Symbol:
Cpa3
Name:
carboxypeptidase A3
RGD ID:
2390
Description:
Predicted to enable metallocarboxypeptidase activity. Predicted to be involved in angiotensin maturation. Predicted to act upstream of or within regulation of angiotensin levels in blood. Predicted to be located in transport vesicle. Predicted to be active in extracellular space. Orthologous to human CPA3 (carboxypeptidase A3); PARTICIPATES IN renin-angiotensin cascade pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; ammonium chloride.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
carboxypeptidase A3 mast cell; carboxypeptidase A3, mast cell; mast cell carboxypeptidase A; R-CPA; RMC-CP
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CPA3 (carboxypeptidase A3) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Cpa3 (carboxypeptidase A3, mast cell) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Cpa3 (carboxypeptidase A3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CPA3 (carboxypeptidase A3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CPA3 (carboxypeptidase A3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Cpa3 (carboxypeptidase A3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CPA3 (carboxypeptidase A3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CPA3 (carboxypeptidase A3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Cpa3 (carboxypeptidase A3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
CPB1 (carboxypeptidase B1) HGNC
OrthoDB
Alliance orthologs 3
Homo sapiens (human):
CPA3 (carboxypeptidase A3)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Cpa3 (carboxypeptidase A3, mast cell)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG7025
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG8563
Alliance
DIOPT (Ensembl Compara|OMA|PANTHER)
Saccharomyces cerevisiae (baker's yeast):
ECM14
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
T06A4.1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector)
Drosophila melanogaster (fruit fly):
CG18585
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG4017
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG14820
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG17633
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG18417
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA)
Drosophila melanogaster (fruit fly):
CG32379
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA)
Xenopus tropicalis (tropical clawed frog):
cpa3
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 104,641,619 - 104,673,253 (-) NCBI GRCr8 mRatBN7.2 2 102,712,483 - 102,744,219 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 102,712,589 - 102,744,203 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 109,232,601 - 109,264,222 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 107,353,762 - 107,385,392 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 102,306,747 - 102,338,386 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 105,016,798 - 105,047,989 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 105,016,626 - 105,047,984 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 124,745,511 - 124,777,636 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 105,368,835 - 105,402,657 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 105,313,798 - 105,347,605 (-) NCBI Celera 2 98,081,042 - 98,112,943 (-) NCBI Celera RH 3.4 Map 2 729.9 RGD Cytogenetic Map 2 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Cpa3 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO CPA3 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of CPA3 mRNA CTD PMID:22079256 Cpa3 Rat 1,2-dimethylhydrazine increases expression ISO Cpa3 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of CPA3 mRNA CTD PMID:22206623 Cpa3 Rat 17alpha-ethynylestradiol multiple interactions ISO Cpa3 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of CPA3 mRNA CTD PMID:17942748 Cpa3 Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of CPA3 mRNA CTD PMID:26496021 Cpa3 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Cpa3 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of CPA3 mRNA CTD PMID:17942748 Cpa3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of CPA3 mRNA CTD PMID:32109520 Cpa3 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO CPA3 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin inhibits the reaction [Endosulfan results in decreased expression of CPA3 mRNA] CTD PMID:26159488 Cpa3 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Cpa3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of CPA3 mRNA CTD PMID:16120747 and PMID:20159946 Cpa3 Rat 4-hydroxyphenyl retinamide decreases expression ISO Cpa3 (Mus musculus) 6480464 Fenretinide results in decreased expression of CPA3 mRNA CTD PMID:28973697 Cpa3 Rat 5-aza-2'-deoxycytidine increases expression ISO CPA3 (Homo sapiens) 6480464 Decitabine results in increased expression of CPA3 mRNA CTD PMID:19194470 Cpa3 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of CPA3 mRNA CTD PMID:16483693 Cpa3 Rat benzo[a]pyrene increases methylation ISO CPA3 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of CPA3 3' UTR CTD PMID:27901495 Cpa3 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Cpa3 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of CPA3 mRNA CTD PMID:32235866 and PMID:34319233 Cpa3 Rat bisphenol A decreases expression ISO Cpa3 (Mus musculus) 6480464 bisphenol A results in decreased expression of CPA3 mRNA CTD PMID:20739668 Cpa3 Rat bisphenol A increases expression ISO Cpa3 (Mus musculus) 6480464 bisphenol A results in increased expression of CPA3 mRNA CTD PMID:32156529 Cpa3 Rat bisphenol A multiple interactions ISO CPA3 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of CPA3 gene CTD PMID:31601247 Cpa3 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of CPA3 mRNA CTD PMID:33296240 Cpa3 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CPA3 mRNA CTD PMID:25181051 more ... Cpa3 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of CPA3 mRNA CTD PMID:26496021 Cpa3 Rat calcitriol decreases expression ISO CPA3 (Homo sapiens) 6480464 Calcitriol results in decreased expression of CPA3 mRNA CTD PMID:26485663 Cpa3 Rat CGP 52608 multiple interactions ISO CPA3 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to CPA3 gene] CTD PMID:28238834 Cpa3 Rat chromium(6+) affects expression ISO Cpa3 (Mus musculus) 6480464 chromium hexavalent ion affects the expression of CPA3 mRNA CTD PMID:28472532 Cpa3 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of CPA3 mRNA CTD PMID:27523638 Cpa3 Rat Dibutyl phosphate affects expression ISO CPA3 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of CPA3 mRNA CTD PMID:37042841 Cpa3 Rat elemental selenium decreases expression ISO CPA3 (Homo sapiens) 6480464 Selenium results in decreased expression of CPA3 mRNA CTD PMID:19244175 Cpa3 Rat endosulfan decreases expression ISO CPA3 (Homo sapiens) 6480464 Endosulfan results in decreased expression of CPA3 mRNA CTD PMID:26159488 Cpa3 Rat endosulfan multiple interactions ISO CPA3 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin inhibits the reaction [Endosulfan results in decreased expression of CPA3 mRNA] CTD PMID:26159488 Cpa3 Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of CPA3 mRNA CTD PMID:30307764 Cpa3 Rat flavonoids increases expression EXP 6480464 Flavonoids results in increased expression of CPA3 mRNA CTD PMID:18035473 Cpa3 Rat fulvestrant multiple interactions ISO CPA3 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of CPA3 gene CTD PMID:31601247 Cpa3 Rat furan increases expression EXP 6480464 furan results in increased expression of CPA3 mRNA CTD PMID:27387713 Cpa3 Rat genistein decreases expression EXP 6480464 Genistein results in decreased expression of CPA3 mRNA CTD PMID:12075121 Cpa3 Rat genistein decreases expression ISO Cpa3 (Mus musculus) 6480464 Genistein results in decreased expression of CPA3 mRNA CTD PMID:32186404 Cpa3 Rat hexachlorobenzene increases expression EXP 6480464 Hexachlorobenzene results in increased expression of CPA3 mRNA CTD PMID:15159207 Cpa3 Rat naphthalenes increases expression EXP 6480464 Naphthalenes results in increased expression of CPA3 protein CTD PMID:17337753 Cpa3 Rat ozone multiple interactions ISO Cpa3 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of CPA3 mRNA CTD PMID:34911549 Cpa3 Rat paracetamol affects expression ISO Cpa3 (Mus musculus) 6480464 Acetaminophen affects the expression of CPA3 mRNA CTD PMID:17562736 Cpa3 Rat potassium chromate decreases expression ISO CPA3 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of CPA3 mRNA CTD PMID:22079256 Cpa3 Rat potassium chromate multiple interactions ISO CPA3 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of CPA3 mRNA CTD PMID:22079256 Cpa3 Rat potassium dichromate decreases expression ISO Cpa3 (Mus musculus) 6480464 Potassium Dichromate results in decreased expression of CPA3 mRNA CTD PMID:23608068 Cpa3 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of CPA3 mRNA CTD PMID:28374803 Cpa3 Rat selenium atom decreases expression ISO CPA3 (Homo sapiens) 6480464 Selenium results in decreased expression of CPA3 mRNA CTD PMID:19244175 Cpa3 Rat sodium arsenite increases expression ISO Cpa3 (Mus musculus) 6480464 sodium arsenite results in increased expression of CPA3 mRNA CTD PMID:16014739 and PMID:36209798 Cpa3 Rat sodium fluoride decreases expression ISO Cpa3 (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of CPA3 protein CTD PMID:28918527 Cpa3 Rat tetradecane decreases expression EXP 6480464 n-tetradecane results in decreased expression of CPA3 protein CTD PMID:17337753 Cpa3 Rat titanium dioxide decreases expression ISO Cpa3 (Mus musculus) 6480464 titanium dioxide results in decreased expression of CPA3 mRNA CTD PMID:35295148 Cpa3 Rat trichloroethene increases expression ISO Cpa3 (Mus musculus) 6480464 Trichloroethylene results in increased expression of CPA3 mRNA CTD PMID:28973375 Cpa3 Rat trimellitic anhydride decreases expression ISO Cpa3 (Mus musculus) 6480464 trimellitic anhydride results in decreased expression of CPA3 mRNA CTD PMID:19042947 Cpa3 Rat triphenyl phosphate affects expression ISO CPA3 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of CPA3 mRNA CTD PMID:37042841 Cpa3 Rat troglitazone increases expression ISO Cpa3 (Mus musculus) 6480464 troglitazone results in increased expression of CPA3 mRNA CTD PMID:28973697 Cpa3 Rat undecane increases expression EXP 6480464 undecane results in increased expression of CPA3 protein CTD PMID:17337753 Cpa3 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of CPA3 mRNA CTD PMID:23034163
Imported Annotations - KEGG (archival)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
3.
The novel imprinted carboxypeptidase A4 gene ( CPA4) in the 7q32 imprinting domain.
Kayashima T, etal., Hum Genet 2003 Mar;112(3):220-6. Epub 2003 Jan 28.
4.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
5.
Secretory granule proteases in rat mast cells. Cloning of 10 different serine proteases and a carboxypeptidase A from various rat mast cell populations.
Lutzelschwab C, etal., J Exp Med 1997 Jan 6;185(1):13-29.
6.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
7.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
9.
GOA pipeline
RGD automated data pipeline
10.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
Cpa3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 104,641,619 - 104,673,253 (-) NCBI GRCr8 mRatBN7.2 2 102,712,483 - 102,744,219 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 102,712,589 - 102,744,203 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 109,232,601 - 109,264,222 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 107,353,762 - 107,385,392 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 102,306,747 - 102,338,386 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 105,016,798 - 105,047,989 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 105,016,626 - 105,047,984 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 124,745,511 - 124,777,636 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 105,368,835 - 105,402,657 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 105,313,798 - 105,347,605 (-) NCBI Celera 2 98,081,042 - 98,112,943 (-) NCBI Celera RH 3.4 Map 2 729.9 RGD Cytogenetic Map 2 q24 NCBI
CPA3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 148,865,296 - 148,897,203 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 148,865,296 - 148,897,203 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 148,583,083 - 148,614,990 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 150,065,774 - 150,097,552 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 150,065,781 - 150,097,560 NCBI Celera 3 146,993,118 - 147,024,950 (+) NCBI Celera Cytogenetic Map 3 q24 NCBI HuRef 3 145,955,149 - 145,986,993 (+) NCBI HuRef CHM1_1 3 148,545,876 - 148,577,717 (+) NCBI CHM1_1 T2T-CHM13v2.0 3 151,616,046 - 151,647,965 (+) NCBI T2T-CHM13v2.0
Cpa3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 20,269,780 - 20,296,373 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 20,269,784 - 20,296,345 (-) Ensembl GRCm39 Ensembl GRCm38 3 20,215,616 - 20,242,209 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 20,215,620 - 20,242,181 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 20,115,515 - 20,142,080 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 20,407,673 - 20,434,227 (-) NCBI MGSCv36 mm8 Celera 3 20,204,832 - 20,231,395 (-) NCBI Celera Cytogenetic Map 3 A2 NCBI cM Map 3 6.25 NCBI
Cpa3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955474 8,602,958 - 8,626,436 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955474 8,602,958 - 8,626,436 (-) NCBI ChiLan1.0 ChiLan1.0
CPA3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 146,760,053 - 146,793,151 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 146,764,783 - 146,797,881 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 145,889,140 - 145,921,462 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 153,468,252 - 153,500,113 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 153,468,071 - 153,500,333 (+) Ensembl panpan1.1 panPan2
CPA3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 23 43,718,987 - 43,748,335 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 23 43,679,361 - 43,748,213 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 23 43,583,372 - 43,612,478 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 23 44,346,568 - 44,375,767 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 23 44,276,898 - 44,375,642 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 23 43,928,939 - 43,958,267 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 23 43,983,539 - 44,012,801 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 23 44,237,426 - 44,266,751 (+) NCBI UU_Cfam_GSD_1.0
Cpa3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 83,015,494 - 83,041,913 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936519 6,692,513 - 6,718,425 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936519 6,692,466 - 6,718,480 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CPA3
CPA3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 15 41,807,728 - 41,839,889 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 15 41,807,727 - 41,839,819 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 14,650,383 - 14,682,474 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Cpa3
.
Predicted Target Of
Count of predictions: 34 Count of miRNA genes: 31 Interacting mature miRNAs: 32 Transcripts: ENSRNOT00000014970 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1578777 Stresp15 Stress response QTL 15 2 0.05 blood aldosterone amount (VT:0005346) plasma aldosterone level (CMO:0000551) 2 59846005 104846005 Rat 2293671 Bss44 Bone structure and strength QTL 44 10.97 0.0001 lumbar vertebra morphology trait (VT:0010494) lumbar vertebra cortical cross-sectional area (CMO:0001690) 2 43162366 148478373 Rat 1298074 Bp164 Blood pressure QTL 164 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 1598865 Bp296 Blood pressure QTL 296 2.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 81018907 126018907 Rat 1354648 Bp239 Blood pressure QTL 239 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118463 226797303 Rat 1578772 Stresp14 Stress response QTL 14 5 0.001 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 2 82345893 130923501 Rat 1354649 Kidm17 Kidney mass QTL 17 2.9 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 2 81754530 227146641 Rat 2293676 Bmd19 Bone mineral density QTL 19 10.7 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 2 43162366 111362592 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 2293682 Bmd24 Bone mineral density QTL 24 8.9 0.0001 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 2 43162366 111362592 Rat 152025242 Bw191 Body weight QTL 191 3.62 body mass (VT:0001259) 2 38573329 122609194 Rat 1598862 Glom9 Glomerulus QTL 9 3.5 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 2 92337601 137337601 Rat 631198 Cm22 Cardiac mass QTL 22 4.3 0.0008 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 2 76539322 150540526 Rat 1598863 Cm65 Cardiac mass QTL 65 2.3 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 92337601 137337601 Rat 1302794 Stl27 Serum triglyceride level QTL 27 4.4 0.0001 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 2 25413423 143657569 Rat 61465 Bp13 Blood pressure QTL 13 3.3 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 2 76539322 102785628 Rat 1581569 Uae32 Urinary albumin excretion QTL 32 0.0001 urine protein amount (VT:0005160) urine albumin excretion rate (CMO:0000757) 2 78665619 219826953 Rat 61467 Bp14 Blood pressure QTL 14 2.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 43154682 202446871 Rat 70174 BpQTLCluster2 Blood pressure QTL cluster 2 4.24 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 2 40067944 102785628 Rat 1358901 Cm38 Cardiac mass QTL 38 2 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 1331760 Bp206 Blood pressure QTL 206 3.62454 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 56043031 202447032 Rat 2300165 Bmd49 Bone mineral density QTL 49 4.8 0.0001 lumbar vertebra mineral mass (VT:0010511) bone mineral density (CMO:0001226) 2 88862519 133862519 Rat 1358899 Kidm23 Kidney mass QTL 23 3.88 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358908 Bw49 Body weight QTL 49 3.36 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 5684990 Bmd82 Bone mineral density QTL 82 2.8 tibia mineral mass (VT:1000283) bone mineral content (CMO:0001554) 2 59324377 103795077 Rat 2300170 Bmd45 Bone mineral density QTL 45 12.1 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 2 88862519 133862519 Rat 1358910 Kidm27 Kidney mass QTL 27 5.77 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 61355 Bp36 Blood pressure QTL 36 2.9 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 2 5873687 102844969 Rat 1358911 Kidm28 Kidney mass QTL 28 5.42 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358904 Cm39 Cardiac mass QTL 39 2.26 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 7411551 Bw131 Body weight QTL 131 29.6 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 2 67942638 112942638 Rat 1358887 Bw50 Body weight QTL 50 2.39 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 1298080 Bp163 Blood pressure QTL 163 0.02 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118275 202447032 Rat 8662832 Vetf7 Vascular elastic tissue fragility QTL 7 3.5 aorta elastin amount (VT:0003905) aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002) 2 81689826 221035911 Rat 1298085 Bp165 Blood pressure QTL 165 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 2290453 Scl55 Serum cholesterol level QTL 55 2.83 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 2 26917817 136917119 Rat 2299162 Iddm32 Insulin dependent diabetes mellitus QTL 32 2.36 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 2 78665616 143657569 Rat 1358894 Kidm24 Kidney mass QTL 24 4.03 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 2300185 Bmd46 Bone mineral density QTL 46 8.4 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 2 88862519 133862519 Rat 724534 Uae6 Urinary albumin excretion QTL 6 10 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 2 78665619 249053267 Rat 61374 Edpm2 Estrogen-dependent pituitary mass QTL 2 4.42 0.86 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 2 76539322 202447032 Rat 631500 Bp99 Blood pressure QTL 99 2.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 59324719 102755241 Rat 61392 Bp6 Blood pressure QTL 6 7 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 2 80270434 125270434 Rat 1358917 Cm42 Cardiac mass QTL 42 2.82 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 5684996 Bmd85 Bone mineral density QTL 85 4.7 0.024 tibia mineral mass (VT:1000283) bone mineral density (CMO:0001226) 2 59324377 103795077 Rat 1358913 Cm41 Cardiac mass QTL 41 2.73 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 2293835 Kiddil5 Kidney dilation QTL 5 3.8 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 42804607 157142209 Rat 1558653 Prcr1 Prostate cancer resistance QTL 1 5 prostate integrity trait (VT:0010571) area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899) 2 72532993 157142209 Rat 1354622 Kidm16 Kidney mass QTL 16 3 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 2 81754530 222436696 Rat 631266 Bp132 Blood pressure QTL 132 0.0005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 46123260 202447032 Rat 7207808 Bmd89 Bone mineral density QTL 89 4.1 femur strength trait (VT:0010010) femoral neck ultimate force (CMO:0001703) 2 88862519 133862519 Rat 1558648 Smcn1 Smooth muscle cell number QTL 1 0.039 blood vessel smooth muscle cell quantity (VT:0010525) aorta smooth muscle cell count per unit vessel length (CMO:0001646) 2 59134147 127460910 Rat 2293843 Kiddil6 Kidney dilation QTL 6 3.1 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 42804607 182042367 Rat 2306903 Bp336 Blood pressure QTL 336 0.01 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 64366971 109366971 Rat 152025206 Hrtrt23 Heart rate QTL 23 5.98 heart pumping trait (VT:2000009) 2 28484589 169504100 Rat 1354605 Rf48 Renal function QTL 48 2.9 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 2 74786664 206665859 Rat 152025204 Hrtrt22 Heart rate QTL 22 5.6 heart pumping trait (VT:2000009) 2 28484589 169504100 Rat 1354601 Slep1 Serum leptin concentration QTL 1 5.39 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 2 43171017 184114403 Rat 61438 Cia7 Collagen induced arthritis QTL 7 4.6 0.0001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 2 59324377 141596857 Rat 1354603 Bp243 Blood pressure QTL 243 3.9 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 26917817 127469484 Rat
RH94836
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 102,712,656 - 102,712,761 (+) MAPPER mRatBN7.2 Rnor_6.0 2 105,016,868 - 105,016,972 NCBI Rnor6.0 Rnor_5.0 2 124,745,581 - 124,745,685 UniSTS Rnor5.0 RGSC_v3.4 2 105,368,905 - 105,369,009 UniSTS RGSC3.4 Celera 2 98,081,112 - 98,081,216 UniSTS RH 3.4 Map 2 729.9 UniSTS Cytogenetic Map 2 q24 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
37
73
87
86
55
25
55
6
198
85
53
41
48
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000014970 ⟹ ENSRNOP00000014970
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 102,712,589 - 102,744,203 (-) Ensembl Rnor_6.0 Ensembl 2 105,016,626 - 105,047,984 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000100012 ⟹ ENSRNOP00000095188
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 102,712,589 - 102,744,203 (-) Ensembl
RefSeq Acc Id:
NM_019300 ⟹ NP_062173
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 104,641,619 - 104,673,237 (-) NCBI mRatBN7.2 2 102,712,587 - 102,744,203 (-) NCBI Rnor_6.0 2 105,016,798 - 105,047,989 (-) NCBI Rnor_5.0 2 124,745,511 - 124,777,636 (-) NCBI RGSC_v3.4 2 105,368,835 - 105,402,657 (-) RGD Celera 2 98,081,042 - 98,112,943 (-) RGD
Sequence:
CATGAGGTCCTTCTTGCTTATGGGGGTCATCTATTCCACACTTGCAATTGCTCCTGTTCAGTTTGACAGGGAGAAGGTATTCCGTGTGAAACTCCAGGATGAAAAGCAAGCAAGTATCTTGAAGAACT
hide sequence
RefSeq Acc Id:
XM_039102980 ⟹ XP_038958908
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 104,641,619 - 104,673,253 (-) NCBI mRatBN7.2 2 102,712,483 - 102,744,219 (-) NCBI
RefSeq Acc Id:
XM_039102981 ⟹ XP_038958909
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 104,641,619 - 104,673,253 (-) NCBI mRatBN7.2 2 102,712,788 - 102,744,219 (-) NCBI
RefSeq Acc Id:
NP_062173 ⟸ NM_019300
- Peptide Label:
precursor
- UniProtKB:
P97597 (UniProtKB/Swiss-Prot), P21961 (UniProtKB/Swiss-Prot), F1M7S4 (UniProtKB/TrEMBL), A6IHD2 (UniProtKB/TrEMBL)
- Sequence:
MRSFLLMGVIYSTLAIAPVQFDREKVFRVKLQDEKQASILKNLTQTIELDFWYPDAIHDIAVNMTVDFRVTEKESQTIQSTLEQHKMDYEILINDLQEEIDKQFDVKEEIAGRHSYAKYNDWNKIVSW
hide sequence
Ensembl Acc Id:
ENSRNOP00000014970 ⟸ ENSRNOT00000014970
RefSeq Acc Id:
XP_038958908 ⟸ XM_039102980
- Peptide Label:
isoform X1
- UniProtKB:
P97597 (UniProtKB/Swiss-Prot), P21961 (UniProtKB/Swiss-Prot), A0A8I6GL18 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038958909 ⟸ XM_039102981
- Peptide Label:
isoform X2
Ensembl Acc Id:
ENSRNOP00000095188 ⟸ ENSRNOT00000100012
RGD ID: 13691259 Promoter ID: EPDNEW_R1784 Type: single initiation site Name: Cpa3_1 Description: carboxypeptidase A3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 2 105,047,999 - 105,048,059 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-12-23
Cpa3
carboxypeptidase A3
Cpa3
carboxypeptidase A3, mast cell
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-02-15
Cpa3
carboxypeptidase A3, mast cell
Cpa3
carboxypeptidase A3
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Cpa3
carboxypeptidase A3
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_expression
expressed in mast cells
69811
gene_product
mast cell protease
69811
