Symbol:
Alox5
Name:
arachidonate 5-lipoxygenase
RGD ID:
2096
Description:
Predicted to enable arachidonate 5-lipoxygenase activity and iron ion binding activity. Involved in several processes, including positive regulation of cytochrome-c oxidase activity; positive regulation of vasoconstriction; and response to hyperoxia. Located in dendrite; nuclear envelope; and sarcolemma. Used to study several diseases, including brain ischemia; hypertension (multiple); pleurisy; portal hypertension; and pulmonary edema. Biomarker of pulmonary hypertension. Human ortholog(s) of this gene implicated in artery disease (multiple); asthma (multiple); pancreatic cancer; and pulmonary tuberculosis. Orthologous to human ALOX5 (arachidonate 5-lipoxygenase); PARTICIPATES IN leukotriene metabolic pathway; lipoxygenase mediated pathway of arachidonic acid metabolism; acetylsalicylic acid pharmacodynamics pathway; INTERACTS WITH 17beta-estradiol; 17beta-estradiol 3-benzoate; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
5 - Lipoxygenase; 5-lipoxygenase; 5-LO; LOX5A; polyunsaturated fatty acid 5-lipoxygenase
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Candidate Gene For:
Bp116
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 151,203,948 - 151,251,126 (-) NCBI GRCr8 mRatBN7.2 4 149,531,329 - 149,578,696 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 149,531,515 - 149,578,743 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 155,763,428 - 155,810,585 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 151,547,462 - 151,594,624 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 150,170,360 - 150,217,527 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 148,398,004 - 148,446,308 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 148,398,892 - 148,446,303 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 214,345,956 - 214,393,337 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 152,610,283 - 152,657,891 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 152,855,123 - 152,902,732 (-) NCBI Celera 4 138,415,564 - 138,454,485 (-) NCBI Celera Cytogenetic Map 4 q42 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Alox5 Rat (4Z,7Z,10Z,13Z,15E,19Z)-17-hydroxydocosahexaenoic acid decreases expression ISO Alox5 (Mus musculus) 6480464 17-hydroxy-4 more ... CTD PMID:17056761 Alox5 Rat (4Z,7Z,10Z,13Z,15E,19Z)-17-hydroxydocosahexaenoic acid multiple interactions ISO Alox5 (Mus musculus) 6480464 17-hydroxy-4 more ... CTD PMID:34601004 Alox5 Rat (5Z,8Z,11Z,13E)-15-HETE multiple interactions ISO ALOX5 (Homo sapiens) 6480464 [benoxaprofen results in decreased activity of ALOX5 protein] which results in increased abundance of 15-hydroxy-5 more ... CTD PMID:2849922 Alox5 Rat (S)-nicotine multiple interactions ISO ALOX5 (Homo sapiens) 6480464 [RTKI cpd co-treated with AG 1879] inhibits the reaction [Nicotine results in increased expression of ALOX5 protein] more ... CTD PMID:14569062 and PMID:20061081 Alox5 Rat (S)-nicotine increases expression ISO ALOX5 (Homo sapiens) 6480464 Nicotine results in increased expression of ALOX5 mRNA and Nicotine results in increased expression of ALOX5 protein CTD PMID:14569062 and PMID:20061081 Alox5 Rat 1,2-dimethylhydrazine decreases expression ISO Alox5 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of ALOX5 mRNA CTD PMID:22206623 Alox5 Rat 1-O-palmitoyl-2-O-(5-oxovaleryl)-sn-glycero-3-phosphocholine increases expression ISO ALOX5 (Homo sapiens) 6480464 1-palmitoyl-2-(5-oxovaleroyl)-sn-glycero-3-phosphorylcholine results in increased expression of ALOX5 mRNA CTD PMID:16386258 Alox5 Rat 1-octadec-9-enoylglycero-3-phosphate multiple interactions ISO ALOX5 (Homo sapiens) 6480464 ALOX5 protein promotes the reaction [lysophosphatidic acid results in increased abundance of Hydrogen Peroxide] more ... CTD PMID:10698703 Alox5 Rat 17beta-estradiol decreases expression ISO Alox5 (Mus musculus) 6480464 Estradiol results in decreased expression of ALOX5 protein CTD PMID:17143502 Alox5 Rat 17beta-estradiol multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of ALOX5 mRNA CTD PMID:32741896 Alox5 Rat 17beta-estradiol increases expression ISO Alox5 (Mus musculus) 6480464 Estradiol results in increased expression of ALOX5 mRNA CTD PMID:19484750 Alox5 Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of ALOX5 mRNA CTD PMID:32741896 Alox5 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO ALOX5 (Homo sapiens) 6480464 2 more ... CTD PMID:23146750 Alox5 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Alox5 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of ALOX5 mRNA CTD PMID:28487374 Alox5 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of ALOX5 mRNA CTD PMID:34747641 Alox5 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 AHR mRNA promotes the reaction [Tetrachlorodibenzodioxin results in increased expression of ALOX5 mRNA] CTD PMID:28487374 Alox5 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of ALOX5 mRNA and Tetrachlorodibenzodioxin results in increased expression of ALOX5 protein CTD PMID:28487374 more ... Alox5 Rat 2,6-di-tert-butyl-4-methylphenol affects localization ISO Alox5 (Mus musculus) 6480464 Butylated Hydroxytoluene affects the localization of ALOX5 protein CTD PMID:12376474 Alox5 Rat 2,6-di-tert-butyl-4-methylphenol multiple interactions ISO Alox5 (Mus musculus) 6480464 celecoxib inhibits the reaction [Butylated Hydroxytoluene affects the localization of ALOX5 protein] CTD PMID:12376474 Alox5 Rat 2-acetyl-1-alkyl-sn-glycero-3-phosphocholine multiple interactions ISO ALOX5 (Homo sapiens) 6480464 [sodium arsenite co-treated with Platelet Activating Factor co-treated with Arachidonic Acid] results in increased phosphorylation of and results in increased activity of ALOX5 protein and [zileuton results in decreased activity of ALOX5 protein] inhibits the reaction [Calcimycin results in increased abundance of Platelet Activating Factor] CTD PMID:10779545 and PMID:8387780 Alox5 Rat 2-acetyl-1-alkyl-sn-glycero-3-phosphocholine increases expression ISO ALOX5 (Homo sapiens) 6480464 Platelet Activating Factor results in increased expression of ALOX5 mRNA CTD PMID:16386258 Alox5 Rat 3,3',4,4',5-pentachlorobiphenyl multiple interactions EXP 6480464 AHR gene mutant form inhibits the reaction [3 more ... CTD PMID:34256052 Alox5 Rat 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3 more ... CTD PMID:34256052 Alox5 Rat 3-[3-(tert-butylsulfanyl)-1-(4-chlorobenzyl)-5-(propan-2-yl)-1H-indol-2-yl]-2,2-dimethylpropanoic acid decreases activity EXP 6480464 MK-886 results in decreased activity of ALOX5 protein CTD PMID:14726295 and PMID:9445378 Alox5 Rat 3-[3-(tert-butylsulfanyl)-1-(4-chlorobenzyl)-5-(propan-2-yl)-1H-indol-2-yl]-2,2-dimethylpropanoic acid multiple interactions ISO Alox5 (Mus musculus) 6480464 EPHX2 gene mutant form promotes the reaction [MK-886 inhibits the reaction [Lipopolysaccharides results in increased expression of ALOX5 protein]] and MK-886 inhibits the reaction [Lipopolysaccharides results in increased expression of ALOX5 protein] CTD PMID:19896470 Alox5 Rat 3-[3-(tert-butylsulfanyl)-1-(4-chlorobenzyl)-5-(propan-2-yl)-1H-indol-2-yl]-2,2-dimethylpropanoic acid multiple interactions ISO ALOX5 (Homo sapiens) 6480464 MK-886 inhibits the reaction [ALOX5 protein results in increased metabolism of Hydroxyeicosatetraenoic Acids metabolite] and MK-886 inhibits the reaction [Nicotine results in increased expression of ALOX5 protein] CTD PMID:11861792 and PMID:20061081 Alox5 Rat 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione multiple interactions ISO ALOX5 (Homo sapiens) 6480464 bisindolylmaleimide I inhibits the reaction [Calcimycin results in increased phosphorylation of and results in increased activity of ALOX5 protein] CTD PMID:10779545 Alox5 Rat 4-hydroxycyclophosphamide multiple interactions EXP 6480464 [afimoxifene co-treated with 4-hydroxycyclophosphamide] affects the expression of ALOX5 mRNA CTD PMID:25833159 Alox5 Rat 4-hydroxynon-2-enal multiple interactions ISO Alox5 (Mus musculus) 6480464 ALOX5 mutant form inhibits the reaction [4-hydroxy-2-nonenal results in increased expression of MMP9 protein] CTD PMID:19837106 Alox5 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of ALOX5 mRNA CTD PMID:31881176 Alox5 Rat acrolein increases expression ISO Alox5 (Mus musculus) 6480464 Acrolein results in increased expression of ALOX5 mRNA and Acrolein results in increased expression of ALOX5 protein CTD PMID:20153347 Alox5 Rat acrolein multiple interactions ISO Alox5 (Mus musculus) 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [Acrolein results in increased expression of ALOX5 protein] and RTKI cpd inhibits the reaction [Acrolein results in increased expression of ALOX5 protein] CTD PMID:20153347 Alox5 Rat acrolein increases activity ISO Alox5 (Mus musculus) 6480464 Acrolein results in increased activity of ALOX5 protein CTD PMID:20153347 Alox5 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of ALOX5 mRNA CTD PMID:28959563 Alox5 Rat actinomycin D multiple interactions ISO ALOX5 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of ALOX5 mRNA CTD PMID:38460933 Alox5 Rat afimoxifene multiple interactions EXP 6480464 [afimoxifene co-treated with 4-hydroxycyclophosphamide] affects the expression of ALOX5 mRNA CTD PMID:25833159 Alox5 Rat aflatoxin B1 increases expression ISO ALOX5 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of ALOX5 mRNA CTD PMID:22100608 Alox5 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of ALOX5 mRNA CTD PMID:33354967 Alox5 Rat aldehydo-D-glucose multiple interactions EXP 6480464 [Oxygen deficiency co-treated with Glucose deficiency] affects the localization of ALOX5 protein more ... CTD PMID:18951527 Alox5 Rat aldehydo-D-glucose increases expression ISO ALOX5 (Homo sapiens) 6480464 Glucose results in increased expression of ALOX5 mRNA CTD PMID:31655124 Alox5 Rat all-trans-retinoic acid increases expression ISO ALOX5 (Homo sapiens) 6480464 Tretinoin results in increased expression of ALOX5 mRNA CTD PMID:16129123 and PMID:33167477 Alox5 Rat aluminium atom multiple interactions EXP 6480464 caffeic acid inhibits the reaction [Aluminum results in increased expression of ALOX5 mRNA] and caffeic acid inhibits the reaction [Aluminum results in increased expression of ALOX5 protein] CTD PMID:27368151 Alox5 Rat aluminium atom increases expression EXP 6480464 Aluminum results in increased expression of ALOX5 mRNA and Aluminum results in increased expression of ALOX5 protein CTD PMID:27368151 Alox5 Rat aluminium(0) multiple interactions EXP 6480464 caffeic acid inhibits the reaction [Aluminum results in increased expression of ALOX5 mRNA] and caffeic acid inhibits the reaction [Aluminum results in increased expression of ALOX5 protein] CTD PMID:27368151 Alox5 Rat aluminium(0) increases expression EXP 6480464 Aluminum results in increased expression of ALOX5 mRNA and Aluminum results in increased expression of ALOX5 protein CTD PMID:27368151 Alox5 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of ALOX5 mRNA CTD PMID:16483693 Alox5 Rat amphotericin B decreases expression ISO ALOX5 (Homo sapiens) 6480464 Amphotericin B analog results in decreased expression of ALOX5 mRNA CTD PMID:28534445 Alox5 Rat anthra[1,9-cd]pyrazol-6(2H)-one decreases expression ISO ALOX5 (Homo sapiens) 6480464 pyrazolanthrone results in decreased expression of ALOX5 protein CTD PMID:23539630 Alox5 Rat antirheumatic drug decreases expression ISO ALOX5 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of ALOX5 mRNA CTD PMID:24449571 Alox5 Rat arachidonic acid multiple interactions ISO ALOX5 (Homo sapiens) 6480464 [sodium arsenite co-treated with Platelet Activating Factor co-treated with Arachidonic Acid] results in increased phosphorylation of and results in increased activity of ALOX5 protein more ... CTD PMID:10779545 more ... Alox5 Rat arachidonic acid increases metabolic processing ISO ALOX5 (Homo sapiens) 6480464 ALOX5 protein results in increased metabolism of Arachidonic Acid CTD PMID:18295198 Alox5 Rat aristolochic acid A increases expression EXP 6480464 aristolochic acid I results in increased expression of ALOX5 mRNA CTD PMID:36863539 Alox5 Rat arsane affects expression ISO ALOX5 (Homo sapiens) 6480464 Arsenic affects the expression of ALOX5 mRNA CTD PMID:18414638 Alox5 Rat arsenic atom affects expression ISO ALOX5 (Homo sapiens) 6480464 Arsenic affects the expression of ALOX5 mRNA CTD PMID:18414638 Alox5 Rat Azoxymethane multiple interactions ISO Alox5 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of ALOX5 mRNA CTD PMID:29950665 Alox5 Rat baicalin multiple interactions EXP 6480464 baicalin inhibits the reaction [Hydrogen Peroxide affects the localization of and results in increased activity of ALOX5 protein] CTD PMID:20139896 Alox5 Rat benoxaprofen decreases activity ISO ALOX5 (Homo sapiens) 6480464 benoxaprofen results in decreased activity of ALOX5 protein CTD PMID:2849922 and PMID:3020588 Alox5 Rat benoxaprofen multiple interactions ISO ALOX5 (Homo sapiens) 6480464 [benoxaprofen results in decreased activity of ALOX5 protein] which results in decreased chemical synthesis of Leukotriene B4 more ... CTD PMID:2849922 Alox5 Rat benoxaprofen decreases activity EXP 6480464 benoxaprofen results in decreased activity of ALOX5 protein CTD PMID:2724698 and PMID:3928952 Alox5 Rat benzene affects response to substance ISO ALOX5 (Homo sapiens) 6480464 ALOX5 gene SNP affects the susceptibility to Benzene CTD PMID:21540635 Alox5 Rat benzene increases expression ISO ALOX5 (Homo sapiens) 6480464 Benzene results in increased expression of ALOX5 mRNA CTD PMID:33064461 Alox5 Rat benzo[a]pyrene multiple interactions ISO ALOX5 (Homo sapiens) 6480464 Benzo(a)pyrene promotes the reaction [Calcitriol results in increased expression of ALOX5 mRNA] CTD PMID:19244278 Alox5 Rat benzo[a]pyrene increases expression ISO ALOX5 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of ALOX5 mRNA CTD PMID:32234424 Alox5 Rat benzo[a]pyrene decreases methylation ISO ALOX5 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of ALOX5 exon CTD PMID:27901495 Alox5 Rat benzo[a]pyrene increases methylation ISO ALOX5 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of ALOX5 3' UTR and Benzo(a)pyrene results in increased methylation of ALOX5 promoter CTD PMID:27901495 Alox5 Rat benzo[a]pyrene increases expression ISO Alox5 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of ALOX5 mRNA CTD PMID:19770486 and PMID:23735875 Alox5 Rat benzo[a]pyrene decreases expression ISO Alox5 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of ALOX5 mRNA CTD PMID:22228805 Alox5 Rat benzo[a]pyrene multiple interactions ISO Alox5 (Mus musculus) 6480464 Benzo(a)pyrene promotes the reaction [AHR protein binds to ALOX5 promoter] CTD PMID:19654925 Alox5 Rat benzo[b]fluoranthene increases expression ISO Alox5 (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of ALOX5 mRNA CTD PMID:26377693 Alox5 Rat beta-D-glucosamine 6-sulfate multiple interactions ISO ALOX5 (Homo sapiens) 6480464 glucosamine 6-O-sulfate inhibits the reaction [Lipopolysaccharides results in increased expression of ALOX5 mRNA] CTD PMID:21877189 Alox5 Rat beta-naphthoflavone increases expression ISO ALOX5 (Homo sapiens) 6480464 beta-Naphthoflavone results in increased expression of ALOX5 mRNA CTD PMID:19737606 Alox5 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of ALOX5 gene CTD PMID:28505145 Alox5 Rat bisphenol A increases expression ISO Alox5 (Mus musculus) 6480464 bisphenol A results in increased expression of ALOX5 mRNA CTD PMID:32156529 Alox5 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ALOX5 mRNA CTD PMID:30816183 and PMID:34973380 Alox5 Rat Bromoenol lactone multiple interactions ISO ALOX5 (Homo sapiens) 6480464 1-oleoyl-2-acetoyl-sn-glycerol inhibits the reaction [6-(bromomethylene)tetrahydro-3-(1-naphthaleneyl)-2H-pyran-2-one inhibits the reaction [Calcimycin results in increased activity of and results in increased localization of ALOX5 protein]] and 6-(bromomethylene)tetrahydro-3-(1-naphthaleneyl)-2H-pyran-2-one inhibits the reaction [Calcimycin results in increased activity of and results in increased localization of ALOX5 protein] CTD PMID:18218859 Alox5 Rat butan-1-ol multiple interactions ISO ALOX5 (Homo sapiens) 6480464 1-Butanol inhibits the reaction [Calcimycin results in increased activity of and results in increased localization of ALOX5 protein] more ... CTD PMID:18218859 Alox5 Rat butanal increases expression ISO ALOX5 (Homo sapiens) 6480464 butyraldehyde results in increased expression of ALOX5 mRNA CTD PMID:26079696 Alox5 Rat butyric acid increases expression ISO ALOX5 (Homo sapiens) 6480464 Butyric Acid results in increased expression of ALOX5 mRNA CTD PMID:34581912 Alox5 Rat Calcimycin multiple interactions EXP 6480464 [[A 78773 co-treated with Calcimycin] results in decreased activity of ALOX5 protein] which results in decreased abundance of Leukotriene B4 more ... CTD PMID:11529688 more ... Alox5 Rat Calcimycin increases activity ISO ALOX5 (Homo sapiens) 6480464 Calcimycin results in increased activity of ALOX5 protein CTD PMID:11698504 and PMID:18475477 Alox5 Rat Calcimycin multiple interactions ISO ALOX5 (Homo sapiens) 6480464 1-Butanol inhibits the reaction [Calcimycin results in increased activity of and results in increased localization of ALOX5 protein] more ... CTD PMID:10779545 more ... Alox5 Rat Calcimycin increases expression EXP 6480464 Calcimycin results in increased expression of ALOX5 mRNA and Calcimycin results in increased expression of ALOX5 protein CTD PMID:18083043 Alox5 Rat calcitriol increases activity ISO ALOX5 (Homo sapiens) 6480464 Calcitriol analog results in increased activity of ALOX5 protein CTD PMID:10799658 Alox5 Rat calcitriol increases expression ISO ALOX5 (Homo sapiens) 6480464 Calcitriol results in increased expression of ALOX5 mRNA CTD PMID:16002434 more ... Alox5 Rat calcitriol multiple interactions ISO ALOX5 (Homo sapiens) 6480464 Benzo(a)pyrene promotes the reaction [Calcitriol results in increased expression of ALOX5 mRNA] CTD PMID:19244278 Alox5 Rat calcium atom multiple interactions ISO ALOX5 (Homo sapiens) 6480464 Calcium promotes the reaction [L 708714 binds to ALOX5 protein] CTD PMID:7577949 Alox5 Rat calcium(0) multiple interactions ISO ALOX5 (Homo sapiens) 6480464 Calcium promotes the reaction [L 708714 binds to ALOX5 protein] CTD PMID:7577949 Alox5 Rat cantharidin decreases expression ISO Alox5 (Mus musculus) 6480464 Cantharidin results in decreased expression of ALOX5 mRNA CTD PMID:36907384 Alox5 Rat capsaicin multiple interactions EXP 6480464 [Capsaicin co-treated with Curcumin] results in decreased activity of ALOX5 protein CTD PMID:16956363 Alox5 Rat capsaicin decreases activity EXP 6480464 Capsaicin results in decreased activity of ALOX5 protein CTD PMID:16956363 Alox5 Rat carbon nanotube decreases expression ISO Alox5 (Mus musculus) 6480464 Nanotubes and Carbon results in decreased expression of ALOX5 mRNA CTD PMID:25554681 Alox5 Rat celecoxib multiple interactions ISO Alox5 (Mus musculus) 6480464 Celecoxib inhibits the reaction [Butylated Hydroxytoluene affects the localization of ALOX5 protein] CTD PMID:12376474 Alox5 Rat cetirizine decreases activity ISO ALOX5 (Homo sapiens) 6480464 Cetirizine analog results in decreased activity of ALOX5 protein CTD PMID:15482930 Alox5 Rat CGP 52608 multiple interactions ISO ALOX5 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to ALOX5 gene] CTD PMID:28238834 Alox5 Rat choline multiple interactions ISO Alox5 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of ALOX5 mRNA CTD PMID:20938992 Alox5 Rat chromium(6+) affects expression ISO Alox5 (Mus musculus) 6480464 chromium hexavalent ion affects the expression of ALOX5 mRNA CTD PMID:28472532 Alox5 Rat cis-caffeic acid multiple interactions EXP 6480464 caffeic acid inhibits the reaction [[Oxygen deficiency co-treated with Glucose deficiency] affects the localization of ALOX5 protein] more ... CTD PMID:18951527 and PMID:27368151 Alox5 Rat cis-caffeic acid multiple interactions ISO Alox5 (Mus musculus) 6480464 caffeic acid inhibits the reaction [aluminum chloride results in increased expression of ALOX5 mRNA] and caffeic acid inhibits the reaction [aluminum chloride results in increased expression of ALOX5 protein] CTD PMID:18482095 Alox5 Rat cisplatin multiple interactions ISO ALOX5 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of ALOX5 mRNA CTD PMID:27392435 Alox5 Rat cisplatin increases expression ISO ALOX5 (Homo sapiens) 6480464 Cisplatin results in increased expression of ALOX5 mRNA CTD PMID:27392435 and PMID:27594783 Alox5 Rat coumarin increases expression EXP 6480464 coumarin results in increased expression of ALOX5 mRNA CTD PMID:18480146 Alox5 Rat Cuprizon decreases expression ISO ALOX5 (Homo sapiens) 6480464 Cuprizone results in decreased expression of ALOX5 protein CTD PMID:34122009 Alox5 Rat curcumin decreases activity EXP 6480464 Curcumin results in decreased activity of ALOX5 protein CTD PMID:16956363 Alox5 Rat curcumin multiple interactions EXP 6480464 [Capsaicin co-treated with Curcumin] results in decreased activity of ALOX5 protein CTD PMID:16956363 Alox5 Rat D-glucitol multiple interactions ISO ALOX5 (Homo sapiens) 6480464 [Sorbitol co-treated with Calcimycin co-treated with Arachidonic Acid] affects the localization of ALOX5 protein more ... CTD PMID:10779545 and PMID:11698504 Alox5 Rat D-glucose multiple interactions EXP 6480464 [Oxygen deficiency co-treated with Glucose deficiency] affects the localization of ALOX5 protein more ... CTD PMID:18951527 Alox5 Rat D-glucose increases expression ISO ALOX5 (Homo sapiens) 6480464 Glucose results in increased expression of ALOX5 mRNA CTD PMID:31655124 Alox5 Rat dexamethasone multiple interactions EXP 6480464 Dexamethasone inhibits the reaction [[CCL5 protein co-treated with Calcimycin] results in increased expression of ALOX5 protein] CTD PMID:18083043 Alox5 Rat dextran sulfate multiple interactions ISO Alox5 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of ALOX5 mRNA CTD PMID:29950665 Alox5 Rat Dibutyl phosphate affects expression ISO ALOX5 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of ALOX5 mRNA CTD PMID:37042841 Alox5 Rat dioxygen multiple interactions EXP 6480464 [Oxygen deficiency co-treated with Glucose deficiency] affects the localization of ALOX5 protein more ... CTD PMID:18951527 Alox5 Rat dioxygen increases expression ISO ALOX5 (Homo sapiens) 6480464 Oxygen deficiency results in increased expression of ALOX5 mRNA CTD PMID:26516004 Alox5 Rat dithiol decreases activity EXP 6480464 dithiol results in decreased activity of ALOX5 protein CTD PMID:3928952 Alox5 Rat docebenone decreases activity ISO ALOX5 (Homo sapiens) 6480464 2 more ... CTD PMID:2724698 Alox5 Rat docebenone decreases activity ISO Alox5 (Mus musculus) 6480464 2 more ... CTD PMID:25432964 and PMID:7812673 Alox5 Rat docebenone decreases activity EXP 6480464 2 more ... CTD PMID:2724698 Alox5 Rat dorsomorphin multiple interactions ISO ALOX5 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ALOX5 mRNA CTD PMID:27188386 Alox5 Rat doxorubicin increases expression ISO ALOX5 (Homo sapiens) 6480464 Doxorubicin results in increased expression of ALOX5 mRNA CTD PMID:30258081 Alox5 Rat doxorubicin multiple interactions ISO ALOX5 (Homo sapiens) 6480464 TP53 gene mutant form inhibits the reaction [Doxorubicin results in increased expression of ALOX5 mRNA] and TP53 protein promotes the reaction [Doxorubicin results in increased expression of ALOX5 mRNA] CTD PMID:30258081 Alox5 Rat ebselen decreases activity ISO ALOX5 (Homo sapiens) 6480464 ebselen results in decreased activity of ALOX5 protein CTD PMID:7590103 Alox5 Rat edaravone multiple interactions EXP 6480464 Edaravone inhibits the reaction [[Oxygen deficiency co-treated with Glucose deficiency] affects the localization of ALOX5 protein] and Edaravone inhibits the reaction [Hydrogen Peroxide affects the localization of ALOX5 protein] CTD PMID:18951527 Alox5 Rat elemental selenium multiple interactions EXP 6480464 [Vitamin E co-treated with Selenium] results in decreased expression of ALOX5 mRNA and [Vitamin E co-treated with Selenium] results in decreased expression of ALOX5 protein CTD PMID:22223226 Alox5 Rat endosulfan increases expression ISO ALOX5 (Homo sapiens) 6480464 Endosulfan results in increased expression of ALOX5 mRNA CTD PMID:26615145 Alox5 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of ALOX5 mRNA CTD PMID:29391264 Alox5 Rat entinostat increases expression ISO ALOX5 (Homo sapiens) 6480464 entinostat results in increased expression of ALOX5 mRNA CTD PMID:27188386 Alox5 Rat ethoxyquin decreases activity EXP 6480464 Ethoxyquin results in decreased activity of ALOX5 protein CTD PMID:3928952 Alox5 Rat flavonoids increases expression EXP 6480464 Flavonoids results in increased expression of ALOX5 mRNA CTD PMID:18035473 Alox5 Rat folic acid multiple interactions ISO Alox5 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of ALOX5 mRNA CTD PMID:20938992 Alox5 Rat fructose increases expression ISO ALOX5 (Homo sapiens) 6480464 Fructose results in increased expression of ALOX5 mRNA CTD PMID:31655124 Alox5 Rat furan increases expression EXP 6480464 furan results in increased expression of ALOX5 mRNA CTD PMID:27387713 Alox5 Rat glucose multiple interactions EXP 6480464 [Oxygen deficiency co-treated with Glucose deficiency] affects the localization of ALOX5 protein more ... CTD PMID:18951527 Alox5 Rat glucose increases expression ISO ALOX5 (Homo sapiens) 6480464 Glucose results in increased expression of ALOX5 mRNA CTD PMID:31655124 Alox5 Rat histamine multiple interactions ISO ALOX5 (Homo sapiens) 6480464 ALOX5 protein results in increased susceptibility to [Histamine results in increased abundance of Leukotriene B4] and zileuton inhibits the reaction [ALOX5 protein results in increased susceptibility to [Histamine results in increased abundance of Leukotriene B4]] CTD PMID:9609743 Alox5 Rat hydrogen peroxide multiple interactions ISO ALOX5 (Homo sapiens) 6480464 [Hydrogen Peroxide results in increased activity of ALOX5 protein] which results in increased chemical synthesis of Leukotriene B4 more ... CTD PMID:10491155 and PMID:10698703 Alox5 Rat hydrogen peroxide decreases activity EXP 6480464 Hydrogen Peroxide results in decreased activity of ALOX5 protein CTD PMID:12388339 Alox5 Rat hydrogen peroxide affects localization EXP 6480464 Hydrogen Peroxide affects the localization of ALOX5 protein CTD PMID:18951527 Alox5 Rat hydrogen peroxide multiple interactions EXP 6480464 baicalin inhibits the reaction [Hydrogen Peroxide affects the localization of and results in increased activity of ALOX5 protein] more ... CTD PMID:18951527 and PMID:20139896 Alox5 Rat hydrogen peroxide increases activity ISO ALOX5 (Homo sapiens) 6480464 Hydrogen Peroxide results in increased activity of ALOX5 protein CTD PMID:10491155 Alox5 Rat hydroxamic acid decreases activity EXP 6480464 Hydroxamic Acids analog results in decreased activity of ALOX5 protein CTD PMID:7922131 Alox5 Rat hydroxyurea multiple interactions ISO ALOX5 (Homo sapiens) 6480464 Hydroxyurea inhibits the reaction [L 708714 binds to ALOX5 protein] CTD PMID:7577949 Alox5 Rat indometacin multiple interactions EXP 6480464 [tepoxalin results in decreased activity of ALOX5 protein] inhibits the reaction [Indomethacin results in increased abundance of Leukotriene B4] more ... CTD PMID:35446470 and PMID:9223651 Alox5 Rat indometacin decreases activity EXP 6480464 Indomethacin results in decreased activity of ALOX5 protein CTD PMID:3928952 Alox5 Rat kaempferol multiple interactions ISO ALOX5 (Homo sapiens) 6480464 kaempferol inhibits the reaction [ALOX5 protein results in increased chemical synthesis of Leukotriene B4] CTD PMID:18096136 Alox5 Rat L-methionine multiple interactions ISO Alox5 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of ALOX5 mRNA CTD PMID:20938992 Alox5 Rat lead diacetate multiple interactions EXP 6480464 [lead acetate results in increased abundance of Lead] which results in increased expression of ALOX5 mRNA CTD PMID:39276841 Alox5 Rat lead(0) multiple interactions EXP 6480464 [lead acetate results in increased abundance of Lead] which results in increased expression of ALOX5 mRNA CTD PMID:39276841 Alox5 Rat leukotriene A4 increases chemical synthesis ISO ALOX5 (Homo sapiens) 6480464 ALOX5 protein results in increased chemical synthesis of Leukotriene A4 CTD PMID:18295198 Alox5 Rat leukotriene B4 multiple interactions ISO ALOX5 (Homo sapiens) 6480464 [benoxaprofen results in decreased activity of ALOX5 protein] which results in decreased chemical synthesis of Leukotriene B4 more ... CTD PMID:10491155 more ... Alox5 Rat leukotriene B4 increases chemical synthesis ISO ALOX5 (Homo sapiens) 6480464 ALOX5 protein results in increased chemical synthesis of Leukotriene B4 CTD PMID:18096136 Alox5 Rat leukotriene B4 multiple interactions EXP 6480464 [[A 78773 co-treated with Calcimycin] results in decreased activity of ALOX5 protein] which results in decreased abundance of Leukotriene B4 more ... CTD PMID:10694244 more ... Alox5 Rat leukotriene B4 multiple interactions ISO Alox5 (Mus musculus) 6480464 [zileuton results in decreased activity of ALOX5 protein] which results in decreased abundance of Leukotriene B4 more ... CTD PMID:12794006 and PMID:9593866 Alox5 Rat leukotriene B4 increases secretion ISO ALOX5 (Homo sapiens) 6480464 ALOX5 protein results in increased secretion of Leukotriene B4 CTD PMID:11325678 Alox5 Rat leukotriene C4 multiple interactions ISO ALOX5 (Homo sapiens) 6480464 [zileuton results in decreased activity of ALOX5 protein] inhibits the reaction [N-Formylmethionine Leucyl-Phenylalanine results in increased abundance of Leukotriene C4] and [zileuton results in decreased activity of ALOX5 protein] which results in decreased abundance of Leukotriene C4 CTD PMID:10764316 and PMID:9495842 Alox5 Rat leukotriene C4 multiple interactions EXP 6480464 [Calcimycin results in increased activity of and results in increased localization of ALOX5 protein] which results in increased abundance of Leukotriene C4 CTD PMID:9445378 Alox5 Rat leukotriene C4 multiple interactions ISO Alox5 (Mus musculus) 6480464 ALOX5 protein promotes the reaction [Ovalbumin results in increased abundance of Leukotriene C4] and zileuton inhibits the reaction [ALOX5 protein promotes the reaction [Ovalbumin results in increased abundance of Leukotriene C4]] CTD PMID:12794006 Alox5 Rat leukotriene D4 increases abundance ISO ALOX5 (Homo sapiens) 6480464 ALOX5 protein results in increased abundance of Leukotriene D4 CTD PMID:12629151 Alox5 Rat leukotriene D4 multiple interactions ISO Alox5 (Mus musculus) 6480464 ALOX5 protein promotes the reaction [Ovalbumin results in increased abundance of Leukotriene D4] and zileuton inhibits the reaction [ALOX5 protein promotes the reaction [Ovalbumin results in increased abundance of Leukotriene D4]] CTD PMID:12794006 Alox5 Rat leukotriene D4 multiple interactions ISO ALOX5 (Homo sapiens) 6480464 [zileuton results in decreased activity of ALOX5 protein] which results in decreased abundance of Leukotriene D4 CTD PMID:10764316 Alox5 Rat leukotriene E4 multiple interactions ISO Alox5 (Mus musculus) 6480464 ALOX5 protein promotes the reaction [Ovalbumin results in increased abundance of Leukotriene E4] and zileuton inhibits the reaction [ALOX5 protein promotes the reaction [Ovalbumin results in increased abundance of Leukotriene E4]] CTD PMID:12794006 Alox5 Rat leukotriene E4 multiple interactions ISO ALOX5 (Homo sapiens) 6480464 [zileuton results in decreased activity of ALOX5 protein] which results in decreased abundance of Leukotriene E4 CTD PMID:10764316 and PMID:8621850 Alox5 Rat lipopolysaccharide multiple interactions ISO ALOX5 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:10779545 more ... Alox5 Rat lipopolysaccharide increases expression ISO ALOX5 (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of ALOX5 mRNA CTD PMID:21877189 Alox5 Rat lipopolysaccharide increases expression ISO Alox5 (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of ALOX5 mRNA and Lipopolysaccharides results in increased expression of ALOX5 protein CTD PMID:19896470 and PMID:20453108 Alox5 Rat lipopolysaccharide multiple interactions ISO Alox5 (Mus musculus) 6480464 EPHX2 gene mutant form inhibits the reaction [Lipopolysaccharides results in increased expression of ALOX5 protein] more ... CTD PMID:19896470 Alox5 Rat lipoxin A4 multiple interactions EXP 6480464 zileuton inhibits the reaction [ALOX5 protein affects the abundance of lipoxin A4] CTD PMID:15326064 Alox5 Rat lipoxin A4 affects abundance EXP 6480464 ALOX5 protein affects the abundance of lipoxin A4 CTD PMID:15326064 Alox5 Rat lonapalene multiple interactions ISO ALOX5 (Homo sapiens) 6480464 [RS 43179 results in decreased activity of ALOX5 protein] which results in decreased chemical synthesis of Leukotriene B4 more ... CTD PMID:2849922 Alox5 Rat lonapalene decreases activity ISO ALOX5 (Homo sapiens) 6480464 RS 43179 results in decreased activity of ALOX5 protein CTD PMID:2849922 Alox5 Rat loratadine decreases activity ISO ALOX5 (Homo sapiens) 6480464 Loratadine analog results in decreased activity of ALOX5 protein CTD PMID:15482930 Alox5 Rat losartan decreases expression EXP 6480464 Losartan results in decreased expression of ALOX5 protein CTD PMID:21377515 Alox5 Rat lupeol multiple interactions EXP 6480464 lupeol inhibits the reaction [COL2A1 results in increased activity of ALOX5 protein] CTD PMID:35446470 Alox5 Rat luteolin multiple interactions ISO ALOX5 (Homo sapiens) 6480464 Luteolin inhibits the reaction [ALOX5 protein results in increased chemical synthesis of Leukotriene B4] CTD PMID:18096136 Alox5 Rat masoprocol multiple interactions ISO ALOX5 (Homo sapiens) 6480464 [Masoprocol results in decreased activity of ALOX5 protein] which results in decreased chemical synthesis of Leukotriene B4 more ... CTD PMID:10698703 and PMID:2849922 Alox5 Rat masoprocol multiple interactions EXP 6480464 Masoprocol inhibits the reaction [[CCL5 protein co-treated with Calcimycin] results in increased expression of ALOX5 mRNA] and Masoprocol inhibits the reaction [[CCL5 protein co-treated with Calcimycin] results in increased expression of ALOX5 protein] CTD PMID:18083043 Alox5 Rat masoprocol decreases activity ISO ALOX5 (Homo sapiens) 6480464 Masoprocol results in decreased activity of ALOX5 protein CTD PMID:10698703 more ... Alox5 Rat masoprocol affects response to substance ISO ALOX5 (Homo sapiens) 6480464 ALOX5 protein affects the susceptibility to Masoprocol CTD PMID:19503098 Alox5 Rat masoprocol decreases activity EXP 6480464 Masoprocol results in decreased activity of ALOX5 protein CTD PMID:2724698 and PMID:3928952 Alox5 Rat meclofenamic acid decreases activity ISO ALOX5 (Homo sapiens) 6480464 Meclofenamic Acid results in decreased activity of ALOX5 protein CTD PMID:3020588 Alox5 Rat melittin increases activity ISO ALOX5 (Homo sapiens) 6480464 Melitten results in increased activity of ALOX5 protein CTD PMID:18475477 Alox5 Rat methotrexate affects response to substance ISO ALOX5 (Homo sapiens) 6480464 ALOX5 protein affects the susceptibility to Methotrexate CTD PMID:16217747 Alox5 Rat methylmercury chloride decreases expression ISO ALOX5 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of ALOX5 mRNA CTD PMID:28001369 Alox5 Rat microcystin-LR increases expression ISO Alox5 (Mus musculus) 6480464 cyanoginosin LR results in increased expression of ALOX5 mRNA CTD PMID:37342990 Alox5 Rat miquelianin multiple interactions ISO ALOX5 (Homo sapiens) 6480464 quercetin 3-O-glucuronide inhibits the reaction [ALOX5 protein results in increased chemical synthesis of Leukotriene B4] CTD PMID:18096136 Alox5 Rat montelukast affects response to substance ISO ALOX5 (Homo sapiens) 6480464 ALOX5 gene SNP affects the susceptibility to montelukast CTD PMID:16293801 Alox5 Rat N-formyl-L-methionyl-L-leucyl-L-phenylalanine multiple interactions ISO ALOX5 (Homo sapiens) 6480464 [zileuton results in decreased activity of ALOX5 protein] inhibits the reaction [N-Formylmethionine Leucyl-Phenylalanine results in increased abundance of Leukotriene C4] more ... CTD PMID:10779545 more ... Alox5 Rat N-nitrosodiethylamine increases expression ISO Alox5 (Mus musculus) 6480464 Diethylnitrosamine results in increased expression of ALOX5 mRNA CTD PMID:24535843 Alox5 Rat nickel atom increases expression ISO ALOX5 (Homo sapiens) 6480464 Nickel results in increased expression of ALOX5 mRNA CTD PMID:24768652 and PMID:25583101 Alox5 Rat niclosamide increases expression ISO ALOX5 (Homo sapiens) 6480464 Niclosamide results in increased expression of ALOX5 mRNA CTD PMID:30258081 Alox5 Rat niclosamide decreases response to substance ISO ALOX5 (Homo sapiens) 6480464 ALOX5 protein results in decreased susceptibility to Niclosamide CTD PMID:30258081 Alox5 Rat niclosamide multiple interactions ISO ALOX5 (Homo sapiens) 6480464 TP53 gene mutant form inhibits the reaction [Niclosamide results in increased expression of ALOX5 mRNA] and TP53 protein mutant form inhibits the reaction [Niclosamide results in increased expression of ALOX5 mRNA] CTD PMID:30258081 Alox5 Rat niclosamide increases expression ISO Alox5 (Mus musculus) 6480464 Niclosamide results in increased expression of ALOX5 mRNA CTD PMID:30258081 Alox5 Rat nicotine multiple interactions ISO ALOX5 (Homo sapiens) 6480464 [RTKI cpd co-treated with AG 1879] inhibits the reaction [Nicotine results in increased expression of ALOX5 protein] more ... CTD PMID:14569062 and PMID:20061081 Alox5 Rat nicotine increases expression ISO ALOX5 (Homo sapiens) 6480464 Nicotine results in increased expression of ALOX5 mRNA and Nicotine results in increased expression of ALOX5 protein CTD PMID:14569062 and PMID:20061081 Alox5 Rat nitric oxide multiple interactions EXP 6480464 Nitric Oxide promotes the reaction [Reactive Oxygen Species results in decreased activity of ALOX5 protein] CTD PMID:12388339 Alox5 Rat Nutlin-3 multiple interactions ISO ALOX5 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of ALOX5 mRNA CTD PMID:38460933 Alox5 Rat Nutlin-3 increases expression ISO ALOX5 (Homo sapiens) 6480464 nutlin 3 results in increased expression of ALOX5 mRNA CTD PMID:38460933 Alox5 Rat O-methyleugenol increases expression ISO ALOX5 (Homo sapiens) 6480464 methyleugenol results in increased expression of ALOX5 mRNA CTD PMID:32234424 Alox5 Rat ochratoxin A decreases expression ISO ALOX5 (Homo sapiens) 6480464 ochratoxin A results in decreased expression of ALOX5 mRNA CTD PMID:26505656 Alox5 Rat ochratoxin A affects expression ISO ALOX5 (Homo sapiens) 6480464 ochratoxin A affects the expression of ALOX5 mRNA CTD PMID:26505656 Alox5 Rat oxaliplatin increases expression EXP 6480464 oxaliplatin results in increased expression of ALOX5 mRNA CTD PMID:25729387 Alox5 Rat ozone multiple interactions ISO ALOX5 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of ALOX5 mRNA CTD PMID:35430440 Alox5 Rat paracetamol affects expression ISO Alox5 (Mus musculus) 6480464 Acetaminophen affects the expression of ALOX5 mRNA CTD PMID:17562736 Alox5 Rat paraquat increases expression ISO Alox5 (Mus musculus) 6480464 Paraquat results in increased expression of ALOX5 mRNA CTD PMID:28012437 Alox5 Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of ALOX5 mRNA CTD PMID:32680482 Alox5 Rat pentanal increases expression ISO ALOX5 (Homo sapiens) 6480464 pentanal results in increased expression of ALOX5 mRNA CTD PMID:26079696 Alox5 Rat peroxynitrous acid decreases activity EXP 6480464 Peroxynitrous Acid results in decreased activity of ALOX5 protein CTD PMID:12388339 Alox5 Rat peroxynitrous acid multiple interactions EXP 6480464 Peroxynitrous Acid results in increased nitrosation of and affects the expression of ALOX5 protein and zileuton inhibits the reaction [Peroxynitrous Acid results in increased nitrosation of ALOX5 protein] CTD PMID:11561080 Alox5 Rat PhIP decreases expression ISO ALOX5 (Homo sapiens) 6480464 2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in decreased expression of ALOX5 mRNA CTD PMID:20816883 Alox5 Rat phorbol 13-acetate 12-myristate multiple interactions ISO ALOX5 (Homo sapiens) 6480464 [Tetradecanoylphorbol Acetate co-treated with Calcimycin] affects the localization of ALOX5 protein more ... CTD PMID:10779545 and PMID:11698504 Alox5 Rat pirinixic acid decreases activity ISO ALOX5 (Homo sapiens) 6480464 pirinixic acid analog results in decreased activity of ALOX5 protein CTD PMID:18710209 more ... Alox5 Rat poly(propylene imine) macromolecule decreases expression ISO ALOX5 (Homo sapiens) 6480464 poly(propyleneimine) analog results in decreased expression of ALOX5 mRNA CTD PMID:16308212 Alox5 Rat pregnenolone 16alpha-carbonitrile decreases expression ISO Alox5 (Mus musculus) 6480464 Pregnenolone Carbonitrile results in decreased expression of ALOX5 mRNA CTD PMID:22698814 Alox5 Rat propanal increases expression ISO ALOX5 (Homo sapiens) 6480464 propionaldehyde results in increased expression of ALOX5 mRNA CTD PMID:26079696 Alox5 Rat propranolol multiple interactions ISO ALOX5 (Homo sapiens) 6480464 1-oleoyl-2-acetoyl-sn-glycerol inhibits the reaction [Propranolol inhibits the reaction [Calcimycin results in increased activity of and results in increased localization of ALOX5 protein]] and Propranolol inhibits the reaction [Calcimycin results in increased activity of and results in increased localization of ALOX5 protein] CTD PMID:18218859 Alox5 Rat quercetin multiple interactions ISO ALOX5 (Homo sapiens) 6480464 Quercetin inhibits the reaction [ALOX5 protein results in increased chemical synthesis of Leukotriene B4] CTD PMID:18096136 Alox5 Rat quercetin 3-sulfate multiple interactions ISO ALOX5 (Homo sapiens) 6480464 quercetin 3'-sulfate inhibits the reaction [ALOX5 protein results in increased chemical synthesis of Leukotriene B4] CTD PMID:18096136 Alox5 Rat raloxifene multiple interactions ISO Alox5 (Mus musculus) 6480464 [APC protein affects the susceptibility to Raloxifene Hydrochloride] which affects the expression of ALOX5 mRNA CTD PMID:24431404 Alox5 Rat reactive oxygen species decreases activity EXP 6480464 Reactive Oxygen Species results in decreased activity of ALOX5 protein CTD PMID:12388339 Alox5 Rat reactive oxygen species multiple interactions EXP 6480464 Nitric Oxide promotes the reaction [Reactive Oxygen Species results in decreased activity of ALOX5 protein] CTD PMID:12388339 Alox5 Rat rebaudioside A increases expression ISO ALOX5 (Homo sapiens) 6480464 rebaudioside A results in increased expression of ALOX5 mRNA CTD PMID:31655124 Alox5 Rat resveratrol multiple interactions ISO ALOX5 (Homo sapiens) 6480464 resveratrol binds to and results in decreased activity of ALOX5 protein and resveratrol inhibits the reaction [[Hydrogen Peroxide results in increased activity of ALOX5 protein] which results in increased chemical synthesis of Leukotriene B4] CTD PMID:10491155 Alox5 Rat resveratrol decreases expression ISO Alox5 (Mus musculus) 6480464 Resveratrol results in decreased expression of ALOX5 protein CTD PMID:23751068 Alox5 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO ALOX5 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Alox5 Rat S-(1,2-dichlorovinyl)-L-cysteine decreases expression ISO ALOX5 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in decreased expression of ALOX5 mRNA CTD PMID:35811015 Alox5 Rat SB 203580 multiple interactions ISO ALOX5 (Homo sapiens) 6480464 SB 203580 inhibits the reaction [Calcimycin results in increased phosphorylation of and results in increased activity of ALOX5 protein] more ... CTD PMID:10779545 Alox5 Rat SB 203580 multiple interactions EXP 6480464 SB 203580 inhibits the reaction [[Oxygen deficiency co-treated with Glucose deficiency] affects the localization of ALOX5 protein] and SB 203580 inhibits the reaction [Hydrogen Peroxide affects the localization of ALOX5 protein] CTD PMID:18951527 Alox5 Rat SB 203580 multiple interactions ISO Alox5 (Mus musculus) 6480464 SB 203580 inhibits the reaction [2-chloroethyl ethyl sulfide results in increased expression of ALOX5 mRNA] CTD PMID:20382172 Alox5 Rat SB 431542 multiple interactions ISO ALOX5 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ALOX5 mRNA CTD PMID:27188386 Alox5 Rat selenium atom multiple interactions EXP 6480464 [Vitamin E co-treated with Selenium] results in decreased expression of ALOX5 mRNA and [Vitamin E co-treated with Selenium] results in decreased expression of ALOX5 protein CTD PMID:22223226 Alox5 Rat silicon dioxide decreases expression ISO ALOX5 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of ALOX5 mRNA CTD PMID:25895662 Alox5 Rat silicon dioxide increases expression EXP 6480464 Silicon Dioxide results in increased expression of ALOX5 mRNA CTD PMID:21602193 Alox5 Rat sodium arsenite increases expression ISO Alox5 (Mus musculus) 6480464 sodium arsenite results in increased expression of ALOX5 mRNA CTD PMID:25065748 Alox5 Rat sodium arsenite decreases expression ISO Alox5 (Mus musculus) 6480464 sodium arsenite results in decreased expression of ALOX5 mRNA CTD PMID:37682722 Alox5 Rat sodium arsenite decreases expression ISO ALOX5 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of ALOX5 mRNA CTD PMID:34032870 Alox5 Rat sodium arsenite multiple interactions ISO ALOX5 (Homo sapiens) 6480464 [sodium arsenite co-treated with Platelet Activating Factor co-treated with Arachidonic Acid] results in increased phosphorylation of and results in increased activity of ALOX5 protein more ... CTD PMID:10779545 Alox5 Rat sodium chloride multiple interactions EXP 6480464 [AGT protein co-treated with Sodium Chloride] affects the expression of ALOX5 mRNA CTD PMID:27225954 Alox5 Rat sodium dichromate decreases expression ISO ALOX5 (Homo sapiens) 6480464 sodium bichromate results in decreased expression of ALOX5 mRNA CTD PMID:17685462 Alox5 Rat steviol increases expression ISO ALOX5 (Homo sapiens) 6480464 steviol results in increased expression of ALOX5 mRNA CTD PMID:31655124 Alox5 Rat stevioside increases expression ISO ALOX5 (Homo sapiens) 6480464 stevioside results in increased expression of ALOX5 mRNA CTD PMID:31655124 Alox5 Rat sunitinib increases expression ISO ALOX5 (Homo sapiens) 6480464 Sunitinib results in increased expression of ALOX5 mRNA CTD PMID:31533062 Alox5 Rat tamoxifen multiple interactions ISO ALOX5 (Homo sapiens) 6480464 [Tamoxifen results in increased expression of ALOX5 protein] which results in increased abundance of Leukotriene B4 CTD PMID:9742967 Alox5 Rat tamoxifen increases expression ISO ALOX5 (Homo sapiens) 6480464 Tamoxifen results in increased expression of ALOX5 protein CTD PMID:9742967 Alox5 Rat tenidap decreases activity ISO ALOX5 (Homo sapiens) 6480464 tenidap results in decreased activity of ALOX5 protein CTD PMID:2849922 Alox5 Rat tenidap multiple interactions ISO ALOX5 (Homo sapiens) 6480464 [tenidap results in decreased activity of ALOX5 protein] which results in decreased chemical synthesis of Leukotriene B4 more ... CTD PMID:2849922 Alox5 Rat tepoxalin multiple interactions EXP 6480464 [tepoxalin results in decreased activity of ALOX5 protein] inhibits the reaction [Indomethacin results in increased abundance of Leukotriene B4] CTD PMID:9223651 Alox5 Rat tepoxalin decreases activity EXP 6480464 tepoxalin results in decreased activity of ALOX5 protein CTD PMID:9223651 Alox5 Rat tepoxalin decreases activity ISO ALOX5 (Homo sapiens) 6480464 tepoxalin results in decreased activity of ALOX5 protein CTD PMID:12629151 Alox5 Rat tert-butanol multiple interactions ISO ALOX5 (Homo sapiens) 6480464 tert-Butyl Alcohol inhibits the reaction [Calcimycin results in increased activity of and results in increased localization of ALOX5 protein] CTD PMID:18218859 Alox5 Rat tert-butyl hydroperoxide decreases expression ISO ALOX5 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of ALOX5 mRNA CTD PMID:15336504 Alox5 Rat testosterone multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of ALOX5 mRNA CTD PMID:32741896 Alox5 Rat tetrachloromethane multiple interactions EXP 6480464 2-(4-(quinolin-2-yl-methoxy)phenyl)-2-cyclopentylacetic acid inhibits the reaction [Carbon Tetrachloride results in increased expression of ALOX5 protein] CTD PMID:16033810 Alox5 Rat tetrachloromethane increases expression ISO Alox5 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of ALOX5 protein CTD PMID:25432964 Alox5 Rat tetrachloromethane multiple interactions ISO Alox5 (Mus musculus) 6480464 PTGS1 gene mutant form promotes the reaction [Carbon Tetrachloride results in increased expression of ALOX5 protein] and SC 560 promotes the reaction [Carbon Tetrachloride results in increased expression of ALOX5 protein] CTD PMID:25432964 Alox5 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of ALOX5 protein CTD PMID:16033810 Alox5 Rat tetraphene increases expression ISO Alox5 (Mus musculus) 6480464 benz(a)anthracene results in increased expression of ALOX5 mRNA CTD PMID:26377693 Alox5 Rat thapsigargin multiple interactions ISO ALOX5 (Homo sapiens) 6480464 1-Butanol inhibits the reaction [Thapsigargin results in increased activity of and results in increased localization of ALOX5 protein] more ... CTD PMID:10779545 and PMID:18218859 Alox5 Rat thimerosal decreases expression ISO ALOX5 (Homo sapiens) 6480464 Thimerosal results in decreased expression of ALOX5 mRNA CTD PMID:27188386 Alox5 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of ALOX5 mRNA CTD PMID:34492290 Alox5 Rat titanium dioxide decreases expression ISO Alox5 (Mus musculus) 6480464 titanium dioxide results in decreased expression of ALOX5 mRNA CTD PMID:27760801 Alox5 Rat titanium dioxide increases expression ISO Alox5 (Mus musculus) 6480464 titanium dioxide results in increased expression of ALOX5 mRNA CTD PMID:35295148 Alox5 Rat titanium dioxide decreases methylation ISO Alox5 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of ALOX5 gene CTD PMID:35295148 Alox5 Rat titanium dioxide multiple interactions ISO Alox5 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of ALOX5 mRNA CTD PMID:29950665 Alox5 Rat trans-caffeic acid multiple interactions EXP 6480464 caffeic acid inhibits the reaction [[Oxygen deficiency co-treated with Glucose deficiency] affects the localization of ALOX5 protein] more ... CTD PMID:18951527 and PMID:27368151 Alox5 Rat trans-caffeic acid multiple interactions ISO Alox5 (Mus musculus) 6480464 caffeic acid inhibits the reaction [aluminum chloride results in increased expression of ALOX5 mRNA] and caffeic acid inhibits the reaction [aluminum chloride results in increased expression of ALOX5 protein] CTD PMID:18482095 Alox5 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of ALOX5 mRNA CTD PMID:33387578 Alox5 Rat triclosan increases expression ISO ALOX5 (Homo sapiens) 6480464 Triclosan results in increased expression of ALOX5 mRNA CTD PMID:30510588 Alox5 Rat trimellitic anhydride decreases expression ISO Alox5 (Mus musculus) 6480464 trimellitic anhydride results in decreased expression of ALOX5 mRNA CTD PMID:19042947 Alox5 Rat triphenyl phosphate affects expression ISO ALOX5 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of ALOX5 mRNA CTD PMID:37042841 Alox5 Rat troglitazone decreases activity EXP 6480464 troglitazone results in decreased activity of ALOX5 protein CTD PMID:10694244 and PMID:17113579 Alox5 Rat troglitazone multiple interactions EXP 6480464 [troglitazone results in decreased activity of ALOX5 protein] which results in decreased abundance of Leukotriene B4 CTD PMID:10694244 Alox5 Rat tyrphostin AG 1478 multiple interactions ISO ALOX5 (Homo sapiens) 6480464 [RTKI cpd co-treated with AG 1879] inhibits the reaction [Nicotine results in increased expression of ALOX5 protein] and RTKI cpd inhibits the reaction [Nicotine results in increased expression of ALOX5 protein] CTD PMID:14569062 Alox5 Rat tyrphostin AG 1478 multiple interactions ISO Alox5 (Mus musculus) 6480464 RTKI cpd inhibits the reaction [Acrolein results in increased expression of ALOX5 protein] CTD PMID:20153347 Alox5 Rat valproic acid increases methylation ISO ALOX5 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of ALOX5 gene CTD PMID:29154799 Alox5 Rat valproic acid multiple interactions ISO ALOX5 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ALOX5 mRNA CTD PMID:27188386 Alox5 Rat valproic acid increases expression ISO ALOX5 (Homo sapiens) 6480464 Valproic Acid results in increased expression of ALOX5 mRNA CTD PMID:23179753 more ... Alox5 Rat vitamin E multiple interactions EXP 6480464 [Vitamin E co-treated with Selenium] results in decreased expression of ALOX5 mRNA and [Vitamin E co-treated with Selenium] results in decreased expression of ALOX5 protein CTD PMID:22223226 Alox5 Rat vitamin E decreases activity ISO ALOX5 (Homo sapiens) 6480464 Vitamin E results in decreased activity of ALOX5 protein CTD PMID:11325678 and PMID:12200813 Alox5 Rat zileuton multiple interactions ISO ALOX5 (Homo sapiens) 6480464 [zileuton results in decreased activity of ALOX5 protein] inhibits the reaction [Calcimycin results in increased abundance of Platelet Activating Factor] more ... CTD PMID:10698703 more ... Alox5 Rat zileuton decreases activity EXP 6480464 zileuton results in decreased activity of ALOX5 protein CTD PMID:10694244 more ... Alox5 Rat zileuton affects response to substance ISO ALOX5 (Homo sapiens) 6480464 ALOX5 gene SNP affects the susceptibility to zileuton CTD PMID:19214143 Alox5 Rat zileuton decreases activity ISO ALOX5 (Homo sapiens) 6480464 zileuton results in decreased activity of ALOX5 protein CTD PMID:10377029 more ... Alox5 Rat zileuton decreases expression EXP 6480464 zileuton results in decreased expression of ALOX5 mRNA CTD PMID:19309543 Alox5 Rat zileuton multiple interactions EXP 6480464 [[zileuton co-treated with Calcimycin] results in decreased activity of ALOX5 protein] which results in decreased abundance of Leukotriene B4 more ... CTD PMID:10694244 more ... Alox5 Rat zileuton multiple interactions ISO Alox5 (Mus musculus) 6480464 [zileuton results in decreased activity of ALOX5 protein] which results in decreased abundance of Leukotriene B4 more ... CTD PMID:11694324 more ... Alox5 Rat zileuton decreases activity ISO Alox5 (Mus musculus) 6480464 zileuton results in decreased activity of ALOX5 protein CTD PMID:11694324 more ... Alox5 Rat zinc atom increases expression ISO ALOX5 (Homo sapiens) 6480464 Zinc deficiency results in increased expression of ALOX5 mRNA CTD PMID:22171008 Alox5 Rat zinc(0) increases expression ISO ALOX5 (Homo sapiens) 6480464 Zinc deficiency results in increased expression of ALOX5 mRNA CTD PMID:22171008 Alox5 Rat zoledronic acid increases expression ISO ALOX5 (Homo sapiens) 6480464 zoledronic acid results in increased expression of ALOX5 mRNA CTD PMID:24714768
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(4Z,7Z,10Z,13Z,15E,19Z)-17-hydroxydocosahexaenoic acid (ISO) (5Z,8Z,11Z,13E)-15-HETE (ISO) (S)-nicotine (ISO) 1,2-dimethylhydrazine (ISO) 1-O-palmitoyl-2-O-(5-oxovaleryl)-sn-glycero-3-phosphocholine (ISO) 1-octadec-9-enoylglycero-3-phosphate (ISO) 17beta-estradiol (EXP,ISO) 17beta-estradiol 3-benzoate (EXP) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,6-di-tert-butyl-4-methylphenol (ISO) 2-acetyl-1-alkyl-sn-glycero-3-phosphocholine (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3-[3-(tert-butylsulfanyl)-1-(4-chlorobenzyl)-5-(propan-2-yl)-1H-indol-2-yl]-2,2-dimethylpropanoic acid (EXP,ISO) 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione (ISO) 4-hydroxycyclophosphamide (EXP) 4-hydroxynon-2-enal (ISO) acetamide (EXP) acrolein (ISO) acrylamide (EXP) actinomycin D (ISO) afimoxifene (EXP) aflatoxin B1 (EXP,ISO) aldehydo-D-glucose (EXP,ISO) all-trans-retinoic acid (ISO) aluminium atom (EXP) aluminium(0) (EXP) ammonium chloride (EXP) amphotericin B (ISO) anthra[1,9-cd]pyrazol-6(2H)-one (ISO) antirheumatic drug (ISO) arachidonic acid (ISO) aristolochic acid A (EXP) arsane (ISO) arsenic atom (ISO) Azoxymethane (ISO) baicalin (EXP) benoxaprofen (EXP,ISO) benzene (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) beta-D-glucosamine 6-sulfate (ISO) beta-naphthoflavone (ISO) bisphenol A (EXP,ISO) Bromoenol lactone (ISO) butan-1-ol (ISO) butanal (ISO) butyric acid (ISO) Calcimycin (EXP,ISO) calcitriol (ISO) calcium atom (ISO) calcium(0) (ISO) cantharidin (ISO) capsaicin (EXP) carbon nanotube (ISO) celecoxib (ISO) cetirizine (ISO) CGP 52608 (ISO) choline (ISO) chromium(6+) (ISO) cis-caffeic acid (EXP,ISO) cisplatin (ISO) coumarin (EXP) Cuprizon (ISO) curcumin (EXP) D-glucitol (ISO) D-glucose (EXP,ISO) dexamethasone (EXP) dextran sulfate (ISO) Dibutyl phosphate (ISO) dioxygen (EXP,ISO) dithiol (EXP) docebenone (EXP,ISO) dorsomorphin (ISO) doxorubicin (ISO) ebselen (ISO) edaravone (EXP) elemental selenium (EXP) endosulfan (EXP,ISO) entinostat (ISO) ethoxyquin (EXP) flavonoids (EXP) folic acid (ISO) fructose (ISO) furan (EXP) glucose (EXP,ISO) histamine (ISO) hydrogen peroxide (EXP,ISO) hydroxamic acid (EXP) hydroxyurea (ISO) indometacin (EXP) kaempferol (ISO) L-methionine (ISO) lead diacetate (EXP) lead(0) (EXP) leukotriene A4 (ISO) leukotriene B4 (EXP,ISO) leukotriene C4 (EXP,ISO) leukotriene D4 (ISO) leukotriene E4 (ISO) lipopolysaccharide (ISO) lipoxin A4 (EXP) lonapalene (ISO) loratadine (ISO) losartan (EXP) lupeol (EXP) luteolin (ISO) masoprocol (EXP,ISO) meclofenamic acid (ISO) melittin (ISO) methotrexate (ISO) methylmercury chloride (ISO) microcystin-LR (ISO) miquelianin (ISO) montelukast (ISO) N-formyl-L-methionyl-L-leucyl-L-phenylalanine (ISO) N-nitrosodiethylamine (ISO) nickel atom (ISO) niclosamide (ISO) nicotine (ISO) nitric oxide (EXP) Nutlin-3 (ISO) O-methyleugenol (ISO) ochratoxin A (ISO) oxaliplatin (EXP) ozone (ISO) paracetamol (ISO) paraquat (EXP,ISO) pentanal (ISO) peroxynitrous acid (EXP) PhIP (ISO) phorbol 13-acetate 12-myristate (ISO) pirinixic acid (ISO) poly(propylene imine) macromolecule (ISO) pregnenolone 16alpha-carbonitrile (ISO) propanal (ISO) propranolol (ISO) quercetin (ISO) quercetin 3-sulfate (ISO) raloxifene (ISO) reactive oxygen species (EXP) rebaudioside A (ISO) resveratrol (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 203580 (EXP,ISO) SB 431542 (ISO) selenium atom (EXP) silicon dioxide (EXP,ISO) sodium arsenite (ISO) sodium chloride (EXP) sodium dichromate (ISO) steviol (ISO) stevioside (ISO) sunitinib (ISO) tamoxifen (ISO) tenidap (ISO) tepoxalin (EXP,ISO) tert-butanol (ISO) tert-butyl hydroperoxide (ISO) testosterone (EXP) tetrachloromethane (EXP,ISO) tetraphene (ISO) thapsigargin (ISO) thimerosal (ISO) thioacetamide (EXP) titanium dioxide (ISO) trans-caffeic acid (EXP,ISO) trichloroethene (EXP) triclosan (ISO) trimellitic anhydride (ISO) triphenyl phosphate (ISO) troglitazone (EXP) tyrphostin AG 1478 (ISO) valproic acid (ISO) vitamin E (EXP,ISO) zileuton (EXP,ISO) zinc atom (ISO) zinc(0) (ISO) zoledronic acid (ISO)
Biological Process
arachidonate metabolic process (IBA) dendritic cell migration (IEA,ISO,ISS) glucose homeostasis (IEA,ISO,ISS) humoral immune response (IEA,ISO,ISS) inflammatory response (IEA,ISO) leukocyte chemotaxis involved in inflammatory response (IEA,ISO,ISS) leukocyte migration involved in inflammatory response (IEA,ISO,ISS) leukotriene A4 biosynthetic process (IEA,ISO,ISS) leukotriene biosynthetic process (IEA,ISO,ISS,TAS) leukotriene metabolic process (IEA,ISO) leukotriene production involved in inflammatory response (IEA,ISO) lipid metabolic process (IEA) lipid oxidation (IBA,IEA) lipoxin biosynthetic process (IEA,ISO,ISS) lipoxygenase pathway (IBA) negative regulation of angiogenesis (IEA,ISO,ISS) negative regulation of endothelial cell proliferation (IEA,ISO,ISS) negative regulation of inflammatory response (IEA,ISO,ISS) negative regulation of response to endoplasmic reticulum stress (IEA,ISO,ISS) negative regulation of sprouting angiogenesis (IEA,ISO,ISS) negative regulation of vascular wound healing (IEA,ISO,ISS) negative regulation of wound healing (IEA,ISO,ISS) positive regulation of bone mineralization (IEA,ISO,ISS) positive regulation of cytochrome-c oxidase activity (IMP) positive regulation of leukocyte adhesion to arterial endothelial cell (IEA,ISO,ISS) positive regulation of vasoconstriction (IMP) regulation of cellular response to oxidative stress (IEA,ISO,ISS) regulation of cytokine production involved in inflammatory response (IEA,ISO,ISS) regulation of fat cell differentiation (IEA,ISO,ISS) regulation of inflammatory response (IEA,ISO,ISS) regulation of inflammatory response to wounding (IEA,ISO,ISS) regulation of insulin secretion (IEA,ISO,ISS) regulation of reactive oxygen species biosynthetic process (IEA,ISO,ISS) response to hyperoxia (IEP) response to nutrient (IEP)
Cellular Component
cytoplasm (IEA,ISO) cytosol (IEA,ISO,ISS) dendrite (IDA) membrane (IEA) nuclear envelope (IBA,IDA,IEA,ISO,TAS) nuclear envelope lumen (IEA,ISO,ISS) nuclear matrix (IEA,ISO) nuclear membrane (IEA,ISO,ISS) nucleoplasm (IEA,ISO) nucleus (IEA,ISO) perinuclear region of cytoplasm (IEA,ISO,ISS) sarcolemma (IDA)
1.
A novel polymorphism, E254K, in the 5-lipoxygenase gene associated with bronchial asthma.
Bai C, etal., Int J Mol Med. 2008 Feb;21(2):139-44.
2.
Isolation and characterization of a cDNA clone encoding rat 5-lipoxygenase.
Balcarek JM, etal., J Biol Chem 1988 Sep 25;263(27):13937-41.
3.
The genetic association database.
Becker KG, etal., Nat Genet. 2004 May;36(5):431-2.
4.
Zileuton: clinical implications of 5-Lipoxygenase inhibition in severe airway disease.
Berger W, etal., Int J Clin Pract. 2007 Apr;61(4):663-76.
5.
Translocation and leukotriene synthetic capacity of nuclear 5-lipoxygenase in rat basophilic leukemia cells and alveolar macrophages.
Brock TG, etal., J Biol Chem. 1995 Sep 15;270(37):21652-8. doi: 10.1074/jbc.270.37.21652.
6.
5-Lipoxygenase deficiency prevents respiratory failure during ventilator-induced lung injury.
Caironi P, etal., Am J Respir Crit Care Med. 2005 Aug 1;172(3):334-43. Epub 2005 May 13.
7.
Platelet-activating factor potentiates protamine-induced lung edema. Role of eicosanoids.
Chen CR, etal., Am J Respir Crit Care Med. 1994 Jan;149(1):34-40.
8.
In situ amplification of 5-lipoxygenase and 5-lipoxygenase-activating protein in allergic airway inflammation and inhibition by leukotriene blockade.
Chu SJ, etal., J Immunol. 2000 Oct 15;165(8):4640-8.
9.
Comparative effects of long-acting beta2-agonists, leukotriene receptor antagonists, and a 5-lipoxygenase inhibitor on exercise-induced asthma.
Coreno A, etal., J Allergy Clin Immunol. 2000 Sep;106(3):500-6.
10.
CJ-13610, an orally active inhibitor of 5-lipoxygenase is efficacious in preclinical models of pain.
Cortes-Burgos LA, etal., Eur J Pharmacol. 2009 Sep 1;617(1-3):59-67. Epub 2009 Jul 4.
11.
Pharmacological inhibition of 5-lipoxygenase accelerates and enhances fracture-healing.
Cottrell JA and O'Connor JP, J Bone Joint Surg Am. 2009 Nov;91(11):2653-65.
12.
5-Lipoxygenase knockout mice exhibit a resistance to pleurisy and lung injury caused by carrageenan.
Cuzzocrea S, etal., J Leukoc Biol. 2003 Jun;73(6):739-46.
13.
Pharmacogenetic association between ALOX5 promoter genotype and the response to anti-asthma treatment.
Drazen JM, etal., Nat Genet 1999 Jun;22(2):168-70.
14.
Arachidonate 5-lipoxygenase promoter genotype, dietary arachidonic acid, and atherosclerosis.
Dwyer JH, etal., N Engl J Med 2004 Jan 1;350(1):29-37.
15.
Increased expression of cytosolic phospholipase A2, 5-lipoxygenase and 5-lipoxygenase-activating protein in rat peritoneal macrophages during ovalbumin-induced sensitization.
Escoubet-Lozach L, etal., Clin Exp Allergy 2001 Jul;31(7):1094-104.
16.
Pharmacological inhibition of leukotrienes in an animal model of bleomycin-induced acute lung injury.
Failla M, etal., Respir Res. 2006 Nov 21;7:137.
17.
Is there a role for the macrophage 5-lipoxygenase pathway in aortic aneurysm development in apolipoprotein E-deficient mice?
Funk CD, etal., Ann N Y Acad Sci. 2006 Nov;1085:151-60.
18.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
19.
Activation of 5-lipoxygenase after oxygen-glucose deprivation is partly mediated via NMDA receptor in rat cortical neurons.
Ge QF, etal., J Neurochem. 2006 May;97(4):992-1004. Epub 2006 Apr 5.
20.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
21.
5-lipoxygenase inhibition reduces intrahepatic vascular resistance of cirrhotic rat livers: a possible role of cysteinyl-leukotrienes.
Graupera M, etal., Gastroenterology. 2002 Feb;122(2):387-93.
22.
Effects of some nonsteroidal anti-inflammatory agents on experimental radiation pneumonitis.
Gross NJ, etal., Radiat Res. 1991 Sep;127(3):317-24.
23.
The importance of leukotrienes in airway inflammation in a mouse model of asthma.
Henderson WR Jr, etal., J Exp Med. 1996 Oct 1;184(4):1483-94.
24.
5-Lipoxygenase and leukotriene B(4) receptor are expressed in human pancreatic cancers but not in pancreatic ducts in normal tissue.
Hennig R, etal., Am J Pathol. 2002 Aug;161(2):421-8.
25.
5-Lipoxygenase, a marker for early pancreatic intraepithelial neoplastic lesions.
Hennig R, etal., Cancer Res. 2005 Jul 15;65(14):6011-6.
26.
ALOX5 variants associated with susceptibility to human pulmonary tuberculosis.
Herb F, etal., Hum Mol Genet. 2008 Apr 1;17(7):1052-60. Epub 2008 Jan 3.
27.
Hyperoxia increases protein mass of 5-lipoxygenase and its activating protein, flap, and leukotriene B(4) output in newborn rat lungs.
Hosford GE, etal., Exp Lung Res. 2002 Dec;28(8):671-84.
28.
Human bronchial epithelial cells express an active and inducible biosynthetic pathway for leukotrienes B4 and C4.
Jame AJ, etal., Clin Exp Allergy. 2007 Jun;37(6):880-92.
29.
Effect of 5-lipoxygenase on the development of pulmonary hypertension in rats.
Jones JE, etal., Am J Physiol Heart Circ Physiol. 2004 May;286(5):H1775-84. Epub 2004 Jan 15.
30.
ALOX5 promoter genotype, asthma severity and LTC production by eosinophils.
Kalayci O, etal., Allergy. 2006 Jan;61(1):97-103.
31.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
32.
Expression of 5-lipoxygenase and 5-lipoxygenase-activating protein mRNAs in the peripheral blood leukocytes of asthmatics.
Koshino T, etal., Biochem Biophys Res Commun. 1998 Jun 18;247(2):510-3.
33.
Post-treatment effects of erythropoietin and nordihydroguaiaretic acid on recovery from cisplatin-induced acute renal failure in the rat.
Lee DW, etal., J Korean Med Sci. 2009 Jan;24 Suppl:S170-5. Epub 2009 Jan 29.
34.
Effects of celecoxib and nordihydroguaiaretic acid on puromycin aminonucleoside-induced nephrosis in the rat.
Lee DW, etal., J Korean Med Sci. 2009 Jan;24 Suppl:S183-8. Epub 2009 Jan 29.
35.
Effect of 5-lipoxygenase blockade on blood pressure and acetylcholine-evoked endothelium-dependent contraction in aorta from spontaneously hypertensive rats.
Lefebvre B, etal., J Hypertens. 2006 Jan;24(1):85-93.
36.
Cardioprotective effect of 5-lipoxygenase gene (ALOX5) silencing in ischemia-reperfusion.
Lisovyy OO, etal., Acta Biochim Pol. 2009;56(4):687-94. Epub 2009 Dec 11.
37.
Intrapulmonary administration of leukotriene B4 enhances pulmonary host defense against pneumococcal pneumonia.
Mancuso P, etal., Infect Immun. 2010 May;78(5):2264-71. Epub 2010 Mar 15.
38.
The nuclear membrane organization of leukotriene synthesis.
Mandal AK, etal., Proc Natl Acad Sci U S A. 2008 Dec 23;105(51):20434-9. Epub 2008 Dec 15.
39.
Protective effect of dietary curcumin and capsaicin on induced oxidation of low-density lipoprotein, iron-induced hepatotoxicity and carrageenan-induced inflammation in experimental rats.
Manjunatha H and Srinivasan K, FEBS J. 2006 Oct;273(19):4528-37. Epub 2006 Sep 5.
40.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
41.
Prognostic value of eicosanoid pathways in extrahepatic cholangiocarcinoma.
Mobius C, etal., Anticancer Res. 2008 Mar-Apr;28(2A):873-8.
42.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
43.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
44.
Role of lipoxygenases and the lipoxin A(4)/annexin 1 receptor in ischemia-reperfusion-induced gastric mucosal damage in rats.
Peskar BM, etal., Pharmacology. 2009;84(5):294-9. Epub 2009 Oct 8.
45.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
46.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
47.
Increased expression of lipoxygenase enzymes during pollen season in nasal biopsies of pollen-allergic patients.
Plewako H, etal., Allergy. 2006 Jun;61(6):725-30.
48.
Inhaled carbenoxolone prevents allergic airway inflammation and airway hyperreactivity in a mouse model of asthma.
Ram A, etal., Int Arch Allergy Immunol. 2009;149(1):38-46. Epub 2008 Nov 26.
49.
Inhibition of LTB4 biosynthesis in situ by CGS 23885, a potent 5-lipoxygenase inhibitor, correlates with its pleural fluid concentrations in an experimentally induced rat pleurisy model.
Raychaudhuri A, etal., Naunyn Schmiedebergs Arch Pharmacol. 1997 Apr;355(4):470-4.
50.
GOA pipeline
RGD automated data pipeline
51.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
52.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
53.
Promoter polymorphism in the 5-lipoxygenase (ALOX5) and 5-lipoxygenase-activating protein (ALOX5AP) genes and asthma susceptibility in a Caucasian population.
Sayers I, etal., Clin Exp Allergy. 2003 Aug;33(8):1103-10.
54.
Rhinovirus infection increases 5-lipoxygenase and cyclooxygenase-2 in bronchial biopsy specimens from nonatopic subjects.
Seymour ML, etal., J Infect Dis. 2002 Feb 15;185(4):540-4. Epub 2002 Jan 31.
55.
Actions of a 5-lipoxygenase inhibitor, Sch 40120, on acute inflammatory responses.
Smith SR, etal., J Pharmacol Exp Ther. 1992 Aug;262(2):721-8.
56.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
57.
Phenotypically-Silent Bone Morphogenetic Protein Receptor 2 (Bmpr2) Mutations Predispose Rats to Inflammation-Induced Pulmonary Arterial Hypertension by Enhancing The Risk for Neointimal Transformation.
Tian W, etal., Circulation. 2019 Aug 29. doi: 10.1161/CIRCULATIONAHA.119.040629.
58.
Lipoxygenase inhibitors attenuate growth of human pancreatic cancer xenografts and induce apoptosis through the mitochondrial pathway.
Tong WG, etal., Mol Cancer Ther. 2002 Sep;1(11):929-35.
59.
5-Lipoxygenase pathway gene polymorphisms: lack of association with asthma in a Spanish population.
Torres-Galvan SM, etal., J Investig Allergol Clin Immunol. 2009;19(6):453-8.
60.
Zileuton Reduces Inflammatory Reaction and Brain Damage Following Permanent Cerebral Ischemia in Rats.
Tu XK, etal., Inflammation. 2010 Mar 5.
61.
Inhibition of 5-lipoxygenase-activating protein (FLAP) reduces pulmonary vascular reactivity and pulmonary hypertension in hypoxic rats.
Voelkel NF, etal., J Clin Invest 1996 Jun 1;97(11):2491-8.
62.
Constitutive activation of 5-lipoxygenase in the lungs of patients with idiopathic pulmonary fibrosis.
Wilborn J, etal., J Clin Invest. 1996 Apr 15;97(8):1827-36.
63.
5-Lipoxygenase and 5-lipoxygenase activating protein (FLAP) immunoreactivity in lungs from patients with primary pulmonary hypertension.
Wright L, etal., Am J Respir Crit Care Med. 1998 Jan;157(1):219-29.
64.
Metabolic changes of arachidonic acid after cerebral ischemia-reperfusion in diabetic rats.
Zhang RL, etal., Exp Neurol. 2003 Dec;184(2):746-52.
65.
Lipoxygenase-dependent superoxide release in skeletal muscle.
Zuo L, etal., J Appl Physiol. 2004 Aug;97(2):661-8. Epub 2004 Apr 23.
Alox5 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 151,203,948 - 151,251,126 (-) NCBI GRCr8 mRatBN7.2 4 149,531,329 - 149,578,696 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 149,531,515 - 149,578,743 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 155,763,428 - 155,810,585 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 151,547,462 - 151,594,624 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 150,170,360 - 150,217,527 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 148,398,004 - 148,446,308 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 148,398,892 - 148,446,303 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 214,345,956 - 214,393,337 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 152,610,283 - 152,657,891 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 152,855,123 - 152,902,732 (-) NCBI Celera 4 138,415,564 - 138,454,485 (-) NCBI Celera Cytogenetic Map 4 q42 NCBI
ALOX5 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 10 45,374,216 - 45,446,117 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 10 45,374,176 - 45,446,119 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 10 45,869,664 - 45,941,565 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 10 45,189,635 - 45,261,571 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 10 45,189,691 - 45,261,567 NCBI Celera 10 41,889,257 - 41,939,521 (+) NCBI Celera Cytogenetic Map 10 q11.21 NCBI HuRef 10 42,394,884 - 42,467,216 (+) NCBI HuRef CHM1_1 10 45,908,843 - 45,980,778 (+) NCBI CHM1_1 T2T-CHM13v2.0 10 46,255,243 - 46,327,106 (+) NCBI T2T-CHM13v2.0
Alox5 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 116,387,030 - 116,438,139 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 116,387,038 - 116,438,139 (-) Ensembl GRCm39 Ensembl GRCm38 6 116,410,071 - 116,461,178 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 116,410,077 - 116,461,178 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 116,360,089 - 116,411,196 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 116,375,696 - 116,426,797 (-) NCBI MGSCv36 mm8 Celera 6 118,247,670 - 118,299,116 (-) NCBI Celera Cytogenetic Map 6 E3 NCBI cM Map 6 53.79 NCBI
Alox5 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955546 2,494,819 - 2,550,909 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955546 2,495,226 - 2,550,909 (+) NCBI ChiLan1.0 ChiLan1.0
ALOX5 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 8 58,201,690 - 58,271,880 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 10 58,207,019 - 58,277,209 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 10 42,461,398 - 42,531,576 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 10 45,639,946 - 45,710,016 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 10 45,639,946 - 45,710,016 (+) Ensembl panpan1.1 panPan2
ALOX5 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 28 2,170,920 - 2,218,765 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 28 2,170,920 - 2,219,609 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 28 2,405,370 - 2,462,571 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 28 2,349,844 - 2,407,164 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 28 2,349,846 - 2,407,125 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 28 2,147,070 - 2,204,281 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 28 2,183,953 - 2,241,179 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 28 2,315,780 - 2,373,040 (-) NCBI UU_Cfam_GSD_1.0
Alox5 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 81,798,191 - 81,858,352 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936554 7,808,355 - 7,867,931 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936554 7,807,914 - 7,848,691 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ALOX5 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 90,859,019 - 90,907,090 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 90,859,209 - 90,907,084 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 98,902,267 - 98,950,236 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ALOX5 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 9 41,085,257 - 41,145,760 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 9 41,085,361 - 41,145,331 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666048 764,154 - 824,908 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Alox5
.
Predicted Target Of
Count of predictions: 70 Count of miRNA genes: 59 Interacting mature miRNAs: 67 Transcripts: ENSRNOT00000017633 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1582237 Kidm34 Kidney mass QTL 34 4 0.0001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 4 148090542 168069246 Rat 61446 Coreg2 Compensatory renal growth QTL 2 3.5 kidney mass (VT:0002707) compensatory renal growth score (CMO:0001894) 4 148423102 157580971 Rat 1300116 Hrtrt5 Heart rate QTL 5 3.76 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 116179486 151161268 Rat 6478693 Anxrr32 Anxiety related response QTL 32 0.00092 locomotor behavior trait (VT:0001392) measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957) 4 144639524 182687754 Rat 10755501 Bp390 Blood pressure QTL 390 2.5 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 4 26775591 168368347 Rat 631683 Bp116 Blood pressure QTL 116 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 124303370 169303370 Rat 61451 Ciaa4 CIA Autoantibody QTL 4 3.1 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 4 126395976 167139601 Rat 1331738 Bp209 Blood pressure QTL 209 2.979 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 138503169 179293946 Rat 6478700 Anxrr33 Anxiety related response QTL 33 0.00896 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 144639524 182687754 Rat 1549827 Scl46 Serum cholesterol level QTL 46 3.5 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 4 132396220 177396220 Rat 731165 Uae21 Urinary albumin excretion QTL 21 2.4 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 4 106649412 151649412 Rat 737821 Hcar9 Hepatocarcinoma resistance QTL 9 3.7 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 4 109866907 167139601 Rat 7411558 Bw133 Body weight QTL 133 13.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 4 125590636 170590636 Rat 10401796 Kidm48 Kidney mass QTL 48 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 4 145568712 182687754 Rat 6478718 Anxrr34 Anxiety related response QTL 34 0.00896 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 144639524 182687754 Rat 1549832 Bss3 Bone structure and strength QTL 3 11 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 4 109827074 154827074 Rat 70177 Xhs1 X-ray hypersensitivity QTL 1 25.1 intestine integrity trait (VT:0010554) post-insult time to onset of moribundity (CMO:0001896) 4 82798864 152731274 Rat 2303623 Vencon2 Ventilatory control QTL 2 3.8 respiration trait (VT:0001943) minute ventilation (CMO:0000132) 4 135204660 180204660 Rat 1578674 Bmd12 Bone mineral density QTL 12 3.8 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 4 135699135 180699135 Rat 737978 Pia23 Pristane induced arthritis QTL 23 5.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 131730738 167139601 Rat 61362 Oia2 Oil induced arthritis QTL 2 0.001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 138503169 173369699 Rat 2293659 Bmd35 Bone mineral density QTL 35 4.5 0.0001 femur strength trait (VT:0010010) femoral neck ultimate force (CMO:0001703) 4 137755016 181392681 Rat 1331759 Hrtrt13 Heart rate QTL 13 3.54628 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 110275411 168266883 Rat 724535 Cm18 Cardiac mass QTL 18 2.6 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 4 118856416 163856416 Rat 2316958 Gluco58 Glucose level QTL 58 10 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 11320076 180699135 Rat 6478754 Anxrr43 Anxiety related response QTL 43 0.14035 locomotor behavior trait (VT:0001392) distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493) 4 144639524 182687754 Rat 2302049 Pia32 Pristane induced arthritis QTL 32 5.1 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112) 4 105789505 150789505 Rat 724558 Plsm2 Polydactyly-luxate syndrome (PLS) morphotypes QTL 2 0.0003 hindlimb integrity trait (VT:0010563) hind foot phalanges count (CMO:0001949) 4 132422778 177422778 Rat 6478763 Anxrr46 Anxiety related response QTL 46 0.07428 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 110870972 155870972 Rat 6478760 Anxrr45 Anxiety related response QTL 45 0.06717 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 110870972 155870972 Rat 1331802 Srn5 Serum renin concentration QTL 5 3.045 renin activity (VT:0005581) plasma renin activity level (CMO:0000116) 4 119428175 157578333 Rat 1298524 Oia8 Oil induced arthritis QTL 8 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 138503169 173369699 Rat 738009 Sach4 Saccharine consumption QTL 4 4.9 0.000016 consumption behavior trait (VT:0002069) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 4 59948935 154902892 Rat 7207480 Bss105 Bone structure and strength QTL 105 8.1 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 4 109827074 154827074 Rat 634335 Anxrr16 Anxiety related response QTL 16 7.22 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 4 93308457 167139447 Rat 6478778 Anxrr51 Anxiety related response QTL 51 0.25384 locomotor behavior trait (VT:0001392) measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957) 4 124778595 169778595 Rat 61406 Scwia1 Streptococcal cell wall induced arthritis QTL 1 2.3 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 4 106805662 151805662 Rat 631511 Pia7 Pristane induced arthritis QTL 7 4.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 131730738 167139601 Rat 634347 Hcar8 Hepatocarcinoma resistance QTL 8 5.8 liver integrity trait (VT:0010547) liver tumorous lesion area to total liver area ratio (CMO:0001075) 4 123143783 168143783 Rat 738031 Alc14 Alcohol consumption QTL 14 7.6 0.00003 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1576316 Ept5 Estrogen-induced pituitary tumorigenesis QTL 5 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 4 83428419 177635233 Rat 1576305 Emca6 Estrogen-induced mammary cancer QTL 6 5.8 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 4 44463720 155883716 Rat 738016 Alc16 Alcohol consumption QTL 16 3.6 0.00015 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1358202 Gluco11 Glucose level QTL 11 2.4 0.02 adipocyte glucose uptake trait (VT:0004185) absolute change in adipocyte glucose uptake (CMO:0000873) 4 85379421 167139601 Rat 61422 Cia13 Collagen induced arthritis QTL 13 4.5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 132642577 167139601 Rat 634342 Cia24 Collagen induced arthritis QTL 24 4.5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 146565735 175236377 Rat 631674 Iddm14 Insulin dependent diabetes mellitus QTL 14 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 4 64528739 157573521 Rat 12798519 Anxrr54 Anxiety related response QTL 54 2.54 0.05 locomotor behavior trait (VT:0001392) distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493) 4 114627026 159627026 Rat 12798523 Anxrr56 Anxiety related response QTL 56 2.83 0.05 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 85253748 150276390 Rat 6478748 Anxrr42 Anxiety related response QTL 42 0.28008 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 144639524 182687754 Rat 12798525 Anxrr57 Anxiety related response QTL 57 3.21 0.05 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 147278504 167139601 Rat
RH94554
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 149,531,561 - 149,531,650 (+) MAPPER mRatBN7.2 Rnor_6.0 4 148,398,939 - 148,399,027 NCBI Rnor6.0 Rnor_5.0 4 214,346,197 - 214,346,285 UniSTS Rnor5.0 RGSC_v3.4 4 152,610,330 - 152,610,418 UniSTS RGSC3.4 Celera 4 138,415,611 - 138,415,699 UniSTS Cytogenetic Map 4 q42 UniSTS
RH133456
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 149,531,758 - 149,531,974 (+) MAPPER mRatBN7.2 Rnor_6.0 4 148,399,136 - 148,399,351 NCBI Rnor6.0 Rnor_5.0 4 214,346,394 - 214,346,609 UniSTS Rnor5.0 RGSC_v3.4 4 152,610,527 - 152,610,742 UniSTS RGSC3.4 Celera 4 138,415,808 - 138,416,023 UniSTS RH 3.4 Map 4 968.82 UniSTS Cytogenetic Map 4 q42 UniSTS
BM387192
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 149,541,066 - 149,541,255 (+) MAPPER mRatBN7.2 Rnor_6.0 4 148,408,444 - 148,408,632 NCBI Rnor6.0 Rnor_5.0 4 214,355,702 - 214,355,890 UniSTS Rnor5.0 RGSC_v3.4 4 152,619,835 - 152,620,023 UniSTS RGSC3.4 Celera 4 138,425,085 - 138,425,273 UniSTS RH 3.4 Map 4 968.2 UniSTS Cytogenetic Map 4 q42 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000017633 ⟹ ENSRNOP00000017633
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 149,531,515 - 149,578,743 (-) Ensembl Rnor_6.0 Ensembl 4 148,399,120 - 148,446,303 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000082907 ⟹ ENSRNOP00000068941
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 149,531,940 - 149,578,743 (-) Ensembl Rnor_6.0 Ensembl 4 148,398,892 - 148,437,961 (-) Ensembl
RefSeq Acc Id:
NM_012822 ⟹ NP_036954
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 151,203,949 - 151,251,126 (-) NCBI mRatBN7.2 4 149,531,515 - 149,578,696 (-) NCBI Rnor_6.0 4 148,398,892 - 148,446,273 (-) NCBI Rnor_5.0 4 214,345,956 - 214,393,337 (-) NCBI RGSC_v3.4 4 152,610,283 - 152,657,891 (-) RGD Celera 4 138,415,564 - 138,454,485 (-) RGD
Sequence:
CTCTTGAGTGACAGAGTCAAGAATCTGGTAAACTGCCACCTGAACTTCCCGGGCTCCTGCGCCCACGCAGCAGCGCTCACTTCCCAGAGCCATGCCTTCCTACACTGTCACCGTAGCCACCGGTAGCC
hide sequence
RefSeq Acc Id:
XM_039107106 ⟹ XP_038963034
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 151,203,948 - 151,251,001 (-) NCBI mRatBN7.2 4 149,531,329 - 149,578,549 (-) NCBI
RefSeq Acc Id:
NP_036954 ⟸ NM_012822
- UniProtKB:
P12527 (UniProtKB/Swiss-Prot), F1LMM5 (UniProtKB/TrEMBL)
- Sequence:
MPSYTVTVATGSQWFAGTDDYIYLSLIGSAGCSEKHLLDKAFYNDFERGGRDSYDVTVDEELGEIYLVKIEKRKYRLHDDWYLKYITLKTPHDYIEFPCYRWITGEGEIVLRDGCAKLARDDQIHILK
hide sequence
Ensembl Acc Id:
ENSRNOP00000068941 ⟸ ENSRNOT00000082907
Ensembl Acc Id:
ENSRNOP00000017633 ⟸ ENSRNOT00000017633
RefSeq Acc Id:
XP_038963034 ⟸ XM_039107106
- Peptide Label:
isoform X1
- UniProtKB:
A6IL16 (UniProtKB/TrEMBL)
RGD ID: 13693335 Promoter ID: EPDNEW_R3859 Type: single initiation site Name: Alox5_1 Description: arachidonate 5-lipoxygenase SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 4 148,446,288 - 148,446,348 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2001-06-29
Alox5
arachidonate 5-lipoxygenase
Name updated to reflect Human and Mouse nomenclature
67952 APPROVED
2001-06-29
Alox5
5 - Lipoxygenase
Name withdrawn
67952 WITHDRAWN
Note Type
Note
Reference
gene_expression
expressed in all tissues tested
632194
gene_expression
expressed at high levels in lung
632194
gene_function
catalyzes the conversion of arachidonate to leukotriene A4
632194
gene_process
plays a role in leukotriene metabolism
632194
gene_protein
77.6 kDa protein
632194
gene_transcript
2.6 kb transcript is detected
632194
