Symbol:
Cma1
Name:
chymase 1
RGD ID:
2365
Description:
Enables peptide binding activity and serine-type endopeptidase activity. Involved in several processes, including cellular response to glucose stimulus; midbrain development; and positive regulation of angiogenesis. Located in extracellular region. Biomarker of renovascular hypertension. Human ortholog(s) of this gene implicated in asthma; atopic dermatitis; hypertrophic cardiomyopathy; and sarcoidosis. Orthologous to human CMA1 (chymase 1); PARTICIPATES IN angiotensin II signaling pathway; renin-angiotensin cascade pathway; INTERACTS WITH adefovir; ammonium chloride; bisphenol A.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
alpha-chymase; chymase; chymase 1 mast cell; chymase 1, mast cell; mast cell protease 3; mast cell protease 5; mast cell protease III; MCP3P; Mcpt5; rMCP-3; rMCP-5; rMCP-III
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CMA1 (chymase 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Cma1 (chymase 1, mast cell) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CMA1 (chymase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CMA1 (chymase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CMA1 (chymase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Cma1 (chymase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
TMPRSS11D (transmembrane serine protease 11D) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
CMA1 (chymase 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Cma1 (chymase 1, mast cell)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
si:ch211-212d10.1
Alliance
DIOPT (OMA|OrthoFinder|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
gzmh
Alliance
DIOPT (Hieranoid|InParanoid|OrthoInspector|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 33,387,351 - 33,390,133 (-) NCBI GRCr8 mRatBN7.2 15 29,417,451 - 29,420,233 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 29,417,451 - 29,420,233 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 31,263,077 - 31,265,859 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 32,410,295 - 32,413,077 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 30,652,671 - 30,655,453 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 34,601,037 - 34,603,819 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 34,601,037 - 34,603,819 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 38,490,971 - 38,493,753 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 34,083,202 - 34,084,387 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 34,098,901 - 34,102,176 (-) NCBI Celera 15 28,991,244 - 28,994,014 (-) NCBI Celera RH 3.4 Map 15 213.78 RGD Cytogenetic Map 15 p12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Cma1 Rat 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene multiple interactions ISO RGD:735368 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Cma1 Rat 1,2-dimethylhydrazine increases expression ISO RGD:735368 6480464 1,2-Dimethylhydrazine results in increased expression of CMA1 mRNA CTD PMID:22206623 Cma1 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO RGD:735368 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Cma1 Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO RGD:735368 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Cma1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:735368 6480464 Tetrachlorodibenzodioxin results in decreased expression of CMA1 mRNA CTD PMID:16120747 Cma1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:735368 6480464 Tetrachlorodibenzodioxin affects the expression of CMA1 mRNA CTD PMID:21570461 Cma1 Rat 2,4,4'-trichlorobiphenyl multiple interactions ISO RGD:735368 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Cma1 Rat 4-hydroxyphenyl retinamide decreases expression ISO RGD:735368 6480464 Fenretinide results in decreased expression of CMA1 mRNA CTD PMID:28973697 Cma1 Rat acetohydrazide decreases expression ISO RGD:735368 6480464 acetylhydrazine results in decreased expression of CMA1 mRNA CTD PMID:15282401 Cma1 Rat adefovir increases secretion EXP 6480464 adefovir results in increased secretion of CMA1 protein CTD PMID:35114312 Cma1 Rat aflatoxin B1 decreases methylation ISO RGD:735367 6480464 Aflatoxin B1 results in decreased methylation of CMA1 gene CTD PMID:27153756 Cma1 Rat aldehydo-D-glucose multiple interactions ISO RGD:735368 6480464 [lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] more ... CTD PMID:37567420 Cma1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of CMA1 mRNA CTD PMID:16483693 Cma1 Rat antirheumatic drug increases expression ISO RGD:735367 6480464 Antirheumatic Agents results in increased expression of CMA1 mRNA CTD PMID:24449571 Cma1 Rat Azoxymethane multiple interactions ISO RGD:735368 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of CMA1 more ... CTD PMID:29950665 Cma1 Rat benzo[a]pyrene decreases expression ISO RGD:735367 6480464 Benzo(a)pyrene results in decreased expression of CMA1 mRNA CTD PMID:22316170 Cma1 Rat benzo[a]pyrene affects methylation ISO RGD:735367 6480464 Benzo(a)pyrene affects the methylation of CMA1 promoter CTD PMID:27901495 Cma1 Rat benzo[a]pyrene decreases expression ISO RGD:735368 6480464 Benzo(a)pyrene results in decreased expression of CMA1 mRNA CTD PMID:22228805 Cma1 Rat benzo[a]pyrene multiple interactions ISO RGD:735368 6480464 AHR protein affects the reaction [Benzo(a)pyrene affects the expression of CMA1 mRNA] CTD PMID:22228805 Cma1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Testosterone] results in increased expression of CMA1 mRNA CTD PMID:26496021 Cma1 Rat bisphenol A increases expression ISO RGD:735368 6480464 bisphenol A results in increased expression of CMA1 mRNA CTD PMID:32156529 Cma1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of CMA1 mRNA CTD PMID:33296240 Cma1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CMA1 mRNA CTD PMID:25181051|PMID:30816183|PMID:32528016|PMID:34947998|PMID:38750585 Cma1 Rat butanal increases expression ISO RGD:735367 6480464 butyraldehyde results in increased expression of CMA1 mRNA CTD PMID:26079696 Cma1 Rat carrageenan increases expression EXP 6480464 Carrageenan results in increased expression of CMA1 protein CTD PMID:18429935 Cma1 Rat carrageenan multiple interactions EXP 6480464 adelmidrol inhibits the reaction [Carrageenan results in increased expression of CMA1 protein] CTD PMID:18429935 Cma1 Rat CGP 52608 multiple interactions ISO RGD:735367 6480464 CGP 52608 promotes the reaction [RORA protein binds to CMA1 gene] CTD PMID:28238834 Cma1 Rat D-glucose multiple interactions ISO RGD:735368 6480464 [lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] more ... CTD PMID:37567420 Cma1 Rat decabromodiphenyl ether decreases expression EXP 6480464 decabromobiphenyl ether results in decreased expression of CMA1 mRNA CTD PMID:23640034 Cma1 Rat dextran sulfate multiple interactions ISO RGD:735368 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of CMA1 more ... CTD PMID:29950665 Cma1 Rat diethylstilbestrol decreases expression EXP 6480464 Diethylstilbestrol results in decreased expression of CMA1 mRNA CTD PMID:36653537 Cma1 Rat enalapril decreases expression EXP 6480464 Enalapril results in decreased expression of CMA1 mRNA CTD PMID:18796534 Cma1 Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of CMA1 mRNA CTD PMID:30307764 Cma1 Rat fructose multiple interactions ISO RGD:735368 6480464 [lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] more ... CTD PMID:37567420 Cma1 Rat furan increases expression EXP 6480464 furan results in increased expression of CMA1 mRNA CTD PMID:27387713 Cma1 Rat genistein multiple interactions EXP 6480464 [Genistein co-treated with Methoxychlor] results in increased expression of CMA1 mRNA CTD PMID:21782745 Cma1 Rat genistein decreases expression ISO RGD:735368 6480464 Genistein results in decreased expression of CMA1 mRNA CTD PMID:32186404 Cma1 Rat genistein increases expression EXP 6480464 Genistein results in increased expression of CMA1 mRNA CTD PMID:21782745 Cma1 Rat glucose multiple interactions ISO RGD:735368 6480464 [lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] more ... CTD PMID:37567420 Cma1 Rat hexachlorobenzene increases expression EXP 6480464 Hexachlorobenzene results in increased expression of CMA1 mRNA CTD PMID:15159207 Cma1 Rat hydrochlorothiazide affects expression EXP 6480464 Hydrochlorothiazide affects the expression of CMA1 mRNA CTD PMID:18796534 Cma1 Rat indole-3-methanol multiple interactions EXP 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in decreased expression of CMA1 mRNA CTD PMID:22129741 Cma1 Rat malathion decreases expression ISO RGD:735367 6480464 Malathion results in decreased expression of CMA1 mRNA CTD PMID:37047231 Cma1 Rat Mesaconitine decreases expression EXP 6480464 mesaconitine results in decreased expression of CMA1 protein CTD PMID:37182599 Cma1 Rat methotrexate affects expression ISO RGD:735368 6480464 Methotrexate affects the expression of CMA1 mRNA CTD PMID:18502557 Cma1 Rat methoxychlor multiple interactions EXP 6480464 [Genistein co-treated with Methoxychlor] results in increased expression of CMA1 mRNA CTD PMID:21782745 Cma1 Rat methoxychlor increases expression EXP 6480464 Methoxychlor results in increased expression of CMA1 mRNA CTD PMID:21782745 Cma1 Rat N-acetyl-L-cysteine multiple interactions EXP 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in decreased expression of CMA1 mRNA CTD PMID:22129741 Cma1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in decreased expression of CMA1 mRNA CTD PMID:22129741 Cma1 Rat oxaliplatin increases expression EXP 6480464 oxaliplatin results in increased expression of CMA1 mRNA CTD PMID:25729387 Cma1 Rat ozone decreases expression ISO RGD:735368 6480464 Ozone results in decreased expression of CMA1 mRNA CTD PMID:33026818 Cma1 Rat paraquat multiple interactions ISO RGD:735367 6480464 CMA1 protein promotes the reaction [Paraquat results in increased expression of ACTA2 protein]; CMA1 protein more ... CTD PMID:19969051 Cma1 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of CMA1 mRNA CTD PMID:18198484 Cma1 Rat paraquat increases expression ISO RGD:735368 6480464 Paraquat results in increased expression of CMA1 mRNA; Paraquat results in increased expression of CMA1 more ... CTD PMID:19969051 Cma1 Rat paraquat increases expression ISO RGD:735367 6480464 Paraquat results in increased expression of CMA1 mRNA; Paraquat results in increased expression of CMA1 more ... CTD PMID:19969051 Cma1 Rat PCB138 multiple interactions ISO RGD:735368 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Cma1 Rat pentane-2,3-dione increases expression EXP 6480464 2,3-pentanedione results in increased expression of CMA1 mRNA CTD PMID:25710175 Cma1 Rat pirinixic acid increases expression ISO RGD:735368 6480464 pirinixic acid results in increased expression of CMA1 mRNA CTD PMID:20813756 Cma1 Rat potassium dichromate decreases expression ISO RGD:735368 6480464 Potassium Dichromate results in decreased expression of CMA1 mRNA CTD PMID:23608068 Cma1 Rat silicon dioxide increases expression EXP 6480464 Silicon Dioxide results in increased expression of CMA1 mRNA CTD PMID:18685790 Cma1 Rat sodium arsenite increases expression ISO RGD:735368 6480464 sodium arsenite results in increased expression of CMA1 mRNA CTD PMID:36209798 Cma1 Rat testosterone multiple interactions EXP 6480464 [bisphenol A co-treated with Testosterone] results in increased expression of CMA1 mRNA CTD PMID:26496021 Cma1 Rat titanium dioxide increases expression ISO RGD:735368 6480464 titanium dioxide results in increased expression of CMA1 mRNA CTD PMID:23557971|PMID:35295148 Cma1 Rat titanium dioxide multiple interactions ISO RGD:735368 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of CMA1 more ... CTD PMID:29950665 Cma1 Rat titanium dioxide increases expression EXP 6480464 titanium dioxide results in increased expression of CMA1 mRNA CTD PMID:30012374 Cma1 Rat topotecan increases expression EXP 6480464 Topotecan results in increased expression of CMA1 mRNA CTD PMID:25729387 Cma1 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of CMA1 mRNA CTD PMID:33387578 Cma1 Rat trimellitic anhydride decreases expression ISO RGD:735368 6480464 trimellitic anhydride results in decreased expression of CMA1 mRNA CTD PMID:19042947 Cma1 Rat troglitazone increases expression ISO RGD:735368 6480464 troglitazone results in increased expression of CMA1 mRNA CTD PMID:28973697 Cma1 Rat verteporfin multiple interactions ISO RGD:735368 6480464 Verteporfin inhibits the reaction [lipopolysaccharide, Escherichia coli O111 B4 results in increased expression of CMA1 more ... CTD PMID:31812773
Imported Annotations - KEGG (archival)
1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO) 1,2-dimethylhydrazine (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4,4'-trichlorobiphenyl (ISO) 4-hydroxyphenyl retinamide (ISO) acetohydrazide (ISO) adefovir (EXP) aflatoxin B1 (ISO) aldehydo-D-glucose (ISO) ammonium chloride (EXP) antirheumatic drug (ISO) Azoxymethane (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) butanal (ISO) carrageenan (EXP) CGP 52608 (ISO) D-glucose (ISO) decabromodiphenyl ether (EXP) dextran sulfate (ISO) diethylstilbestrol (EXP) enalapril (EXP) fenvalerate (EXP) fructose (ISO) furan (EXP) genistein (EXP,ISO) glucose (ISO) hexachlorobenzene (EXP) hydrochlorothiazide (EXP) indole-3-methanol (EXP) malathion (ISO) Mesaconitine (EXP) methotrexate (ISO) methoxychlor (EXP) N-acetyl-L-cysteine (EXP) N-nitrosodiethylamine (EXP) oxaliplatin (EXP) ozone (ISO) paraquat (EXP,ISO) PCB138 (ISO) pentane-2,3-dione (EXP) pirinixic acid (ISO) potassium dichromate (ISO) silicon dioxide (EXP) sodium arsenite (ISO) testosterone (EXP) titanium dioxide (EXP,ISO) topotecan (EXP) trichloroethene (EXP) trimellitic anhydride (ISO) troglitazone (ISO) verteporfin (ISO)
1.
A protease activated receptor-2 (PAR-2) activating peptide, tc-LIGRLO-NH2, induces protease release from mast cells: role in TNF degradation.
Alshurafa HN, etal., BMC Pharmacol. 2004 Jul 20;4:12.
2.
Mast cell phenotype, location, and activation in severe asthma: data from the severe asthma research program.
Balzar S, etal., Am J Respir Crit Care Med. 2011 Feb 1;183(3):299-309. Epub 2010 Sep 2.
3.
Assessment of bronchial inflammation using an automated cell recognition system based on colour analysis.
Berger P, etal., Eur Respir J. 1999 Dec;14(6):1394-402.
4.
Segmental bronchoprovocation in allergic rhinitis patients affects mast cell and basophil numbers in nasal and bronchial mucosa.
Braunstahl GJ, etal., Am J Respir Crit Care Med. 2001 Sep 1;164(5):858-65.
5.
The Impact of Maternal Separation on the Number of Tyrosine Hydroxylase-Expressing Midbrain Neurons during Different Stages of Ontogenesis.
Chocyk A, etal., Neuroscience. 2011 Mar 8.
6.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
7.
Association of mast cells with lung function in chronic obstructive pulmonary disease.
Gosman MM, etal., Respir Res. 2008 Sep 10;9:64.
8.
Increased expression of mast cell chymase in the lungs of patients with congenital heart disease associated with early pulmonary vascular disease.
Hamada H, etal., Am J Respir Crit Care Med. 1999 Oct;160(4):1303-8.
9.
Evidence for a role of mast cells in the evolution to congestive heart failure.
Hara M, etal., J Exp Med. 2002 Feb 4;195(3):375-81.
10.
Enhanced mast cell chymase expression in human idiopathic interstitial pneumonia.
Hirata K, etal., Int J Mol Med. 2007 Apr;19(4):565-70.
11.
Cloning of the cDNA encoding a novel rat mast-cell proteinase, rMCP-3, and its expression in comparison with other rat mast-cell proteinases.
Ide H, etal., Biochem J 1995 Oct 15;311 ( Pt 2):675-80.
12.
Polymorphism of the mast cell chymase gene (CMA1) promoter region: lack of association with asthma but association with serum total immunoglobulin E levels in adult atopic dermatitis.
Iwanaga T, etal., Clin Exp Allergy. 2004 Jul;34(7):1037-42.
13.
Tranilast reduces mesenteric vascular collagen deposition and chymase-positive mast cells in experimental diabetes.
Jones SE, etal., J Diabetes Complications. 2004 Sep-Oct;18(5):309-15.
14.
Extended substrate specificity of rat mast cell protease 5, a rodent alpha-chymase with elastase-like primary specificity.
Karlson U, etal., J Biol Chem. 2003 Oct 10;278(41):39625-31. Epub 2003 Aug 4.
15.
Gene expression of cardiac mast cell chymase and tryptase in a murine model of heart failure caused by viral myocarditis.
Kitaura-Inenaga K, etal., Circ J. 2003 Oct;67(10):881-4.
16.
Human chymase expression in a mice induces mild hypertension with left ventricular hypertrophy.
Koga T, etal., Hypertens Res. 2003 Sep;26(9):759-68.
17.
Chymase gene (CMA1) polymorphisms in Dutch and Japanese sarcoidosis patients.
Kruit A, etal., Respiration. 2006;73(5):623-33. Epub 2006 Jan 27.
18.
Rodent alpha-chymases are elastase-like proteases.
Kunori Y, etal., Eur J Biochem. 2002 Dec;269(23):5921-30.
19.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
20.
Targeting the renin-angiotensin system: what's new?
Leckie BJ Curr Med Chem Cardiovasc Hematol Agents. 2005 Jan;3(1):23-32.
21.
Mast cell chymase induces smooth muscle cell apoptosis by a mechanism involving fibronectin degradation and disruption of focal adhesions.
Leskinen MJ, etal., Arterioscler Thromb Vasc Biol 2003 Feb 1;23(2):238-43.
22.
Secretory granule proteases in rat mast cells. Cloning of 10 different serine proteases and a carboxypeptidase A from various rat mast cell populations.
Lutzelschwab C, etal., J Exp Med 1997 Jan 6;185(1):13-29.
23.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
24.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
25.
Differential accumulation of pulmonary and cardiac mast cell-subsets and eosinophils between fatal anaphylaxis and asthma death: a postmortem comparative study.
Perskvist N and Edston E, Forensic Sci Int. 2007 Jun 14;169(1):43-9. Epub 2006 Nov 1.
26.
Angiotensin-converting enzyme and heart chymase gene polymorphisms in hypertrophic cardiomyopathy.
Pfeufer A, etal., Am J Cardiol. 1996 Aug 1;78(3):362-4.
27.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
28.
GOA pipeline
RGD automated data pipeline
29.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
30.
Inhibition of granuloma-associated angiogenesis by controlling mast cell mediator release: role of mast cell protease-5.
Russo A, etal., Br J Pharmacol. 2005 May;145(1):24-33.
31.
Angiotensin converting enzyme-independent angiotensin ii production by chymase is up-regulated in the ischemic kidney in renovascular hypertension.
Sadjadi J, etal., J Surg Res. 2005 Aug;127(2):65-9.
32.
A novel (TG)n(GA)m repeat polymorphism 254 bp downstream of the mast cell chymase (CMA1) gene is associated with atopic asthma and total serum IgE levels.
Sharma S, etal., J Hum Genet. 2005;50(6):276-82. Epub 2005 May 28.
33.
High-glucose-induced regulation of intracellular ANG II synthesis and nuclear redistribution in cardiac myocytes.
Singh VP, etal., Am J Physiol Heart Circ Physiol. 2007 Aug;293(2):H939-48. Epub 2007 May 4.
34.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
35.
Association study of mast cell chymase polymorphisms with atopy.
Weidinger S, etal., Allergy. 2005 Oct;60(10):1256-61.
Cma1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 33,387,351 - 33,390,133 (-) NCBI GRCr8 mRatBN7.2 15 29,417,451 - 29,420,233 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 29,417,451 - 29,420,233 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 31,263,077 - 31,265,859 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 32,410,295 - 32,413,077 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 30,652,671 - 30,655,453 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 34,601,037 - 34,603,819 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 34,601,037 - 34,603,819 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 38,490,971 - 38,493,753 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 34,083,202 - 34,084,387 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 34,098,901 - 34,102,176 (-) NCBI Celera 15 28,991,244 - 28,994,014 (-) NCBI Celera RH 3.4 Map 15 213.78 RGD Cytogenetic Map 15 p12 NCBI
CMA1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 14 24,505,353 - 24,508,265 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 14 24,505,353 - 24,508,265 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 14 24,974,559 - 24,977,471 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 14 24,044,552 - 24,047,311 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 14 24,044,551 - 24,047,311 NCBI Celera 14 4,839,478 - 4,842,237 (-) NCBI Celera Cytogenetic Map 14 q12 NCBI HuRef 14 5,089,481 - 5,092,240 (-) NCBI HuRef CHM1_1 14 24,973,574 - 24,976,333 (-) NCBI CHM1_1 T2T-CHM13v2.0 14 18,704,211 - 18,707,123 (-) NCBI T2T-CHM13v2.0
Cma1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 14 56,178,908 - 56,182,132 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 14 56,178,908 - 56,182,132 (-) Ensembl GRCm39 Ensembl GRCm38 14 55,941,451 - 55,944,675 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 14 55,941,451 - 55,944,675 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 14 56,560,288 - 56,563,498 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 14 54,895,522 - 54,898,732 (-) NCBI MGSCv36 mm8 Celera 14 53,745,166 - 53,748,376 (-) NCBI Celera Cytogenetic Map 14 C3 NCBI cM Map 14 28.19 NCBI
CMA1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 15 25,855,859 - 25,858,985 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 14 25,072,378 - 25,075,477 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 14 5,277,269 - 5,280,335 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 14 23,400,677 - 23,402,819 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 14 23,400,345 - 23,403,548 (-) Ensembl panpan1.1 panPan2
CMA1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 8 4,438,244 - 4,441,189 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 8 4,438,244 - 4,441,189 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 8 4,359,948 - 4,362,893 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 8 4,549,708 - 4,552,661 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 8 4,549,715 - 4,552,661 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 8 4,239,198 - 4,242,142 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 8 4,301,888 - 4,304,834 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 8 4,564,103 - 4,567,048 (-) NCBI UU_Cfam_GSD_1.0
CMA1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 24 1,471,767 - 1,475,062 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 24 1,471,725 - 1,474,692 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666036 13,158,008 - 13,161,323 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Cma1
.
Predicted Target Of
Count of predictions: 29 Count of miRNA genes: 29 Interacting mature miRNAs: 29 Transcripts: ENSRNOT00000067539 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1331729 Rf42 Renal function QTL 42 3.071 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 15 17362897 73690657 Rat 1641887 Alcrsp14 Alcohol response QTL 14 response to alcohol trait (VT:0010489) brain neurotensin receptor 1 density (CMO:0002068) 15 1 42356671 Rat 10755503 Bp391 Blood pressure QTL 391 2.37 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 15 20248600 37896129 Rat 1582227 Gluco30 Glucose level QTL 30 3.6 0.0003 blood glucose amount (VT:0000188) absolute change in blood glucose level area under curve (CMO:0002034) 15 28030665 82262678 Rat 1582228 Epfw3 Epididymal fat weight QTL 3 4.1 0.0002 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 15 28030665 82262678 Rat 1578646 Bmd18 Bone mineral density QTL 18 5.2 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 15 22806240 98288169 Rat 9589149 Insul29 Insulin level QTL 29 9.06 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 15 1 34723002 Rat 1578647 Bmd17 Bone mineral density QTL 17 4 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 15 22806240 98288169 Rat 10401805 Kidm51 Kidney mass QTL 51 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 15 306329 45306329 Rat 2317750 Glom26 Glomerulus QTL 26 4.3 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 15 12496141 65205939 Rat 2298549 Neuinf12 Neuroinflammation QTL 12 3.5 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 15 1 55302115 Rat 8552920 Pigfal8 Plasma insulin-like growth factor 1 level QTL 8 3 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 15 1 34723002 Rat 2293688 Bss29 Bone structure and strength QTL 29 5.31 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 15 11111142 56111142 Rat 8694361 Abfw6 Abdominal fat weight QTL 6 10.2 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 15 1 34723002 Rat 1582214 Stl21 Serum triglyceride level QTL 21 3.1 0.022 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 15 28030665 82262678 Rat 631273 Lecl2 Lens clarity QTL 2 0.001 lens clarity trait (VT:0001304) age of onset/diagnosis of cataract (CMO:0001584) 15 10596089 55596089 Rat 2300167 Bmd63 Bone mineral density QTL 63 5.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 15 11111142 56111142 Rat 731170 Pur3 Proteinuria QTL 3 2.3 0.0005 urine protein amount (VT:0005160) urine protein excretion rate (CMO:0000759) 15 1 41686771 Rat 738017 Hcas7 Hepatocarcinoma susceptibility QTL 7 2.91 liver integrity trait (VT:0010547) liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464) 15 2266368 46921453 Rat 152025253 Hrtrt24 Heart rate QTL 24 3.82 heart pumping trait (VT:2000009) 15 27885774 86257085 Rat 10054130 Srcrt8 Stress Responsive Cort QTL 8 2.18 0.0085 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 15 22117933 67117933 Rat 2300173 Bmd62 Bone mineral density QTL 62 12.8 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 15 11111142 56111142 Rat 2324620 Coatc3 Coat color QTL 3 coat/hair pigmentation trait (VT:0010463) pigmented coat/hair area to total coat/hair area ratio (CMO:0001810) 15 19856566 46187442 Rat 61424 Scl1 Serum cholesterol level QTL 1 7.7 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 15 16725528 80672115 Rat 1582251 Gluco24 Glucose level QTL 24 3.2 0.0008 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 15 5530756 50530756 Rat 1354657 Despr13 Despair related QTL 13 0.0022 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 15 1 29912054 Rat 631550 Bw7 Body weight QTL 7 3.6 body mass (VT:0001259) body weight (CMO:0000012) 15 19856566 34924750 Rat 1582242 Gluco28 Glucose level QTL 28 3.3 0.0008 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 15 28030665 82262678 Rat 1578660 Bss19 Bone structure and strength QTL 19 4.3 femur morphology trait (VT:0000559) bone trabecular cross-sectional area (CMO:0002311) 15 22806240 98288169 Rat 1582244 Bw79 Body weight QTL 79 4 0.0002 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 15 28030665 82262678 Rat
RH131228
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 15 33,387,456 - 33,387,645 (+) Marker Load Pipeline mRatBN7.2 15 29,417,556 - 29,417,745 (+) MAPPER mRatBN7.2 Rnor_6.0 15 34,601,143 - 34,601,331 NCBI Rnor6.0 Rnor_5.0 15 38,491,077 - 38,491,265 UniSTS Rnor5.0 RGSC_v3.4 15 34,083,308 - 34,083,496 UniSTS RGSC3.4 Celera 15 28,991,350 - 28,991,538 UniSTS RH 3.4 Map 15 260.81 UniSTS Cytogenetic Map 15 p13 UniSTS
RH94861
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 15 33,387,351 - 33,387,509 (+) Marker Load Pipeline mRatBN7.2 15 29,417,451 - 29,417,609 (+) MAPPER mRatBN7.2 Rnor_6.0 15 34,601,038 - 34,601,195 NCBI Rnor6.0 Rnor_5.0 15 38,490,972 - 38,491,129 UniSTS Rnor5.0 RGSC_v3.4 15 34,083,203 - 34,083,360 UniSTS RGSC3.4 Celera 15 28,991,245 - 28,991,402 UniSTS RH 3.4 Map 15 213.78 UniSTS Cytogenetic Map 15 p13 UniSTS
Cma1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 29,417,760 - 29,418,259 (+) MAPPER mRatBN7.2 Rnor_6.0 15 34,601,347 - 34,601,845 NCBI Rnor6.0 Rnor_5.0 15 38,491,281 - 38,491,779 UniSTS Rnor5.0 Celera 15 28,991,554 - 28,992,052 UniSTS Cytogenetic Map 15 p13 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
37
68
87
86
55
25
55
6
201
85
48
44
53
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000067539 ⟹ ENSRNOP00000061330
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 29,417,451 - 29,420,233 (-) Ensembl Rnor_6.0 Ensembl 15 34,601,037 - 34,603,819 (-) Ensembl
RefSeq Acc Id:
NM_013092 ⟹ NP_037224
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 33,387,351 - 33,390,133 (-) NCBI mRatBN7.2 15 29,417,451 - 29,420,233 (-) NCBI Rnor_6.0 15 34,601,037 - 34,603,819 (-) NCBI Rnor_5.0 15 38,490,971 - 38,493,753 (-) NCBI RGSC_v3.4 15 34,083,202 - 34,084,387 (-) RGD Celera 15 28,991,244 - 28,994,014 (-) RGD
Sequence:
AGCCTGCACAGCCCTGAGTAGCCCCTCAGAGAGGATGAATCTCCATGCTCTGTGTCTGCTGCTCCTTCTCCTGGGTTCCAGCACCAAAGCTGGGGAGATCATCGGGGGCACGGAGTGCATACCACACT
hide sequence
RefSeq Acc Id:
NP_037224 ⟸ NM_013092
- Peptide Label:
precursor
- UniProtKB:
Q9R2C8 (UniProtKB/Swiss-Prot), P50339 (UniProtKB/Swiss-Prot), A6KH67 (UniProtKB/TrEMBL)
- Sequence:
MNLHALCLLLLLLGSSTKAGEIIGGTECIPHSRPYMAYLEIVTSDNYLSACSGFLIRRNFVLTAAHCAGRSITVLLGAHNKTYKEDTWQKLEVEKQFIHPNYDKRLVLHDIMLLKLKEKAKLTLGVGT
hide sequence
Ensembl Acc Id:
ENSRNOP00000061330 ⟸ ENSRNOT00000067539
RGD ID: 13699698 Promoter ID: EPDNEW_R10221 Type: initiation region Name: Cma1_1 Description: chymase 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 15 34,603,814 - 34,603,874 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-03-01
Cma1
chymase 1
Cma1
chymase 1, mast cell
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Cma1
chymase 1, mast cell
chymase 1
Name updated
1299863 APPROVED
2002-06-10
Cma1
chymase 1
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_expression
expressed in peritoneal mast cells, skin, tongue and RBL2H3 basophilic leukemia cells; weakly expressed in jejunum of N. brasiliensis-infected rats
1298761
gene_expression
expressed in connective tissue mast cells of ear and peritoneum
69811
gene_function
has proteolytic activity
1298762
gene_process
may facilitate apoptosis by playing a role in fibronectin degradation and disruption of the p-FAK cell survival cascade
1298762
gene_protein
mature enzyme is 226 amino acids
1298761
