREBBP protein CTD PMID:22609851 Crebbp Rat 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane multiple interactions ISO CREBBP (Homo sapiens) 6480464 o more ... CTD PMID:22609851 Crebbp Rat 1,2-dimethylhydrazine decreases expression ISO Crebbp (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of CREBBP mRNA CTD PMID:22206623 Crebbp Rat 1-[(4-chlorophenyl)-phenylmethyl]-4-methylpiperazine decreases expression EXP 6480464 chlorcyclizine results in decreased expression of CREBBP mRNA CTD PMID:21058326 Crebbp Rat 17beta-estradiol multiple interactions ISO CREBBP (Homo sapiens) 6480464 CREBBP mutant form inhibits the reaction [Estradiol inhibits the reaction [TNF protein results in increased expression of IL6 mRNA]] more ... CTD PMID:16417649 more ... Crebbp Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of CREBBP mRNA CTD PMID:20068009 and PMID:32145629 Crebbp Rat 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one multiple interactions ISO CREBBP (Homo sapiens) 6480464 [Metribolone binds to and affects the folding of AR protein] promotes the reaction [AR protein modified form binds to CREBBP protein modified form] more ... CTD PMID:11981028 more ... Crebbp Rat 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one decreases expression ISO CREBBP (Homo sapiens) 6480464 Metribolone results in decreased expression of CREBBP mRNA and Metribolone results in decreased expression of CREBBP protein CTD PMID:15378487 Crebbp Rat 17beta-hydroxy-5alpha-androstan-3-one multiple interactions ISO CREBBP (Homo sapiens) 6480464 Curcumin inhibits the reaction [Dihydrotestosterone promotes the reaction [CREBBP protein binds to KLK3 enhancer]] and Dihydrotestosterone promotes the reaction [CREBBP protein binds to KLK3 enhancer] CTD PMID:22258452 Crebbp Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression EXP 6480464 2 more ... CTD PMID:31826744 Crebbp Rat 2,2-(2-Chlorophenyl-4'-chlorophenyl)-1,1-dichloroethene increases activity ISO CREBBP (Homo sapiens) 6480464 2 more ... CTD PMID:22609851 Crebbp Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Crebbp (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of CREBBP mRNA CTD PMID:21570461 and PMID:24058054 Crebbp Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of CREBBP mRNA CTD PMID:34747641 Crebbp Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of CREBBP mRNA CTD PMID:32109520 Crebbp Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Crebbp (Mus musculus) 6480464 Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to CREBBP promoter] CTD PMID:19654925 Crebbp Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Crebbp (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of CREBBP mRNA CTD PMID:19465110 Crebbp Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO CREBBP (Homo sapiens) 6480464 Tetrachlorodibenzodioxin promotes the reaction [CREBBP protein binds to CYP1A1 promoter] CTD PMID:15964790 Crebbp Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Crebbp Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of CREBBP mRNA CTD PMID:21346803 Crebbp Rat 2-acetamidofluorene decreases expression EXP 6480464 2-Acetylaminofluorene results in decreased expression of CREBBP mRNA CTD PMID:22213190 Crebbp Rat 2-Hydroxy-6-(8,11,14-pentadecatrienyl)benzoic acid decreases activity ISO Crebbp (Mus musculus) 6480464 anacardic acid results in decreased activity of CREBBP protein CTD PMID:31927229 Crebbp Rat 2-tert-butylhydroquinone multiple interactions ISO CREBBP (Homo sapiens) 6480464 1 more ... CTD PMID:21443188 Crebbp Rat 3',5'-cyclic AMP multiple interactions ISO CREBBP (Homo sapiens) 6480464 CREBBP protein promotes the reaction [Cyclic AMP results in increased activity of ESR1 protein] CTD PMID:20360387 Crebbp Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Crebbp (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of CREBBP mRNA CTD PMID:26251327 Crebbp Rat 4,4'-sulfonyldiphenol multiple interactions ISO CREBBP (Homo sapiens) 6480464 [bisphenol S binds to and affects the folding of AR protein] affects the reaction [AR protein modified form binds to CREBBP protein modified form] and bisphenol S inhibits the reaction [ESR1 protein binds to CREBBP protein] CTD PMID:28751236 and PMID:29389661 Crebbp Rat 4,4'-sulfonyldiphenol decreases expression ISO Crebbp (Mus musculus) 6480464 bisphenol S results in decreased expression of CREBBP mRNA CTD PMID:39298647 Crebbp Rat 4-hydroxynon-2-enal multiple interactions EXP 6480464 CREBBP protein inhibits the reaction [4-hydroxy-2-nonenal results in decreased expression of BDNF mRNA] CTD PMID:16337876 Crebbp Rat 5-aza-2'-deoxycytidine decreases expression ISO Crebbp (Mus musculus) 6480464 Decitabine results in decreased expression of CREBBP mRNA CTD PMID:27915011 Crebbp Rat acetylsalicylic acid increases expression ISO CREBBP (Homo sapiens) 6480464 Aspirin results in increased expression of CREBBP mRNA CTD PMID:11906190 Crebbp Rat acrolein multiple interactions EXP 6480464 CREBBP protein inhibits the reaction [Acrolein results in decreased expression of BDNF mRNA] CTD PMID:16337876 Crebbp Rat aflatoxin B1 decreases methylation ISO CREBBP (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of CREBBP intron CTD PMID:30157460 Crebbp Rat aldosterone multiple interactions EXP 6480464 Aldosterone promotes the reaction [NR3C2 protein binds to CREBBP protein] and Aldosterone results in increased expression of and results in increased localization of CREBBP protein CTD PMID:19966502 Crebbp Rat all-trans-retinoic acid multiple interactions ISO CREBBP (Homo sapiens) 6480464 Tretinoin inhibits the reaction [[CREBBP protein binds to MAPK3 promoter] which affects the expression of MAPK3 mRNA] more ... CTD PMID:16050810 more ... Crebbp Rat all-trans-retinoic acid increases expression ISO CREBBP (Homo sapiens) 6480464 Tretinoin results in increased expression of CREBBP mRNA CTD PMID:28053092 Crebbp Rat all-trans-retinoic acid multiple interactions ISO Crebbp (Mus musculus) 6480464 Tretinoin inhibits the reaction [CREBBP protein binds to RETN promoter] CTD PMID:15047602 Crebbp Rat allethrin multiple interactions EXP 6480464 [Allethrins co-treated with cyhalothrin co-treated with cypermethrin co-treated with decamethrin co-treated with fenvalerate] affects the expression of CREBBP mRNA and [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in decreased expression of CREBBP mRNA CTD PMID:33051911 more ... Crebbp Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of CREBBP mRNA CTD PMID:38685447 Crebbp Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of CREBBP mRNA CTD PMID:16483693 Crebbp Rat Ammothamnine multiple interactions ISO Crebbp (Mus musculus) 6480464 oxymatrine inhibits the reaction [Carbon Tetrachloride results in increased expression of CREBBP mRNA] CTD PMID:18395914 Crebbp Rat androst-4-ene-3,17-dione increases activity ISO CREBBP (Homo sapiens) 6480464 Androstenedione results in increased activity of CREBBP protein CTD PMID:16467117 Crebbp Rat aripiprazole decreases expression EXP 6480464 Aripiprazole results in decreased expression of CREBBP mRNA CTD PMID:17868501 Crebbp Rat arsane affects methylation ISO CREBBP (Homo sapiens) 6480464 Arsenic affects the methylation of CREBBP gene CTD PMID:25304211 Crebbp Rat arsane multiple interactions ISO Crebbp (Mus musculus) 6480464 [Arsenic inhibits the reaction [EZH2 protein binds to TNF promoter]] promotes the reaction [[CREBBP protein binds to TNF promoter] which results in increased expression of TNF protein] CTD PMID:39098089 Crebbp Rat arsane increases expression ISO CREBBP (Homo sapiens) 6480464 Arsenic results in increased expression of CREBBP mRNA CTD PMID:28242323 Crebbp Rat arsenic atom affects methylation ISO CREBBP (Homo sapiens) 6480464 Arsenic affects the methylation of CREBBP gene CTD PMID:25304211 Crebbp Rat arsenic atom multiple interactions ISO Crebbp (Mus musculus) 6480464 [Arsenic inhibits the reaction [EZH2 protein binds to TNF promoter]] promotes the reaction [[CREBBP protein binds to TNF promoter] which results in increased expression of TNF protein] CTD PMID:39098089 Crebbp Rat arsenic atom increases expression ISO CREBBP (Homo sapiens) 6480464 Arsenic results in increased expression of CREBBP mRNA CTD PMID:28242323 Crebbp Rat arsenite(3-) multiple interactions ISO CREBBP (Homo sapiens) 6480464 3-(4-methylphenylsulfonyl)-2-propenenitrile promotes the reaction [arsenite promotes the reaction [TP53 protein binds to CREBBP protein]] more ... CTD PMID:20199942 more ... Crebbp Rat arsenite(3-) increases acetylation ISO CREBBP (Homo sapiens) 6480464 arsenite results in increased acetylation of CREBBP protein CTD PMID:33097607 Crebbp Rat arsenous acid decreases expression ISO Crebbp (Mus musculus) 6480464 Arsenic Trioxide results in decreased expression of CREBBP mRNA CTD PMID:24831965 Crebbp Rat arsenous acid multiple interactions ISO CREBBP (Homo sapiens) 6480464 Arsenic Trioxide promotes the reaction [[CREBBP protein binds to CDKN1A promoter] which results in increased expression of CDKN1A mRNA] more ... CTD PMID:18822310 Crebbp Rat aurantio-obtusin increases phosphorylation ISO CREBBP (Homo sapiens) 6480464 aurantio-obtusin results in increased phosphorylation of CREBBP protein CTD PMID:35995123 Crebbp Rat azoxystrobin decreases expression ISO CREBBP (Homo sapiens) 6480464 azoxystrobin results in decreased expression of CREBBP mRNA CTD PMID:33512557 Crebbp Rat BAPTA multiple interactions ISO CREBBP (Homo sapiens) 6480464 1 more ... CTD PMID:21443188 Crebbp Rat benzo[a]pyrene multiple interactions ISO Crebbp (Mus musculus) 6480464 Benzo(a)pyrene promotes the reaction [AHR protein binds to CREBBP promoter] CTD PMID:19654925 Crebbp Rat benzo[a]pyrene affects methylation ISO CREBBP (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of CREBBP intron and Benzo(a)pyrene affects the methylation of CREBBP promoter CTD PMID:27901495 and PMID:30157460 Crebbp Rat benzo[a]pyrene increases methylation ISO CREBBP (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of CREBBP 3' UTR CTD PMID:27901495 Crebbp Rat benzo[a]pyrene diol epoxide I decreases expression ISO CREBBP (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Crebbp Rat berberine increases expression ISO CREBBP (Homo sapiens) 6480464 Berberine results in increased expression of CREBBP mRNA CTD PMID:27311644 Crebbp Rat beta-lapachone increases expression ISO CREBBP (Homo sapiens) 6480464 beta-lapachone results in increased expression of CREBBP mRNA CTD PMID:38218311 Crebbp Rat bezafibrate multiple interactions ISO CREBBP (Homo sapiens) 6480464 Bezafibrate affects the reaction [PPARA protein binds to CREBBP protein] CTD PMID:19263263 Crebbp Rat bicalutamide multiple interactions ISO CREBBP (Homo sapiens) 6480464 bicalutamide inhibits the reaction [Metribolone results in decreased expression of CREBBP protein] CTD PMID:15378487 Crebbp Rat bis(2-ethylhexyl) phthalate decreases expression ISO Crebbp (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of CREBBP mRNA CTD PMID:33754040 Crebbp Rat bisphenol A multiple interactions ISO CREBBP (Homo sapiens) 6480464 [bisphenol A binds to and affects the folding of AR protein] inhibits the reaction [AR protein modified form binds to CREBBP protein modified form] more ... CTD PMID:24533973 more ... Crebbp Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CREBBP mRNA CTD PMID:32145629 Crebbp Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of CREBBP mRNA CTD PMID:30816183 and PMID:34947998 Crebbp Rat bisphenol A affects methylation ISO Crebbp (Mus musculus) 6480464 bisphenol A affects the methylation of CREBBP promoter CTD PMID:27334623 Crebbp Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of CREBBP mRNA CTD PMID:25181051 Crebbp Rat bisphenol AF multiple interactions ISO CREBBP (Homo sapiens) 6480464 [bisphenol AF binds to and affects the folding of AR protein] promotes the reaction [AR protein modified form binds to CREBBP protein modified form] and bisphenol AF inhibits the reaction [ESR1 protein binds to CREBBP protein] CTD PMID:28751236 and PMID:29389661 Crebbp Rat bisphenol F increases expression ISO Crebbp (Mus musculus) 6480464 bisphenol F results in increased expression of CREBBP mRNA CTD PMID:38685157 Crebbp Rat bortezomib decreases expression ISO CREBBP (Homo sapiens) 6480464 Bortezomib results in decreased expression of CREBBP mRNA CTD PMID:25913414 Crebbp Rat bucladesine multiple interactions ISO CREBBP (Homo sapiens) 6480464 [Doxycycline co-treated with Bucladesine co-treated with GDNF protein] affects the reaction [CREBBP protein binds to NR4A1 promoter] more ... CTD PMID:20685861 and PMID:36565944 Crebbp Rat bucladesine multiple interactions ISO Crebbp (Mus musculus) 6480464 [Bucladesine promotes the reaction [CREB1 protein modified form binds to STAR promoter]] promotes the reaction [CREBBP protein binds to STAR promoter] and CREBBP protein promotes the reaction [CREB1 protein promotes the reaction [Tetradecanoylphorbol Acetate promotes the reaction [Bucladesine results in increased expression of STAR mRNA]]] CTD PMID:19282384 Crebbp Rat butanal decreases expression ISO CREBBP (Homo sapiens) 6480464 butyraldehyde results in decreased expression of CREBBP mRNA CTD PMID:26079696 Crebbp Rat butyric acid increases expression ISO Crebbp (Mus musculus) 6480464 Butyric Acid results in increased expression of CREBBP mRNA CTD PMID:22687346 Crebbp Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of CREBBP mRNA CTD PMID:19167457 Crebbp Rat cadmium atom multiple interactions ISO CREBBP (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of CREBBP mRNA CTD PMID:35301059 Crebbp Rat cadmium dichloride multiple interactions ISO CREBBP (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of CREBBP mRNA CTD PMID:35301059 Crebbp Rat caffeine decreases phosphorylation ISO CREBBP (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of CREBBP protein CTD PMID:35688186 Crebbp Rat calcitriol affects localization ISO Crebbp (Mus musculus) 6480464 Calcitriol affects the localization of CREBBP protein CTD PMID:15647825 Crebbp Rat calcitriol multiple interactions ISO Crebbp (Mus musculus) 6480464 Calcitriol promotes the reaction [CREBBP protein binds to CYP24A1 promoter] and Calcitriol promotes the reaction [CREBBP protein binds to SPP1 promoter] CTD PMID:15647825 Crebbp Rat calyculin a increases phosphorylation ISO CREBBP (Homo sapiens) 6480464 calyculin A results in increased phosphorylation of CREBBP protein CTD PMID:22142222 Crebbp Rat camptothecin multiple interactions EXP 6480464 Camptothecin inhibits the reaction [RELA protein binds to CREBBP protein] more ... CTD PMID:13679428 Crebbp Rat carbon nanotube decreases expression ISO Crebbp (Mus musculus) 6480464 Nanotubes and Carbon results in decreased expression of CREBBP mRNA CTD PMID:25554681 Crebbp Rat cefaloridine decreases expression EXP 6480464 Cephaloridine results in decreased expression of CREBBP mRNA CTD PMID:18500788 Crebbp Rat chaetocin multiple interactions EXP 6480464 chaetocin inhibits the reaction [Dronabinol results in decreased expression of CREBBP mRNA] CTD PMID:29022873 and PMID:29481316 Crebbp Rat chloroprene decreases expression EXP 6480464 Chloroprene results in decreased expression of CREBBP mRNA CTD PMID:23125180 Crebbp Rat chlorpyrifos decreases expression ISO Crebbp (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of CREBBP mRNA CTD PMID:37019170 Crebbp Rat choline multiple interactions ISO Crebbp (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of CREBBP gene CTD PMID:20938992 Crebbp Rat chromium atom multiple interactions ISO CREBBP (Homo sapiens) 6480464 Chromium affects the reaction [JUN protein binds to CREBBP protein] and Chromium inhibits the reaction [RELA protein binds to CREBBP protein] CTD PMID:10593907 Crebbp Rat chromium(6+) decreases expression EXP 6480464 chromium hexavalent ion results in decreased expression of CREBBP protein CTD PMID:32679048 Crebbp Rat chromium(6+) multiple interactions ISO CREBBP (Homo sapiens) 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in increased expression of CREBBP mRNA CTD PMID:38479592 Crebbp Rat ciglitazone multiple interactions ISO CREBBP (Homo sapiens) 6480464 ciglitazone inhibits the reaction [CREBBP protein binds to EGFR promoter] more ... CTD PMID:21080969 Crebbp Rat ciglitazone affects response to substance ISO CREBBP (Homo sapiens) 6480464 CREBBP affects the susceptibility to ciglitazone CTD PMID:21080969 Crebbp Rat cisplatin multiple interactions ISO CREBBP (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of CREBBP mRNA and [Cisplatin co-treated with Quercetin] results in increased expression of CREBBP mRNA CTD PMID:27392435 and PMID:27514524 Crebbp Rat cisplatin decreases expression ISO CREBBP (Homo sapiens) 6480464 Cisplatin results in decreased expression of CREBBP mRNA and Cisplatin results in decreased expression of CREBBP protein CTD PMID:17498666 and PMID:27594783 Crebbp Rat clobetasol decreases expression ISO Crebbp (Mus musculus) 6480464 Clobetasol results in decreased expression of CREBBP mRNA CTD PMID:27462272 Crebbp Rat clofibrate multiple interactions ISO CREBBP (Homo sapiens) 6480464 Clofibrate inhibits the reaction [CREBBP protein binds to EGFR promoter] more ... CTD PMID:21080969 Crebbp Rat clofibrate affects response to substance ISO CREBBP (Homo sapiens) 6480464 CREBBP affects the susceptibility to Clofibrate CTD PMID:21080969 Crebbp Rat cobalt dichloride multiple interactions ISO CREBBP (Homo sapiens) 6480464 [cobaltous chloride results in increased activity of SRC protein] promotes the reaction [[[HIF1A protein binds to STAT3 protein modified form] which binds to VEGFA promoter] binds to [APEX1 protein binds to CREBBP promoter]] CTD PMID:15735682 Crebbp Rat cocaine increases expression EXP 6480464 Cocaine results in increased expression of CREBBP mRNA CTD PMID:17898221 Crebbp Rat colforsin daropate hydrochloride multiple interactions ISO CREBBP (Homo sapiens) 6480464 Colforsin promotes the reaction [GCM1 protein binds to CREBBP protein] and CREBBP protein affects the reaction [Colforsin results in increased activity of GCM1 protein] CTD PMID:16166624 Crebbp Rat copper atom decreases expression EXP 6480464 Copper results in decreased expression of CREBBP mRNA CTD PMID:22465980 Crebbp Rat copper atom multiple interactions ISO CREBBP (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of CREBBP mRNA CTD PMID:30911355 Crebbp Rat copper(0) decreases expression EXP 6480464 Copper results in decreased expression of CREBBP mRNA CTD PMID:22465980 Crebbp Rat copper(0) multiple interactions ISO CREBBP (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of CREBBP mRNA CTD PMID:30911355 Crebbp Rat copper(II) sulfate increases expression ISO CREBBP (Homo sapiens) 6480464 Copper Sulfate results in increased expression of CREBBP mRNA CTD PMID:19549813 Crebbp Rat corticosterone multiple interactions ISO Crebbp (Mus musculus) 6480464 2-(3 more ... CTD PMID:22850435 Crebbp Rat corticosterone decreases expression ISO Crebbp (Mus musculus) 6480464 Corticosterone results in decreased expression of CREBBP protein CTD PMID:22850435 Crebbp Rat curcumin multiple interactions ISO CREBBP (Homo sapiens) 6480464 Curcumin inhibits the reaction [Dihydrotestosterone promotes the reaction [CREBBP protein binds to KLK3 enhancer]] CTD PMID:22258452 Crebbp Rat cyhalothrin multiple interactions EXP 6480464 [Allethrins co-treated with cyhalothrin co-treated with cypermethrin co-treated with decamethrin co-treated with fenvalerate] affects the expression of CREBBP mRNA and [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in decreased expression of CREBBP mRNA CTD PMID:33051911 more ... Crebbp Rat cypermethrin multiple interactions EXP 6480464 [Allethrins co-treated with cyhalothrin co-treated with cypermethrin co-treated with decamethrin co-treated with fenvalerate] affects the expression of CREBBP mRNA and [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in decreased expression of CREBBP mRNA CTD PMID:33051911 more ... Crebbp Rat cyproterone acetate multiple interactions ISO CREBBP (Homo sapiens) 6480464 [Cyproterone Acetate binds to and affects the folding of AR protein] promotes the reaction [AR protein modified form binds to CREBBP protein modified form] more ... CTD PMID:15308689 and PMID:28751236 Crebbp Rat DDD increases activity ISO CREBBP (Homo sapiens) 6480464 Dichlorodiphenyldichloroethane results in increased activity of CREBBP protein CTD PMID:22609851 Crebbp Rat DDE increases activity ISO CREBBP (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in increased activity of CREBBP protein CTD PMID:22609851 and PMID:27589886 Crebbp Rat DDT increases activity ISO CREBBP (Homo sapiens) 6480464 DDT results in increased activity of CREBBP protein CTD PMID:22609851 Crebbp Rat deoxynivalenol increases expression ISO CREBBP (Homo sapiens) 6480464 deoxynivalenol results in increased expression of CREBBP mRNA CTD PMID:24247028 Crebbp Rat diarsenic trioxide decreases expression ISO Crebbp (Mus musculus) 6480464 Arsenic Trioxide results in decreased expression of CREBBP mRNA CTD PMID:24831965 Crebbp Rat diarsenic trioxide multiple interactions ISO CREBBP (Homo sapiens) 6480464 Arsenic Trioxide promotes the reaction [[CREBBP protein binds to CDKN1A promoter] which results in increased expression of CDKN1A mRNA] more ... CTD PMID:18822310 Crebbp Rat Dibutyl phosphate affects expression ISO CREBBP (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of CREBBP mRNA CTD PMID:37042841 Crebbp Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of CREBBP mRNA CTD PMID:21266533 Crebbp Rat dicrotophos increases expression ISO CREBBP (Homo sapiens) 6480464 dicrotophos results in increased expression of CREBBP mRNA CTD PMID:28302478 Crebbp Rat diethylstilbestrol multiple interactions ISO CREBBP (Homo sapiens) 6480464 Diethylstilbestrol promotes the reaction [CREBBP protein binds to EZH2 promoter] more ... CTD PMID:24533973 more ... Crebbp Rat dinophysistoxin 1 increases expression ISO CREBBP (Homo sapiens) 6480464 dinophysistoxin 1 results in increased expression of CREBBP mRNA CTD PMID:28939011 Crebbp Rat dioxygen increases expression ISO Crebbp (Mus musculus) 6480464 Oxygen deficiency results in increased expression of CREBBP mRNA CTD PMID:22629407 Crebbp Rat dioxygen multiple interactions ISO Crebbp (Mus musculus) 6480464 Oxygen inhibits the reaction [Oxygen deficiency results in increased expression of CREBBP mRNA] CTD PMID:22629407 Crebbp Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of CREBBP mRNA CTD PMID:21551480 Crebbp Rat dorsomorphin multiple interactions ISO CREBBP (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of CREBBP mRNA CTD PMID:27188386 Crebbp Rat doxorubicin multiple interactions ISO CREBBP (Homo sapiens) 6480464 Doxorubicin promotes the reaction [CREBBP protein binds to ESR1 promoter] and Doxorubicin promotes the reaction [TP53 protein binds to CREBBP protein] CTD PMID:19351845 Crebbp Rat doxorubicin decreases expression EXP 6480464 Doxorubicin results in decreased expression of CREBBP mRNA CTD PMID:28865727 Crebbp Rat doxorubicin decreases expression ISO CREBBP (Homo sapiens) 6480464 Doxorubicin results in decreased expression of CREBBP protein CTD PMID:17498666 Crebbp Rat doxycycline multiple interactions ISO CREBBP (Homo sapiens) 6480464 [Doxycycline co-treated with Bucladesine co-treated with GDNF protein] affects the reaction [CREBBP protein binds to NR4A1 promoter] and methylmercuric chloride affects the reaction [[Doxycycline co-treated with Bucladesine co-treated with GDNF protein] affects the reaction [CREBBP protein binds to NR4A1 promoter]] CTD PMID:36565944 Crebbp Rat elemental selenium decreases expression ISO CREBBP (Homo sapiens) 6480464 Selenium results in decreased expression of CREBBP mRNA CTD PMID:19244175 Crebbp Rat enzalutamide affects expression ISO CREBBP (Homo sapiens) 6480464 enzalutamide affects the expression of CREBBP mRNA CTD PMID:30940724 Crebbp Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of CREBBP mRNA CTD PMID:20655511 Crebbp Rat ethanol multiple interactions EXP 6480464 N-methyl-N-(6-methoxy-1-phenyl-1 more ... CTD PMID:20655511 Crebbp Rat ethylene glycol bis(2-aminoethyl)tetraacetic acid multiple interactions ISO CREBBP (Homo sapiens) 6480464 Egtazic Acid inhibits the reaction [2-tert-butylhydroquinone promotes the reaction [CREBBP protein binds to NFE2L2 protein]] CTD PMID:21443188 Crebbp Rat fenthion increases expression ISO Crebbp (Mus musculus) 6480464 Fenthion results in increased expression of CREBBP mRNA CTD PMID:34813904 Crebbp Rat fenvalerate multiple interactions EXP 6480464 [Allethrins co-treated with cyhalothrin co-treated with cypermethrin co-treated with decamethrin co-treated with fenvalerate] affects the expression of CREBBP mRNA and [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in decreased expression of CREBBP mRNA CTD PMID:33051911 more ... Crebbp Rat folic acid multiple interactions ISO Crebbp (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of CREBBP gene CTD PMID:20938992 Crebbp Rat folpet increases expression ISO Crebbp (Mus musculus) 6480464 folpet results in increased expression of CREBBP mRNA CTD PMID:31558096 Crebbp Rat formaldehyde decreases expression ISO CREBBP (Homo sapiens) 6480464 Formaldehyde results in decreased expression of CREBBP mRNA CTD PMID:20655997 Crebbp Rat FR900359 affects phosphorylation ISO CREBBP (Homo sapiens) 6480464 FR900359 affects the phosphorylation of CREBBP protein CTD PMID:37730182 Crebbp Rat fulvestrant multiple interactions ISO CREBBP (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of CREBBP gene more ... CTD PMID:18511507 more ... Crebbp Rat fulvestrant multiple interactions EXP 6480464 fulvestrant inhibits the reaction [FSHB protein promotes the reaction [ESR1 protein binds to CREBBP protein]] CTD PMID:18511507 Crebbp Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of CREBBP mRNA CTD PMID:22061828 Crebbp Rat hydrogen peroxide decreases expression EXP 6480464 Hydrogen Peroxide results in decreased expression of CREBBP mRNA CTD PMID:24349266 Crebbp Rat ibrutinib decreases response to substance ISO CREBBP (Homo sapiens) 6480464 CREBBP protein mutant form results in decreased susceptibility to ibrutinib CTD PMID:26254443 Crebbp Rat inulin multiple interactions ISO Crebbp (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of CREBBP mRNA CTD PMID:36331819 Crebbp Rat irinotecan decreases expression ISO CREBBP (Homo sapiens) 6480464 Irinotecan analog results in decreased expression of CREBBP mRNA more ... CTD PMID:15956246 and PMID:18927307 Crebbp Rat KT 5823 multiple interactions ISO Crebbp (Mus musculus) 6480464 KT 5823 inhibits the reaction [2-(3 more ... CTD PMID:22850435 Crebbp Rat L-methionine multiple interactions ISO Crebbp (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of CREBBP gene CTD PMID:20938992 Crebbp Rat leflunomide increases expression EXP 6480464 leflunomide results in increased expression of CREBBP mRNA CTD PMID:24136188 Crebbp Rat linoleic acid multiple interactions ISO CREBBP (Homo sapiens) 6480464 Linoleic Acid affects the reaction [PPARA protein binds to CREBBP protein] CTD PMID:19263263 Crebbp Rat lipopolysaccharide multiple interactions ISO CREBBP (Homo sapiens) 6480464 Amino Acids more ... CTD PMID:22003094 Crebbp Rat lipopolysaccharide decreases expression ISO Crebbp (Mus musculus) 6480464 Lipopolysaccharides results in decreased expression of CREBBP mRNA CTD PMID:15919760 and PMID:16847310 Crebbp Rat medroxyprogesterone acetate multiple interactions ISO CREBBP (Homo sapiens) 6480464 Medroxyprogesterone Acetate promotes the reaction [CREBBP protein binds to SOD2 promoter] CTD PMID:20685861 Crebbp Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of CREBBP mRNA CTD PMID:30467583 Crebbp Rat methylmercury chloride affects expression EXP 6480464 methylmercuric chloride affects the expression of CREBBP mRNA CTD PMID:20864626 Crebbp Rat methylmercury chloride multiple interactions ISO CREBBP (Homo sapiens) 6480464 methylmercuric chloride affects the reaction [[Doxycycline co-treated with Bucladesine co-treated with GDNF protein] affects the reaction [CREBBP protein binds to NR4A1 promoter]] CTD PMID:36565944 Crebbp Rat mifepristone multiple interactions ISO CREBBP (Homo sapiens) 6480464 [Mifepristone binds to AR protein] promotes the reaction [CREBBP protein binds to KLK3 enhancer] and [Mifepristone binds to AR protein] promotes the reaction [CREBBP protein binds to KLK3 promoter] CTD PMID:15308689 Crebbp Rat Mitotane increases activity ISO CREBBP (Homo sapiens) 6480464 Mitotane results in increased activity of CREBBP protein CTD PMID:22609851 Crebbp Rat mono(2-ethylhexyl) phthalate decreases expression ISO CREBBP (Homo sapiens) 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of CREBBP mRNA CTD PMID:38685446 Crebbp Rat monosodium L-glutamate decreases expression EXP 6480464 Sodium Glutamate results in decreased expression of CREBBP mRNA CTD PMID:28954212 Crebbp Rat N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine multiple interactions ISO CREBBP (Homo sapiens) 6480464 N more ... CTD PMID:16579968 Crebbp Rat N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide multiple interactions ISO Crebbp (Mus musculus) 6480464 N-(2-(4-bromocinnamylamino)ethyl)-5-isoquinolinesulfonamide inhibits the reaction [Sodium Oxybate results in increased phosphorylation of CREBBP protein] CTD PMID:16675135 Crebbp Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions ISO Crebbp (Mus musculus) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [Valproic Acid results in decreased expression of CREBBP protein] CTD PMID:27381264 Crebbp Rat niclosamide increases expression ISO CREBBP (Homo sapiens) 6480464 Niclosamide results in increased expression of CREBBP mRNA CTD PMID:22576131 Crebbp Rat nicotine increases expression ISO Crebbp (Mus musculus) 6480464 Nicotine results in increased expression of CREBBP mRNA CTD PMID:31945395 Crebbp Rat o-anisidine increases expression ISO CREBBP (Homo sapiens) 6480464 2-anisidine results in increased expression of CREBBP mRNA CTD PMID:28089782 Crebbp Rat okadaic acid increases phosphorylation ISO CREBBP (Homo sapiens) 6480464 Okadaic Acid results in increased phosphorylation of CREBBP protein CTD PMID:16059639 Crebbp Rat okadaic acid increases expression ISO CREBBP (Homo sapiens) 6480464 Okadaic Acid results in increased expression of CREBBP mRNA CTD PMID:28939011 Crebbp Rat oleic acid decreases expression EXP 6480464 Oleic Acid results in decreased expression of CREBBP mRNA CTD PMID:24349266 Crebbp Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of CREBBP mRNA CTD PMID:25729387 Crebbp Rat ozone multiple interactions ISO Crebbp (Mus musculus) 6480464 [Air Pollutants results in increased abundance of Ozone] which results in increased expression of CREBBP mRNA CTD PMID:27106289 Crebbp Rat paracetamol affects expression ISO Crebbp (Mus musculus) 6480464 Acetaminophen affects the expression of CREBBP mRNA CTD PMID:17562736 Crebbp Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of CREBBP protein CTD PMID:20478973 Crebbp Rat paraquat decreases expression ISO CREBBP (Homo sapiens) 6480464 Paraquat results in decreased expression of CREBBP mRNA CTD PMID:28619522 Crebbp Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Crebbp (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of CREBBP mRNA CTD PMID:36331819 Crebbp Rat phenobarbital affects expression ISO CREBBP (Homo sapiens) 6480464 Phenobarbital affects the expression of CREBBP mRNA CTD PMID:19159669 Crebbp Rat phenobarbital decreases expression ISO Crebbp (Mus musculus) 6480464 Phenobarbital results in decreased expression of CREBBP mRNA CTD PMID:23091169 Crebbp Rat phenylephrine multiple interactions EXP 6480464 [Phenylephrine results in increased activity of CREBBP protein] which results in increased expression of NPPA protein more ... CTD PMID:11705990 more ... Crebbp Rat phenylephrine increases response to substance EXP 6480464 CREBBP protein results in increased susceptibility to Phenylephrine CTD PMID:12477714 Crebbp Rat phlorizin decreases expression ISO Crebbp (Mus musculus) 6480464 Phlorhizin results in decreased expression of CREBBP mRNA CTD PMID:22538082 Crebbp Rat phorbol 13-acetate 12-myristate multiple interactions ISO Crebbp (Mus musculus) 6480464 [Tetradecanoylphorbol Acetate promotes the reaction [CREB1 protein modified form binds to STAR promoter]] promotes the reaction [CREBBP protein binds to STAR promoter] more ... CTD PMID:16474181 more ... Crebbp Rat pifithrin-alpha hydrobromide multiple interactions EXP 6480464 pifithrin inhibits the reaction [Camptothecin inhibits the reaction [RELA protein binds to CREBBP protein]] more ... CTD PMID:13679428 Crebbp Rat pirinixic acid multiple interactions ISO CREBBP (Homo sapiens) 6480464 pirinixic acid affects the reaction [PPARA protein binds to CREBBP protein] CTD PMID:19263263 Crebbp Rat propanal decreases expression ISO CREBBP (Homo sapiens) 6480464 propionaldehyde results in decreased expression of CREBBP mRNA CTD PMID:26079696 Crebbp Rat propiconazole decreases expression ISO Crebbp (Mus musculus) 6480464 propiconazole results in decreased expression of CREBBP mRNA CTD PMID:21278054 Crebbp Rat pyrethrins decreases expression EXP 6480464 Pyrethrins results in decreased expression of CREBBP mRNA CTD PMID:34896426 Crebbp Rat quercetin multiple interactions ISO Crebbp (Mus musculus) 6480464 Quercetin inhibits the reaction [CREBBP protein binds to CXCL10 promoter] more ... CTD PMID:17449583 and PMID:21857970 Crebbp Rat quercetin multiple interactions EXP 6480464 Quercetin inhibits the reaction [Air Pollutants and Occupational results in decreased expression of CREBBP mRNA] CTD PMID:37467934 Crebbp Rat quercetin affects activity EXP 6480464 Quercetin affects the activity of CREBBP modified form CTD PMID:19423323 Crebbp Rat quercetin increases expression ISO CREBBP (Homo sapiens) 6480464 Quercetin results in increased expression of CREBBP mRNA CTD PMID:14715546 Crebbp Rat quercetin decreases expression ISO CREBBP (Homo sapiens) 6480464 Quercetin results in decreased expression of CREBBP protein CTD PMID:15580028 Crebbp Rat quercetin multiple interactions ISO CREBBP (Homo sapiens) 6480464 [Cisplatin co-treated with Quercetin] results in increased expression of CREBBP mRNA CTD PMID:27514524 Crebbp Rat raloxifene multiple interactions ISO CREBBP (Homo sapiens) 6480464 Raloxifene Hydrochloride promotes the reaction [CREBBP protein binds to IGF1 promoter] and Raloxifene Hydrochloride promotes the reaction [CREBBP protein binds to PTGS2 promoter] CTD PMID:17872375 Crebbp Rat resveratrol multiple interactions ISO CREBBP (Homo sapiens) 6480464 BCL2 protein inhibits the reaction [resveratrol promotes the reaction [PML protein binds to CREBBP protein]] more ... CTD PMID:19631782 and PMID:24771768 Crebbp Rat resveratrol multiple interactions EXP 6480464 resveratrol inhibits the reaction [CREBBP protein results in increased acetylation of FOXO1 protein] CTD PMID:19740748 Crebbp Rat resveratrol multiple interactions ISO Crebbp (Mus musculus) 6480464 resveratrol inhibits the reaction [Tetradecanoylphorbol Acetate promotes the reaction [CREBBP protein binds to RELA protein]] CTD PMID:16474181 Crebbp Rat resveratrol increases expression ISO CREBBP (Homo sapiens) 6480464 resveratrol results in increased expression of CREBBP mRNA CTD PMID:15149879 Crebbp Rat rotenone increases expression ISO Crebbp (Mus musculus) 6480464 Rotenone results in increased expression of CREBBP mRNA CTD PMID:21536665 Crebbp Rat rotenone decreases expression ISO CREBBP (Homo sapiens) 6480464 Rotenone results in decreased expression of CREBBP mRNA CTD PMID:33512557 Crebbp Rat S-butyl-DL-homocysteine (S,R)-sulfoximine multiple interactions EXP 6480464 [Buthionine Sulfoximine results in increased phosphorylation of STAT3 protein] promotes the reaction [CREBBP protein results in increased acetylation of STAT3 protein modified form] CTD PMID:19289167 Crebbp Rat SB 203580 multiple interactions ISO CREBBP (Homo sapiens) 6480464 SB 203580 inhibits the reaction [o and p'-DDT results in increased activity of CREBBP protein] CTD PMID:22609851 Crebbp Rat SB 431542 multiple interactions ISO CREBBP (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of CREBBP mRNA CTD PMID:27188386 Crebbp Rat selenium atom decreases expression ISO CREBBP (Homo sapiens) 6480464 Selenium results in decreased expression of CREBBP mRNA CTD PMID:19244175 Crebbp Rat sodium arsenite increases expression ISO Crebbp (Mus musculus) 6480464 sodium arsenite results in increased expression of CREBBP mRNA CTD PMID:19822182 Crebbp Rat sodium arsenite increases expression ISO CREBBP (Homo sapiens) 6480464 sodium arsenite results in increased expression of CREBBP mRNA CTD PMID:38568856 Crebbp Rat sodium arsenite multiple interactions ISO Crebbp (Mus musculus) 6480464 [DOT1L protein affects the susceptibility to sodium arsenite] which results in decreased expression of CREBBP mRNA CTD PMID:30130555 Crebbp Rat sodium arsenite decreases expression ISO CREBBP (Homo sapiens) 6480464 sodium arsenite results in decreased expression of CREBBP mRNA CTD PMID:12377979 Crebbp Rat sodium dodecyl sulfate increases expression ISO CREBBP (Homo sapiens) 6480464 Sodium Dodecyl Sulfate results in increased expression of CREBBP mRNA CTD PMID:31734321 Crebbp Rat sodium fluoride increases acetylation ISO Crebbp (Mus musculus) 6480464 Sodium Fluoride results in increased acetylation of CREBBP protein CTD PMID:31927229 Crebbp Rat sodium fluoride multiple interactions ISO Crebbp (Mus musculus) 6480464 Sodium Fluoride promotes the reaction [TRP53 protein binds to CREBBP protein] CTD PMID:31927229 Crebbp Rat Soman decreases expression EXP 6480464 Soman results in decreased expression of CREBBP mRNA CTD PMID:19281266 Crebbp Rat streptozocin decreases expression EXP 6480464 Streptozocin results in decreased expression of CREBBP mRNA CTD PMID:25905778 Crebbp Rat succimer multiple interactions ISO Crebbp (Mus musculus) 6480464 [Succimer co-treated with Magnetite Nanoparticles] results in decreased expression of CREBBP mRNA CTD PMID:26378955 Crebbp Rat temozolomide increases expression ISO CREBBP (Homo sapiens) 6480464 Temozolomide results in increased expression of CREBBP mRNA CTD PMID:31758290 Crebbp Rat testosterone increases expression ISO CREBBP (Homo sapiens) 6480464 Testosterone results in increased expression of CREBBP mRNA CTD PMID:21880219 Crebbp Rat tetrachloromethane increases expression ISO Crebbp (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of CREBBP mRNA CTD PMID:18395914 Crebbp Rat tetrachloromethane multiple interactions ISO Crebbp (Mus musculus) 6480464 oxymatrine inhibits the reaction [Carbon Tetrachloride results in increased expression of CREBBP mRNA] CTD PMID:18395914 Crebbp Rat thapsigargin increases expression ISO CREBBP (Homo sapiens) 6480464 Thapsigargin results in increased expression of CREBBP mRNA CTD PMID:24247028 Crebbp Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of CREBBP mRNA CTD PMID:34492290 Crebbp Rat thiram increases expression ISO CREBBP (Homo sapiens) 6480464 Thiram results in increased expression of CREBBP mRNA CTD PMID:38568856 Crebbp Rat titanium dioxide decreases methylation ISO Crebbp (Mus musculus) 6480464 titanium dioxide results in decreased methylation of CREBBP gene and titanium dioxide results in decreased methylation of CREBBP promoter CTD PMID:35295148 Crebbp Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of CREBBP mRNA CTD PMID:25729387 Crebbp Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of CREBBP mRNA CTD PMID:25729387 Crebbp Rat Tributyltin oxide increases expression ISO CREBBP (Homo sapiens) 6480464 bis(tri-n-butyltin)oxide results in increased expression of CREBBP mRNA CTD PMID:24247028 Crebbp Rat trichostatin A multiple interactions ISO CREBBP (Homo sapiens) 6480464 trichostatin A promotes the reaction [CREBBP protein binds to PDK4 promoter] CTD PMID:16757381 Crebbp Rat triphenyl phosphate affects expression ISO CREBBP (Homo sapiens) 6480464 triphenyl phosphate affects the expression of CREBBP mRNA CTD PMID:37042841 Crebbp Rat triptonide decreases expression ISO Crebbp (Mus musculus) 6480464 triptonide results in decreased expression of CREBBP mRNA CTD PMID:33045310 Crebbp Rat troglitazone multiple interactions ISO CREBBP (Homo sapiens) 6480464 RXRA protein inhibits the reaction [CREBBP protein results in increased susceptibility to troglitazone] CTD PMID:15581905 Crebbp Rat troglitazone decreases expression ISO Crebbp (Mus musculus) 6480464 troglitazone results in decreased expression of CREBBP mRNA CTD PMID:28973697 Crebbp Rat troglitazone increases response to substance EXP 6480464 CREBBP protein results in increased susceptibility to troglitazone CTD PMID:15581905 Crebbp Rat urethane increases expression ISO CREBBP (Homo sapiens) 6480464 Urethane results in increased expression of CREBBP mRNA CTD PMID:28818685 Crebbp Rat ursodeoxycholic acid decreases expression EXP 6480464 Ursodeoxycholic Acid results in decreased expression of CREBBP mRNA CTD PMID:19493473 Crebbp Rat valproic acid decreases expression ISO Crebbp (Mus musculus) 6480464 Valproic Acid results in decreased expression of CREBBP mRNA and Valproic Acid results in decreased expression of CREBBP protein CTD PMID:19136453 more ... Crebbp Rat valproic acid multiple interactions ISO Crebbp (Mus musculus) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [Valproic Acid results in decreased expression of CREBBP protein] CTD PMID:27381264 Crebbp Rat valproic acid multiple interactions ISO CREBBP (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of CREBBP mRNA CTD PMID:27188386 Crebbp Rat valproic acid decreases expression ISO CREBBP (Homo sapiens) 6480464 Valproic Acid results in decreased expression of CREBBP mRNA CTD PMID:19101580 more ... Crebbp Rat valproic acid increases methylation ISO CREBBP (Homo sapiens) 6480464 Valproic Acid results in increased methylation of CREBBP gene CTD PMID:29154799 Crebbp Rat valproic acid affects expression ISO CREBBP (Homo sapiens) 6480464 Valproic Acid affects the expression of CREBBP mRNA CTD PMID:25979313 Crebbp Rat valproic acid decreases methylation ISO CREBBP (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of CREBBP gene CTD PMID:28853863 and PMID:29201983 Crebbp Rat vincristine increases expression ISO CREBBP (Homo sapiens) 6480464 Vincristine results in increased expression of CREBBP mRNA CTD PMID:23649840 Crebbp Rat vitamin E decreases expression ISO CREBBP (Homo sapiens) 6480464 Vitamin E results in decreased expression of CREBBP mRNA CTD PMID:19244175 Crebbp Rat vorinostat multiple interactions ISO CREBBP (Homo sapiens) 6480464 vorinostat promotes the reaction [PML protein binds to CREBBP protein] and vorinostat promotes the reaction [TP53 protein binds to PML protein binds to CREBBP protein] CTD PMID:19631782 Crebbp Rat zinc atom multiple interactions ISO Crebbp (Mus musculus) 6480464 Zinc promotes the reaction [MTF1 protein binds to EP300 protein binds to CREBBP protein] CTD PMID:18458062 Crebbp Rat zinc(0) multiple interactions ISO Crebbp (Mus musculus) 6480464 Zinc promotes the reaction [MTF1 protein binds to EP300 protein binds to CREBBP protein] CTD PMID:18458062
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(-)-anisomycin (ISO) (-)-epigallocatechin 3-gallate (ISO) (S)-nicotine (ISO) 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (ISO) 1,2-dimethylhydrazine (ISO) 1-[(4-chlorophenyl)-phenylmethyl]-4-methylpiperazine (EXP) 17beta-estradiol (EXP,ISO) 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,2-(2-Chlorophenyl-4'-chlorophenyl)-1,1-dichloroethene (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,6-dinitrotoluene (EXP) 2-acetamidofluorene (EXP) 2-Hydroxy-6-(8,11,14-pentadecatrienyl)benzoic acid (ISO) 2-tert-butylhydroquinone (ISO) 3',5'-cyclic AMP (ISO) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxynon-2-enal (EXP) 5-aza-2'-deoxycytidine (ISO) acetylsalicylic acid (ISO) acrolein (EXP) aflatoxin B1 (ISO) aldosterone (EXP) all-trans-retinoic acid (ISO) allethrin (EXP) amitrole (EXP) ammonium chloride (EXP) Ammothamnine (ISO) androst-4-ene-3,17-dione (ISO) aripiprazole (EXP) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) aurantio-obtusin (ISO) azoxystrobin (ISO) BAPTA (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) berberine (ISO) beta-lapachone (ISO) bezafibrate (ISO) bicalutamide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) bisphenol F (ISO) bortezomib (ISO) bucladesine (ISO) butanal (ISO) butyric acid (ISO) C60 fullerene (EXP) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) calcitriol (ISO) calyculin a (ISO) camptothecin (EXP) carbon nanotube (ISO) cefaloridine (EXP) chaetocin (EXP) chloroprene (EXP) chlorpyrifos (ISO) choline (ISO) chromium atom (ISO) chromium(6+) (EXP,ISO) ciglitazone (ISO) cisplatin (ISO) clobetasol (ISO) clofibrate (ISO) cobalt dichloride (ISO) cocaine (EXP) colforsin daropate hydrochloride (ISO) copper atom (EXP,ISO) copper(0) (EXP,ISO) copper(II) sulfate (ISO) corticosterone (ISO) curcumin (ISO) cyhalothrin (EXP) cypermethrin (EXP) cyproterone acetate (ISO) DDD (ISO) DDE (ISO) DDT (ISO) deoxynivalenol (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP) dicrotophos (ISO) diethylstilbestrol (ISO) dinophysistoxin 1 (ISO) dioxygen (ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (EXP,ISO) doxycycline (ISO) elemental selenium (ISO) enzalutamide (ISO) ethanol (EXP) ethylene glycol bis(2-aminoethyl)tetraacetic acid (ISO) fenthion (ISO) fenvalerate (EXP) folic acid (ISO) folpet (ISO) formaldehyde (ISO) FR900359 (ISO) fulvestrant (EXP,ISO) gentamycin (EXP) hydrogen peroxide (EXP) ibrutinib (ISO) inulin (ISO) irinotecan (ISO) KT 5823 (ISO) L-methionine (ISO) leflunomide (EXP) linoleic acid (ISO) lipopolysaccharide (ISO) medroxyprogesterone acetate (ISO) methapyrilene (EXP) methylmercury chloride (EXP,ISO) mifepristone (ISO) Mitotane (ISO) mono(2-ethylhexyl) phthalate (ISO) monosodium L-glutamate (EXP) N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (ISO) N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) niclosamide (ISO) nicotine (ISO) o-anisidine (ISO) okadaic acid (ISO) oleic acid (EXP) oxaliplatin (EXP) ozone (ISO) paracetamol (ISO) paraquat (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) phenylephrine (EXP) phlorizin (ISO) phorbol 13-acetate 12-myristate (ISO) pifithrin-alpha hydrobromide (EXP) pirinixic acid (ISO) propanal (ISO) propiconazole (ISO) pyrethrins (EXP) quercetin (EXP,ISO) raloxifene (ISO) resveratrol (EXP,ISO) rotenone (ISO) S-butyl-DL-homocysteine (S,R)-sulfoximine (EXP) SB 203580 (ISO) SB 431542 (ISO) selenium atom (ISO) sodium arsenite (ISO) sodium dodecyl sulfate (ISO) sodium fluoride (ISO) Soman (EXP) streptozocin (EXP) succimer (ISO) temozolomide (ISO) testosterone (ISO) tetrachloromethane (ISO) thapsigargin (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) topotecan (EXP) Tributyltin oxide (ISO) trichostatin A (ISO) triphenyl phosphate (ISO) triptonide (ISO) troglitazone (EXP,ISO) urethane (ISO) ursodeoxycholic acid (EXP) valproic acid (ISO) vincristine (ISO) vitamin E (ISO) vorinostat (ISO) zinc atom (ISO) zinc(0) (ISO)
Biological Process
behavioral response to cocaine (IMP) canonical NF-kappaB signal transduction (ISO) cellular response to hepatocyte growth factor stimulus (ISO) cellular response to nutrient levels (ISO) cellular response to UV (ISO,ISS) cellular response to virus (ISO) chromatin remodeling (IEA) face morphogenesis (ISO) germ-line stem cell population maintenance (ISO) long-term memory (IMP) N-terminal peptidyl-lysine acetylation (ISO) negative regulation of interferon-beta production (ISO) negative regulation of transcription by RNA polymerase I (ISO,ISS) negative regulation of transcription by RNA polymerase II (ISO) negative regulation of viral process (ISO) positive regulation of cell adhesion molecule production (IMP) positive regulation of CREB transcription factor activity (ISO) positive regulation of dendritic spine development (IMP) positive regulation of DNA-templated transcription (ISO,ISS) positive regulation of double-strand break repair via homologous recombination (ISO,ISS) positive regulation of G1/S transition of mitotic cell cycle (IMP) positive regulation of gene expression (ISO) positive regulation of non-canonical NF-kappaB signal transduction (IMP) positive regulation of protein localization to nucleus (ISO) positive regulation of transcription by RNA polymerase II (IBA,IEA,IMP,ISO) positive regulation of transforming growth factor beta receptor signaling pathway (ISO) protein acetylation (ISO) protein destabilization (ISO,ISS) protein modification process (IDA) regulation of DNA-templated transcription (IDA,IEA,ISO) response to interleukin-1 (IEP) response to ischemia (IEP) rhythmic process (IEA)
Molecular Function
acetyltransferase activity (ISO,ISS) acyltransferase activity (IEA) cAMP response element binding protein binding (ISO) chromatin binding (ISO,ISS) chromatin DNA binding (IBA) damaged DNA binding (ISO,ISS) disordered domain specific binding (ISO) DNA binding (ISO) DNA-binding transcription factor binding (IEA,IPI,ISO) histone acetyltransferase activity (IBA,IDA,IEA,ISO,ISS) histone H3K18 acetyltransferase activity (ISO,ISS) histone H3K27 acetyltransferase activity (ISO,ISS) metal ion binding (IEA) molecular adaptor activity (ISO) MRF binding (ISO,ISS) p53 binding (ISO) peptide lactyltransferase (CoA-dependent) activity (IEA,ISO,ISS) peroxisome proliferator activated receptor binding (IDA) protein binding (IPI,ISO) protein domain specific binding (ISO) protein-containing complex binding (IPI) protein-lysine-acetyltransferase activity (IEA,ISO) RNA polymerase II transcription regulatory region sequence-specific DNA binding (ISO) RNA polymerase II-specific DNA-binding transcription factor binding (ISO) SMAD binding (IPI) TFIIB-class transcription factor binding (ISO) transcription coactivator activity (IBA,IEA,ISO,TAS) transcription coactivator binding (IPI,ISO) transcription coregulator activity (IEA) transcription corepressor activity (ISO) transferase activity (IEA) zinc ion binding (IEA,ISO)
1.
FISH studies in 45 patients with Rubinstein-Taybi syndrome: deletions associated with polysplenia, hypoplastic left heart and death in infancy.
Bartsch O, etal., Eur J Hum Genet. 1999 Oct-Nov;7(7):748-56.
2.
DNA sequencing of CREBBP demonstrates mutations in 56% of patients with Rubinstein-Taybi syndrome (RSTS) and in another patient with incomplete RSTS.
Bartsch O, etal., Hum Genet. 2005 Sep;117(5):485-93. Epub 2005 Jul 14.
3.
Transcriptional regulation by p53.
Beckerman R and Prives C, Cold Spring Harb Perspect Biol. 2010 Aug;2(8):a000935. doi: 10.1101/cshperspect.a000935. Epub 2010 Apr 28.
4.
CBP gene transfer increases BDNF levels and ameliorates learning and memory deficits in a mouse model of Alzheimer's disease.
Caccamo A, etal., Proc Natl Acad Sci U S A. 2010 Dec 28;107(52):22687-92. doi: 10.1073/pnas.1012851108. Epub 2010 Dec 13.
5.
ZFP36 protects lungs from intestinal I/R-induced injury and fibrosis through the CREBBP/p53/p21/Bax pathway.
Cao Y, etal., Cell Death Dis. 2021 Jul 8;12(7):685. doi: 10.1038/s41419-021-03950-y.
6.
Down-regulation of CREB-binding protein expression blocks thrombin-mediated endothelial activation by inhibiting acetylation of NF-kappaB.
Chen J, etal., Int J Cardiol. 2012 Jan 26;154(2):147-52. doi: 10.1016/j.ijcard.2010.09.003. Epub 2010 Oct 5.
7.
Dysregulation of CREB binding protein triggers thrombin-induced proliferation of vascular smooth muscle cells.
Chen J, etal., Mol Cell Biochem. 2008 Aug;315(1-2):123-30. Epub 2008 May 23.
8.
Androgen receptor coregulators and their involvement in the development and progression of prostate cancer.
Chmelar R, etal., Int J Cancer. 2007 Feb 15;120(4):719-33.
9.
Age-related changes in CREB binding protein immunoreactivity in the cerebral cortex and hippocampus of rats.
Chung YH, etal., Brain Res 2002 Nov 29;956(2):312-8.
10.
Mutant huntingtin represses CBP, but not p300, by binding and protein degradation.
Cong SY, etal., Mol Cell Neurosci. 2005 Dec;30(4):560-71.
11.
A comparison of molecular alterations in environmental and genetic rat models of ADHD: a pilot study.
DasBanerjee T, etal., Am J Med Genet B Neuropsychiatr Genet. 2008 Dec 5;147B(8):1554-63.
12.
Transcriptional coactivators CBP and p300 cooperatively enhance HNF-1alpha-mediated expression of the albumin gene in hepatocytes.
Dohda T, etal., J Biochem (Tokyo). 2004 Sep;136(3):313-9.
13.
Transcriptional coactivators CBP and p300 cooperatively enhance HNF-1alpha-mediated expression of the albumin gene in hepatocytes.
Dohda T, etal., J Biochem. 2004 Sep;136(3):313-9.
14.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
15.
Phosphodiesterase type IV inhibition prevents sequestration of CREB binding protein, protects striatal parvalbumin interneurons and rescues motor deficits in the R6/2 mouse model of Huntington's disease.
Giampa C, etal., Eur J Neurosci. 2009 Mar;29(5):902-10. doi: 10.1111/j.1460-9568.2009.06649.x.
16.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
17.
Wnt signaling: multiple pathways, multiple receptors, and multiple transcription factors.
Gordon MD and Nusse R, J Biol Chem. 2006 Aug 11;281(32):22429-33. Epub 2006 Jun 22.
18.
The nucleolus-guardian of cellular homeostasis and genome integrity.
Grummt I Chromosoma. 2013 Dec;122(6):487-97.
19.
The transcriptional co-activators CREB-binding protein (CBP) and p300 play a critical role in cardiac hypertrophy that is dependent on their histone acetyltransferase activity.
Gusterson RJ, etal., J Biol Chem 2003 Feb 28;278(9):6838-47. Epub 2002 Dec 10.
20.
Coregulators in nuclear estrogen receptor action: from concept to therapeutic targeting.
Hall JM and McDonnell DP, Mol Interv. 2005 Dec;5(6):343-57.
21.
The Nrf2 regulatory network provides an interface between redox and intermediary metabolism.
Hayes JD and Dinkova-Kostova AT, Trends Biochem Sci. 2014 Apr;39(4):199-218. doi: 10.1016/j.tibs.2014.02.002. Epub 2014 Mar 16.
22.
Novel glucocorticoid receptor coactivator effector mechanisms.
Jenkins BD, etal., Trends Endocrinol Metab. 2001 Apr;12(3):122-6.
23.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
24.
Partial depletion of CREB-binding protein reduces life expectancy in a mouse model of Huntington disease.
Klevytska AM, etal., J Neuropathol Exp Neurol. 2010 Apr;69(4):396-404. doi: 10.1097/NEN.0b013e3181d6c436.
25.
Modes of p53 regulation.
Kruse JP and Gu W, Cell. 2009 May 15;137(4):609-22. doi: 10.1016/j.cell.2009.04.050.
26.
Gene dose-dependent control of hematopoiesis and hematologic tumor suppression by CBP.
Kung AL, etal., Genes Dev 2000 Feb 1;14(3):272-7.
27.
cAMP inhibits transforming growth factor-beta-stimulated collagen synthesis via inhibition of extracellular signal-regulated kinase 1/2 and Smad signaling in cardiac fibroblasts.
Liu X, etal., Mol Pharmacol. 2006 Dec;70(6):1992-2003. Epub 2006 Sep 7.
28.
HIF-1 and HIF-2 transcription factors--similar but not identical.
Loboda A, etal., Mol Cells. 2010 May;29(5):435-42. Epub 2010 Apr 12.
29.
Evidence of Abeta- and transgene-dependent defects in ERK-CREB signaling in Alzheimer's models.
Ma QL, etal., J Neurochem. 2007 Nov;103(4):1594-607. Epub 2007 Aug 30.
30.
KRAS and CREBBP mutations: a relapse-linked malicious liaison in childhood high hyperdiploid acute lymphoblastic leukemia.
Malinowska-Ozdowy K, etal., Leukemia. 2015 Aug;29(8):1656-67. doi: 10.1038/leu.2015.107. Epub 2015 Apr 28.
31.
Smad transcription factors.
Massagué J, etal., Genes Dev. 2005 Dec 1;19(23):2783-810.
32.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
33.
Major intestinal coactivator p300 strongly activates peroxisome proliferator-activated receptor in intestinal cell line, Caco-2.
Mochizuki K, etal., Gene 2002 May 29;291(1-2):271-7.
34.
Nuclear receptor coactivators modulate hormone-dependent gene expression in brain and female reproductive behavior in rats.
Molenda HA, etal., Endocrinology 2002 Feb;143(2):436-44.
35.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
36.
Interference by huntingtin and atrophin-1 with cbp-mediated transcription leading to cellular toxicity.
Nucifora FC, etal., Science. 2001 Mar 23;291(5512):2423-8.
37.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
38.
Genomic characterization of MOZ/CBP and CBP/MOZ chimeras in acute myeloid leukemia suggests the involvement of a damage-repair mechanism in the origin of the t(8;16)(p11;p13).
Panagopoulos I, etal., Genes Chromosomes Cancer 2003 Jan;36(1):90-8.
39.
In vitro acetylation of HMGB-1 and -2 proteins by CBP: the role of the acidic tail.
Pasheva E, etal., Biochemistry 2004 Mar 16;43(10):2935-40.
40.
Physical and functional HAT/HDAC interplay regulates protein acetylation balance.
Peserico A and Simone C, J Biomed Biotechnol. 2011;2011:371832. doi: 10.1155/2011/371832. Epub 2010 Dec 5.
41.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
42.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
43.
The calcium-responsive transactivator recruits CREB binding protein to nuclear bodies.
Pradhan A and Liu Y, Neurosci Lett. 2004 Nov 11;370(2-3):191-5.
44.
Cocaine self-administration in rats lacking a functional trpc4 gene.
Rasmus KC, etal., F1000Res. 2013 Apr 17;2:110. doi: 10.12688/f1000research.2-110.v1. eCollection 2013.
45.
GOA pipeline
RGD automated data pipeline
46.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
47.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
48.
How the Smads regulate transcription.
Ross S and Hill CS, Int J Biochem Cell Biol. 2008;40(3):383-408. Epub 2007 Oct 7.
49.
CREB-binding protein (CREBBP) and preeclampsia: a new promising target gene.
Sadeghi H, etal., Mol Biol Rep. 2021 Mar;48(3):2117-2122. doi: 10.1007/s11033-021-06215-1. Epub 2021 Feb 24.
50.
Combinatorial control of the bradykinin B2 receptor promoter by p53, CREB, KLF-4, and CBP: implications for terminal nephron differentiation.
Saifudeen Z, etal., Am J Physiol Renal Physiol. 2005 May;288(5):F899-909. Epub 2005 Jan 4.
51.
The bromodomain: From epigenome reader to druggable target.
Sanchez R, etal., Biochim Biophys Acta. 2014 Aug;1839(8):676-685. doi: 10.1016/j.bbagrm.2014.03.011. Epub 2014 Mar 28.
52.
Regulation of oxygen homeostasis by hypoxia-inducible factor 1.
Semenza GL Physiology (Bethesda). 2009 Apr;24:97-106.
53.
Effects of mitogen-activated protein kinase pathway and co-activator CREP-binding protein on peroxisome proliferator-activated receptor-gamma-mediated transcription suppression of angiotensin II type 1 receptor gene.
Sugawara A, etal., Hypertens Res 2003 Aug;26(8):623-8.
54.
Development of a CRISPR-SaCas9 system for projection- and function-specific gene editing in the rat brain.
Sun H, etal., Sci Adv. 2020 Mar 18;6(12):eaay6687. doi: 10.1126/sciadv.aay6687. eCollection 2020 Mar.
55.
Interleukin-1beta induces CREB-binding protein (CBP) mRNA in brain and the sequencing of rat CBP.
Tang C, etal., Brain Res Mol Brain Res. 2005 Jun 13;137(1-2):213-22. Epub 2005 Apr 25.
56.
Interactions of the mineralocorticoid receptor--within and without.
Yang J and Fuller PJ, Mol Cell Endocrinol. 2012 Mar 24;350(2):196-205. doi: 10.1016/j.mce.2011.07.001. Epub 2011 Jul 18.
57.
MicroRNA-22 targeting CBP protects against myocardial ischemia-reperfusion injury through anti-apoptosis in rats.
Yang J, etal., Mol Biol Rep. 2014 Jan;41(1):555-61. doi: 10.1007/s11033-013-2891-x. Epub 2013 Dec 12.
58.
TOX3 regulates calcium-dependent transcription in neurons.
Yuan SH, etal., Proc Natl Acad Sci U S A. 2009 Feb 24;106(8):2909-14. doi: 10.1073/pnas.0805555106. Epub 2009 Feb 5.
59.
Adolescent alcohol exposure epigenetically regulates CREB signaling in the adult amygdala.
Zhang H, etal., Sci Rep. 2018 Jul 10;8(1):10376. doi: 10.1038/s41598-018-28415-9.
60.
Activation of the cyclic AMP response element-binding protein signaling pathway in the olfactory bulb is required for the acquisition of olfactory aversive learning in young rats.
Zhang JJ, etal., Neuroscience 2003;117(3):707-13.
Crebbp Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 11,842,307 - 11,968,266 (+) NCBI GRCr8 mRatBN7.2 10 11,335,551 - 11,461,888 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 11,335,953 - 11,461,888 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 16,043,424 - 16,169,884 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 15,532,272 - 15,658,715 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 11,201,637 - 11,327,626 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 11,590,994 - 11,721,039 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 11,595,044 - 11,721,039 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 10,349,914 - 10,475,506 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 11,598,680 - 11,724,122 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 11,598,679 - 11,724,107 (+) NCBI Celera 10 10,292,190 - 10,418,453 (+) NCBI Celera Cytogenetic Map 10 q12 NCBI
CREBBP Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 16 3,725,054 - 3,880,713 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 16 3,725,054 - 3,880,713 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 16 3,775,055 - 3,930,714 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 16 3,715,056 - 3,870,122 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 16 3,716,569 - 3,870,712 NCBI Celera 16 3,981,749 - 4,136,789 (-) NCBI Celera Cytogenetic Map 16 p13.3 NCBI HuRef 16 3,743,994 - 3,898,607 (-) NCBI HuRef CHM1_1 16 3,775,055 - 3,930,225 (-) NCBI CHM1_1 T2T-CHM13v2.0 16 3,752,324 - 3,907,918 (-) NCBI T2T-CHM13v2.0
Crebbp Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 16 3,899,198 - 4,031,864 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 16 3,899,192 - 4,031,861 (-) Ensembl GRCm39 Ensembl GRCm38 16 4,081,334 - 4,213,957 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 16 4,081,328 - 4,213,997 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 16 4,084,048 - 4,213,404 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 16 3,999,276 - 4,128,632 (-) NCBI MGSCv36 mm8 Celera 16 4,716,365 - 4,845,799 (-) NCBI Celera Cytogenetic Map 16 A1 NCBI cM Map 16 2.4 NCBI
Crebbp Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955442 13,559,496 - 13,692,004 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955442 13,559,496 - 13,691,913 (+) NCBI ChiLan1.0 ChiLan1.0
CREBBP Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 18 4,251,350 - 4,405,330 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 16 8,033,402 - 8,189,001 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 16 2,645,445 - 2,800,975 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 16 3,820,507 - 3,974,200 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 16 3,820,519 - 3,974,206 (-) Ensembl panpan1.1 panPan2
CREBBP Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 6 37,410,201 - 37,536,688 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 6 37,409,930 - 37,534,176 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 6 38,739,122 - 38,865,694 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 6 37,623,705 - 37,751,833 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 6 37,649,589 - 37,750,377 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 6 37,408,543 - 37,535,100 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 6 37,301,774 - 37,428,236 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 6 37,712,371 - 37,838,937 (+) NCBI UU_Cfam_GSD_1.0
Crebbp
CREBBP Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 38,388,547 - 38,530,224 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 38,388,366 - 38,530,243 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 39,768,553 - 39,798,241 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CREBBP Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 5 3,415,548 - 3,570,030 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 5 3,415,412 - 3,540,943 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666068 27,238,466 - 27,395,063 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Crebbp
.
Predicted Target Of
Count of predictions: 10 Count of miRNA genes: 10 Interacting mature miRNAs: 10 Transcripts: ENSRNOT00000007079 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
2313095 Bss62 Bone structure and strength QTL 62 1.5 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 631660 Hcar1 Hepatocarcinoma resistance QTL 1 3.4 0.0001 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 10 6154182 15990232 Rat 1576304 Schws7 Schwannoma susceptibility QTL 7 0.0115 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 4765527 19816042 Rat 8662860 Vetf10 Vascular elastic tissue fragility QTL 10 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 10 6154182 73453136 Rat 2313066 Bss63 Bone structure and strength QTL 63 1.4 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 10 5387014 50387014 Rat 7411611 Foco17 Food consumption QTL 17 18.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 1 42315980 Rat 631554 Bp133 Blood pressure QTL 133 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 743364 63851208 Rat 2313064 Bmd71 Bone mineral density QTL 71 0.9 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 10 5387014 50387014 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 634329 Pia15 Pristane induced arthritis QTL 15 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 1 24158324 Rat 1578761 Stresp21 Stress response QTL 21 3.3 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 6375746 51375746 Rat 2293680 Bss40 Bone structure and strength QTL 40 5.66 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 10 1 35225947 Rat 7387235 Uae41 Urinary albumin excretion QTL 41 5.26 0.1874 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 10 1 29497586 Rat 2313104 Bss61 Bone structure and strength QTL 61 0.9 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 2298544 Neuinf9 Neuroinflammation QTL 9 4.6 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 10 5801990 62146030 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 10401803 Kidm50 Kidney mass QTL 50 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 10 418344 45418344 Rat 737820 Alc9 Alcohol consumption QTL 9 2.2 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 10 5144027 19233348 Rat 2313081 Bss64 Bone structure and strength QTL 64 1.3 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 10 5387014 50387014 Rat 631828 Alc5 Alcohol consumption QTL 5 2.4 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 10 5144027 17245662 Rat 634327 Hc4 Hypercalciuria QTL 4 2.4 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 10 1 38328221 Rat
RH130099
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 11,461,668 - 11,461,855 (+) MAPPER mRatBN7.2 Rnor_6.0 10 11,720,820 - 11,721,006 NCBI Rnor6.0 Rnor_5.0 10 10,475,287 - 10,475,473 UniSTS Rnor5.0 RGSC_v3.4 10 11,725,312 - 11,725,498 UniSTS RGSC3.4 Celera 10 10,418,234 - 10,418,420 UniSTS Cytogenetic Map 10 q12 UniSTS
AW558298
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 10 11,967,806 - 11,967,895 (+) Marker Load Pipeline mRatBN7.2 10 11,461,429 - 11,461,517 (+) MAPPER mRatBN7.2 Rnor_6.0 10 11,720,581 - 11,720,668 NCBI Rnor6.0 Rnor_5.0 10 10,475,048 - 10,475,135 UniSTS Rnor5.0 RGSC_v3.4 10 11,725,073 - 11,725,160 UniSTS RGSC3.4 Celera 10 10,417,995 - 10,418,082 UniSTS Cytogenetic Map 10 q12 UniSTS
WI-22537
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 11,461,570 - 11,461,852 (+) MAPPER mRatBN7.2 Rnor_6.0 10 11,720,722 - 11,721,003 NCBI Rnor6.0 Rnor_5.0 10 10,475,189 - 10,475,470 UniSTS Rnor5.0 RGSC_v3.4 10 11,725,214 - 11,725,495 UniSTS RGSC3.4 Celera 10 10,418,136 - 10,418,417 UniSTS Cytogenetic Map 10 q12 UniSTS
RH137561
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 11,452,815 - 11,452,979 (+) MAPPER mRatBN7.2 Rnor_6.0 10 11,711,971 - 11,712,134 NCBI Rnor6.0 Rnor_5.0 10 10,466,438 - 10,466,601 UniSTS Rnor5.0 RGSC_v3.4 10 11,716,463 - 11,716,626 UniSTS RGSC3.4 Celera 10 10,409,385 - 10,409,548 UniSTS Cytogenetic Map 10 q12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000007079 ⟹ ENSRNOP00000007079
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 11,335,953 - 11,461,888 (+) Ensembl Rnor_6.0 Ensembl 10 11,595,044 - 11,721,039 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000117260 ⟹ ENSRNOP00000080986
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 11,335,953 - 11,461,888 (+) Ensembl
RefSeq Acc Id:
NM_133381 ⟹ NP_596872
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 11,842,340 - 11,968,266 (+) NCBI mRatBN7.2 10 11,335,953 - 11,461,888 (+) NCBI Rnor_6.0 10 11,595,044 - 11,721,039 (+) NCBI Rnor_5.0 10 10,349,914 - 10,475,506 (+) NCBI RGSC_v3.4 10 11,598,680 - 11,724,122 (+) RGD Celera 10 10,292,190 - 10,418,453 (+) NCBI
Sequence:
GCTGTTTCCGCGAGCAGGTGAAGATGGCCGAGAACTTGCTGGACGGACCGCCCAACCCCAAACGAGCCAAACTCAGCTCGCCCGGCTTCTCCGCGAATGACAGCACAGATTTTGGATCATTGTTTGAC
hide sequence
RefSeq Acc Id:
XM_039086667 ⟹ XP_038942595
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 11,842,307 - 11,968,266 (+) NCBI mRatBN7.2 10 11,335,552 - 11,459,262 (+) NCBI
RefSeq Acc Id:
XM_039086668 ⟹ XP_038942596
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 11,842,307 - 11,968,266 (+) NCBI mRatBN7.2 10 11,335,551 - 11,459,262 (+) NCBI
RefSeq Acc Id:
XM_039086669 ⟹ XP_038942597
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 11,842,307 - 11,968,266 (+) NCBI mRatBN7.2 10 11,335,551 - 11,459,263 (+) NCBI
RefSeq Acc Id:
XM_039086670 ⟹ XP_038942598
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 11,842,307 - 11,968,266 (+) NCBI mRatBN7.2 10 11,335,552 - 11,459,262 (+) NCBI
RefSeq Acc Id:
NP_596872 ⟸ NM_133381
- UniProtKB:
Q6JHU9 (UniProtKB/Swiss-Prot), F1M9G7 (UniProtKB/TrEMBL)
- Sequence:
MAENLLDGPPNPKRAKLSSPGFSANDSTDFGSLFDLENDLPDELIPNGELSLLNSGNLVPDAASKHKQLSELLRGGSGSSITPGIGNVSASSPVQQGLGGQAQGQPNSTSMASLGAMGKSPLNPGDSS
hide sequence
Ensembl Acc Id:
ENSRNOP00000007079 ⟸ ENSRNOT00000007079
RefSeq Acc Id:
XP_038942597 ⟸ XM_039086669
- Peptide Label:
isoform X3
- UniProtKB:
Q6JHU9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_038942596 ⟸ XM_039086668
- Peptide Label:
isoform X2
- UniProtKB:
Q6JHU9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_038942595 ⟸ XM_039086667
- Peptide Label:
isoform X1
- UniProtKB:
Q6JHU9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_038942598 ⟸ XM_039086670
- Peptide Label:
isoform X4
- UniProtKB:
Q6JHU9 (UniProtKB/Swiss-Prot), A0A8I5ZRH6 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000080986 ⟸ ENSRNOT00000117260
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-11-06
Crebbp
CREB binding protein
Creb binding protein (CBP)
Name updated
625702 APPROVED
2002-06-10
Crebbp
Creb binding protein (CBP)
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_disease
upregulated in Rubenstein-Taybi syndrome
70390
gene_expression
expressed in brain
70390
gene_expression
expression decreases in the cerebral cortex and hippocampus of aged rats
1298795
gene_function
nuclear receptor coactivator
70390
gene_process
increases estrogen receptor transcriptional activity and regulates hormone-dependent female sexual behavior
70390
gene_process
may have a role in long-term memory
1298598
