Gene: Aldoa (aldolase, fructose-bisphosphate A) Rattus norvegicus
Analyze
Symbol:
Aldoa
Name:
aldolase, fructose-bisphosphate A
RGD ID:
2089
Description:
Predicted to enable several functions, including fructose binding activity; fructose-bisphosphate aldolase activity; and identical protein binding activity. Involved in several processes, including methylglyoxal biosynthetic process; response to estrogen; and response to lipopolysaccharide. Located in cytoplasm and heterochromatin. Orthologous to human ALDOA (aldolase, fructose-bisphosphate A); PARTICIPATES IN Fanconi syndrome pathway; fructose and mannose metabolic pathway; fructose-1,6-bisphosphatase deficiency pathway; INTERACTS WITH (+)-schisandrin B; 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Aldo1; aldolase A; Aldolase A fructose-bisphosphate; aldolase A, fructose-bisphosphate; fructose-bisphosphate aldolase A; muscle-type aldolase; RNALDOG5
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ALDOA (aldolase, fructose-bisphosphate A)
HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, Panther
Pan paniscus (bonobo/pygmy chimpanzee):
ALDOA (aldolase, fructose-bisphosphate A)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ALDOA (aldolase, fructose-bisphosphate A)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ALDOA (aldolase, fructose-bisphosphate A)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ALDOA (aldolase, fructose-bisphosphate A)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
SECTM1 (secreted and transmembrane 1)
HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Aldoa (aldolase A, fructose-bisphosphate)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
ALDOA (aldolase, fructose-bisphosphate A)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Danio rerio (zebrafish):
aldoab (aldolase a, fructose-bisphosphate, b)
Alliance
DIOPT (InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
aldoaa (aldolase a, fructose-bisphosphate, a)
Alliance
DIOPT (InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Ald
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
aldo-1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
aldo-2
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
CG5432
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
aldoa
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
aldoc
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoInspector)
Related Pseudogenes:
Aldoa-ps1
Aldoa-ps2
Aldoa-ps3
Aldoa-ps4
Aldoa-ps5
Aldoa-ps6
Aldoa-ps7
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 190,832,820 - 190,838,021 (-) NCBI GRCr8 mRatBN7.2 1 181,402,275 - 181,407,476 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 181,402,275 - 181,406,182 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 189,753,603 - 189,758,803 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 196,939,676 - 196,944,877 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 189,607,009 - 189,612,203 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 198,228,387 - 198,233,988 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 198,228,387 - 198,233,588 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 205,208,255 - 205,213,627 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 185,970,658 - 185,974,615 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 186,120,538 - 186,124,496 (-) NCBI Celera 1 179,057,793 - 179,062,995 (-) NCBI Celera RH 2.0 Map 1 968.2 RGD Cytogenetic Map 1 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Imported Disease Annotations - ClinVar
Imported Disease Annotations - CTD
Imported Disease Annotations - OMIM
Only show annotations with direct experimental evidence (0 objects hidden)
Aldoa Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of ALDOA mRNA] CTD PMID:31150632 Aldoa Rat (-)-epigallocatechin 3-gallate increases expression ISO RGD:30308195 6480464 epigallocatechin gallate results in increased expression of ALDOA protein CTD PMID:31195006 Aldoa Rat 1,10-phenanthroline increases expression ISO RGD:30308195 6480464 1,10-phenanthroline results in increased expression of ALDOA mRNA CTD PMID:19502547 Aldoa Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of ALDOA mRNA CTD PMID:17522070 Aldoa Rat 14-Deoxy-11,12-didehydroandrographolide decreases expression ISO RGD:30308195 6480464 14-deoxy-11,12-didehydroandrographolide results in decreased expression of ALDOA mRNA CTD PMID:22101062 Aldoa Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of ALDOA mRNA CTD PMID:17557909|PMID:19400957 Aldoa Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of ALDOA mRNA CTD PMID:17522070 Aldoa Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of ALDOA mRNA CTD PMID:32145629 Aldoa Rat 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one increases expression ISO RGD:30308195 6480464 Metribolone results in increased expression of ALDOA mRNA CTD PMID:17010196 Aldoa Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of ALDOA mRNA CTD PMID:34747641 Aldoa Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2,3,7,8-tetrachlorodibenzofuran results in decreased expression of ALDOA mRNA CTD PMID:32109520 Aldoa Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether increases expression EXP 6480464 2,2',4,4',5-brominated diphenyl ether results in increased expression of ALDOA protein CTD PMID:19954255 Aldoa Rat 2,4-dinitrotoluene affects expression EXP 6480464 2,4-dinitrotoluene affects the expression of ALDOA mRNA CTD PMID:21346803 Aldoa Rat 2,6-dimethoxyphenol multiple interactions ISO RGD:30308195 6480464 [pyrogallol 1,3-dimethyl ether co-treated with Furaldehyde] results in increased expression of and affects the localization more ... CTD PMID:38598786 Aldoa Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of ALDOA protein CTD PMID:34915118 Aldoa Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RGD:30308195 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Aldoa Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:30308195 6480464 bisphenol S results in increased expression of ALDOA mRNA CTD PMID:31121516 Aldoa Rat 4-amino-2,6-dinitrotoluene affects expression EXP 6480464 4-amino-2,6-dinitrotoluene affects the expression of ALDOA mRNA CTD PMID:21346803 Aldoa Rat 4-hydroxynon-2-enal affects binding ISO RGD:30308195 6480464 ALDOA protein binds to 4-hydroxy-2-nonenal CTD PMID:20043646 Aldoa Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of ALDOA mRNA CTD PMID:36843608 Aldoa Rat 7,12-dimethyltetraphene increases expression EXP 6480464 9,10-Dimethyl-1,2-benzanthracene results in increased expression of ALDOA protein CTD PMID:22248470 Aldoa Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of ALDOA mRNA CTD PMID:31881176 Aldoa Rat acetylsalicylic acid decreases expression ISO RGD:30308195 6480464 Aspirin results in decreased expression of ALDOA mRNA CTD PMID:15928584 Aldoa Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of ALDOA mRNA CTD PMID:28959563 Aldoa Rat aflatoxin B1 increases methylation ISO RGD:30308195 6480464 Aflatoxin B1 results in increased methylation of ALDOA gene CTD PMID:27153756 Aldoa Rat aflatoxin B1 increases mutagenesis EXP 6480464 Aflatoxin B1 results in increased mutagenesis of ALDOA gene CTD PMID:36908029 Aldoa Rat all-trans-retinoic acid multiple interactions ISO RGD:30308195 6480464 [Tretinoin co-treated with Arsenic Trioxide] results in increased expression of ALDOA mRNA CTD PMID:15894607 Aldoa Rat all-trans-retinoic acid increases expression ISO RGD:30308195 6480464 Tretinoin results in increased expression of ALDOA mRNA CTD PMID:33167477 Aldoa Rat alpha-Zearalanol decreases expression EXP 6480464 Zeranol results in decreased expression of ALDOA mRNA CTD PMID:35163327 Aldoa Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of ALDOA mRNA; [Zeranol co-treated with more ... CTD PMID:35163327 Aldoa Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of ALDOA mRNA CTD PMID:16483693 Aldoa Rat ampicillin multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in more ... CTD PMID:30545405 Aldoa Rat antimycin A increases expression ISO RGD:30308195 6480464 Antimycin A results in increased expression of ALDOA mRNA CTD PMID:33512557 Aldoa Rat aristolochic acid A decreases expression ISO RGD:30308195 6480464 aristolochic acid I results in decreased expression of ALDOA mRNA CTD PMID:33212167 Aldoa Rat arotinoid acid multiple interactions ISO RGD:30308195 6480464 [4-(2-(5,6,7,8-tetrahydro-5,5,8,8-tetramethyl-2-naphthalenyl)-1-propenyl)benzoic acid co-treated with Chir 99021 co-treated with 3-(4-pyridyl)-1H-indole co-treated with Hydrocortisone co-treated with EGF more ... CTD PMID:34480604 Aldoa Rat arsane increases methylation ISO RGD:30308195 6480464 Arsenic results in increased methylation of ALDOA promoter CTD PMID:21291286 Aldoa Rat arsenic atom increases methylation ISO RGD:30308195 6480464 Arsenic results in increased methylation of ALDOA promoter CTD PMID:21291286 Aldoa Rat arsenite(3-) multiple interactions ISO RGD:30308195 6480464 arsenite inhibits the reaction [G3BP1 protein binds to ALDOA protein] CTD PMID:32406909 Aldoa Rat arsenous acid decreases expression ISO RGD:30308195 6480464 Arsenic Trioxide results in decreased expression of ALDOA protein CTD PMID:15894607 Aldoa Rat arsenous acid multiple interactions ISO RGD:30308195 6480464 [Tretinoin co-treated with Arsenic Trioxide] results in increased expression of ALDOA mRNA CTD PMID:15894607 Aldoa Rat atrazine increases expression ISO RGD:30308195 6480464 Atrazine results in increased expression of ALDOA mRNA CTD PMID:22378314 Aldoa Rat azoxystrobin increases expression ISO RGD:30308195 6480464 azoxystrobin results in increased expression of ALDOA mRNA CTD PMID:33512557 Aldoa Rat beauvericin decreases expression ISO RGD:30308195 6480464 beauvericin results in decreased expression of ALDOA mRNA CTD PMID:29203277 Aldoa Rat benzo[a]pyrene increases methylation ISO RGD:30308195 6480464 Benzo(a)pyrene results in increased methylation of ALDOA promoter CTD PMID:27901495 Aldoa Rat benzo[a]pyrene increases expression ISO RGD:30308195 6480464 Benzo(a)pyrene results in increased expression of ALDOA protein CTD PMID:17292933 Aldoa Rat beta-D-fructofuranose 1,6-bisphosphate multiple interactions ISO RGD:30308195 6480464 cylindrospermopsin results in increased expression of [ALDOA protein binds to fructose-1,6-diphosphate] CTD PMID:27494769 Aldoa Rat bexarotene increases expression EXP 6480464 Bexarotene results in increased expression of ALDOA mRNA CTD PMID:16648578 Aldoa Rat bis(2-chloroethyl) sulfide affects expression EXP 6480464 Mustard Gas affects the expression of ALDOA mRNA CTD PMID:15651846 Aldoa Rat bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of ALDOA mRNA CTD PMID:21318169 Aldoa Rat bis(2-ethylhexyl) phthalate increases expression ISO RGD:30308195 6480464 Diethylhexyl Phthalate results in increased expression of ALDOA mRNA CTD PMID:31163220 Aldoa Rat bisphenol A multiple interactions ISO RGD:30308195 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Aldoa Rat bisphenol A decreases expression ISO RGD:30308195 6480464 bisphenol A results in decreased expression of ALDOA protein CTD PMID:37664457 Aldoa Rat bisphenol A affects expression ISO RGD:30308195 6480464 bisphenol A affects the expression of ALDOA mRNA CTD PMID:30903817 Aldoa Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ALDOA mRNA CTD PMID:25181051 Aldoa Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ALDOA mRNA CTD PMID:18180321|PMID:30816183|PMID:32528016|PMID:34947998 Aldoa Rat bisphenol AF increases expression ISO RGD:30308195 6480464 bisphenol AF results in increased expression of ALDOA protein CTD PMID:34186270 Aldoa Rat Bisphenol B increases expression ISO RGD:30308195 6480464 bisphenol B results in increased expression of ALDOA protein CTD PMID:34186270 Aldoa Rat bisphenol F increases expression ISO RGD:30308195 6480464 bisphenol F results in increased expression of ALDOA protein CTD PMID:34186270 Aldoa Rat butan-1-ol multiple interactions ISO RGD:30308195 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic more ... CTD PMID:29432896 Aldoa Rat cadmium atom multiple interactions ISO RGD:30308195 6480464 Cadmium inhibits the reaction [Oxygen deficiency results in increased expression of ALDOA mRNA] CTD PMID:10866824 Aldoa Rat cadmium dichloride increases expression ISO RGD:30308195 6480464 Cadmium Chloride results in increased expression of ALDOA mRNA CTD PMID:25596134 Aldoa Rat caffeine decreases phosphorylation ISO RGD:30308195 6480464 Caffeine results in decreased phosphorylation of ALDOA protein CTD PMID:35688186 Aldoa Rat calcidiol decreases expression EXP 6480464 Calcifediol deficiency results in decreased expression of ALDOA mRNA CTD PMID:17293106 Aldoa Rat carbamazepine affects expression ISO RGD:30308195 6480464 Carbamazepine affects the expression of ALDOA mRNA CTD PMID:25979313 Aldoa Rat carbon nanotube affects expression ISO RGD:30308195 6480464 Nanotubes, Carbon affects the expression of ALDOA protein CTD PMID:22001959 Aldoa Rat cefaloridine affects expression EXP 6480464 Cephaloridine affects the expression of ALDOA mRNA CTD PMID:18172885 Aldoa Rat CGP 52608 multiple interactions ISO RGD:30308195 6480464 CGP 52608 promotes the reaction [RORA protein binds to ALDOA gene] CTD PMID:28238834 Aldoa Rat CHIR 99021 multiple interactions ISO RGD:30308195 6480464 [4-(2-(5,6,7,8-tetrahydro-5,5,8,8-tetramethyl-2-naphthalenyl)-1-propenyl)benzoic acid co-treated with Chir 99021 co-treated with 3-(4-pyridyl)-1H-indole co-treated with Hydrocortisone co-treated with EGF more ... CTD PMID:34480604 Aldoa Rat chloroacetaldehyde increases expression ISO RGD:30308195 6480464 chloroacetaldehyde results in increased expression of ALDOA mRNA CTD PMID:25596134 Aldoa Rat chloroform increases expression EXP 6480464 Chloroform results in increased expression of ALDOA mRNA CTD PMID:17522070 Aldoa Rat chloropicrin decreases expression ISO RGD:30308195 6480464 chloropicrin results in decreased expression of ALDOA mRNA CTD PMID:28476498 Aldoa Rat chloropicrin increases expression ISO RGD:30308195 6480464 chloropicrin results in increased expression of ALDOA mRNA CTD PMID:26352163 Aldoa Rat chlorpromazine increases expression EXP 6480464 Chlorpromazine results in increased expression of ALDOA mRNA CTD PMID:25596134 Aldoa Rat cidofovir anhydrous increases expression ISO RGD:30308195 6480464 Cidofovir results in increased expression of ALDOA mRNA CTD PMID:25596134 Aldoa Rat cisplatin increases expression ISO RGD:30308195 6480464 Cisplatin results in increased expression of ALDOA mRNA CTD PMID:25596134 Aldoa Rat clodronic acid increases expression ISO RGD:30308195 6480464 Clodronic Acid results in increased expression of ALDOA mRNA CTD PMID:25596134 Aldoa Rat clofibrate increases expression EXP 6480464 Clofibrate results in increased expression of ALDOA mRNA CTD PMID:21318169 Aldoa Rat clofibric acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of ALDOA mRNA CTD PMID:17602206 Aldoa Rat clozapine increases expression EXP 6480464 Clozapine results in increased expression of ALDOA mRNA CTD PMID:15860345 Aldoa Rat cobalt dichloride increases expression EXP 6480464 cobaltous chloride results in increased expression of ALDOA mRNA; cobaltous chloride results in increased expression more ... CTD PMID:24386269 Aldoa Rat cobalt dichloride increases expression ISO RGD:30308195 6480464 cobaltous chloride results in increased expression of ALDOA mRNA CTD PMID:17553155|PMID:19320972|PMID:19502547|PMID:22202117|PMID:22537771 Aldoa Rat cobalt dichloride multiple interactions ISO RGD:30308195 6480464 L-4F peptide inhibits the reaction [cobaltous chloride results in increased expression of ALDOA mRNA]; zinc more ... CTD PMID:22202117|PMID:22537771 Aldoa Rat cobalt(2+) sulfate increases expression ISO RGD:30308195 6480464 cobalt sulfate results in increased expression of ALDOA mRNA CTD PMID:19502547 Aldoa Rat copper(II) chloride increases expression ISO RGD:30308195 6480464 cupric chloride results in increased expression of ALDOA mRNA CTD PMID:17211630 Aldoa Rat cortisol multiple interactions ISO RGD:30308195 6480464 [4-(2-(5,6,7,8-tetrahydro-5,5,8,8-tetramethyl-2-naphthalenyl)-1-propenyl)benzoic acid co-treated with Chir 99021 co-treated with 3-(4-pyridyl)-1H-indole co-treated with Hydrocortisone co-treated with EGF more ... CTD PMID:34480604 Aldoa Rat crocidolite asbestos increases expression ISO RGD:30308195 6480464 Asbestos, Crocidolite results in increased expression of ALDOA protein CTD PMID:29553831 Aldoa Rat CU-O LINKAGE decreases expression ISO RGD:30308195 6480464 cupric oxide results in decreased expression of ALDOA protein CTD PMID:25470785 Aldoa Rat curcumin decreases expression ISO RGD:30308195 6480464 Curcumin results in decreased expression of ALDOA mRNA CTD PMID:16880289 Aldoa Rat cyclosporin A increases expression ISO RGD:30308195 6480464 Cyclosporine results in increased expression of ALDOA mRNA CTD PMID:25596134 Aldoa Rat cyclosporin A decreases expression ISO RGD:30308195 6480464 Cyclosporine results in decreased expression of ALDOA mRNA CTD PMID:21163907|PMID:21632981|PMID:25562108 Aldoa Rat cylindrospermopsin multiple interactions ISO RGD:30308195 6480464 cylindrospermopsin results in increased expression of [ALDOA protein binds to fructose-1,6-diphosphate] CTD PMID:27494769 Aldoa Rat D-fructofuranose 1,6-bisphosphate multiple interactions ISO RGD:30308195 6480464 cylindrospermopsin results in increased expression of [ALDOA protein binds to fructose-1,6-diphosphate] CTD PMID:27494769 Aldoa Rat decabromodiphenyl ether decreases expression ISO RGD:30308195 6480464 decabromobiphenyl ether results in decreased expression of ALDOA protein CTD PMID:31675489 Aldoa Rat dexamethasone multiple interactions ISO RGD:30308195 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Aldoa Rat dexamethasone increases expression EXP 6480464 Dexamethasone results in increased expression of ALDOA mRNA CTD PMID:17522070 Aldoa Rat diarsenic trioxide multiple interactions ISO RGD:30308195 6480464 [Tretinoin co-treated with Arsenic Trioxide] results in increased expression of ALDOA mRNA CTD PMID:15894607 Aldoa Rat diarsenic trioxide decreases expression ISO RGD:30308195 6480464 Arsenic Trioxide results in decreased expression of ALDOA protein CTD PMID:15894607 Aldoa Rat diazinon increases methylation ISO RGD:30308195 6480464 Diazinon results in increased methylation of ALDOA gene CTD PMID:22964155 Aldoa Rat Dibutyl phosphate affects expression ISO RGD:30308195 6480464 di-n-butylphosphoric acid affects the expression of ALDOA mRNA CTD PMID:37042841 Aldoa Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of ALDOA mRNA CTD PMID:17379624|PMID:21266533 Aldoa Rat diethyl maleate affects expression ISO RGD:30308195 6480464 diethyl maleate affects the expression of ALDOA mRNA CTD PMID:34480604 Aldoa Rat dioxygen increases expression ISO RGD:30308195 6480464 Oxygen deficiency results in increased expression of ALDOA mRNA CTD PMID:10866824|PMID:11739637|PMID:19502547|PMID:20042640|PMID:25596134 Aldoa Rat dioxygen multiple interactions ISO RGD:30308195 6480464 Cadmium inhibits the reaction [Oxygen deficiency results in increased expression of ALDOA mRNA]; HIF1A protein more ... CTD PMID:10866824|PMID:11739637 Aldoa Rat dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate increases expression ISO RGD:30308195 6480464 Antimony Potassium Tartrate results in increased expression of ALDOA mRNA CTD PMID:28713220 Aldoa Rat dopamine increases expression ISO RGD:30308195 6480464 Dopamine results in increased expression of ALDOA protein CTD PMID:24675778 Aldoa Rat elemental selenium increases expression ISO RGD:30308195 6480464 Selenium results in increased expression of ALDOA mRNA CTD PMID:19244175 Aldoa Rat endosulfan decreases expression ISO RGD:30308195 6480464 Endosulfan results in decreased expression of ALDOA mRNA CTD PMID:26615145 Aldoa Rat enzyme inhibitor multiple interactions ISO RGD:30308195 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation more ... CTD PMID:23301498 Aldoa Rat ethanol increases expression EXP 6480464 Ethanol results in increased expression of ALDOA mRNA CTD PMID:17920746 Aldoa Rat ethanol multiple interactions ISO RGD:30308195 6480464 [[Gasoline co-treated with Ethanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic more ... CTD PMID:29432896 Aldoa Rat ethyl methanesulfonate decreases expression ISO RGD:30308195 6480464 Ethyl Methanesulfonate results in decreased expression of ALDOA mRNA CTD PMID:23649840 Aldoa Rat fenofibrate increases expression EXP 6480464 Fenofibrate results in increased expression of ALDOA mRNA CTD PMID:25596134 Aldoa Rat fenvalerate decreases expression EXP 6480464 fenvalerate results in decreased expression of ALDOA protein CTD PMID:33656234 Aldoa Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of ALDOA mRNA CTD PMID:24136188 Aldoa Rat FR900359 affects phosphorylation ISO RGD:30308195 6480464 FR900359 affects the phosphorylation of ALDOA protein CTD PMID:37730182 Aldoa Rat furan increases expression EXP 6480464 furan results in increased expression of ALDOA mRNA CTD PMID:25539665 Aldoa Rat furfural multiple interactions ISO RGD:30308195 6480464 [pyrogallol 1,3-dimethyl ether co-treated with Furaldehyde] results in increased expression of and affects the localization more ... CTD PMID:38598786 Aldoa Rat gentamycin multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in more ... CTD PMID:30545405 Aldoa Rat glafenine increases expression EXP 6480464 Glafenine results in increased expression of ALDOA mRNA CTD PMID:24136188 Aldoa Rat haloperidol increases expression EXP 6480464 Haloperidol results in increased expression of ALDOA mRNA CTD PMID:15860345 Aldoa Rat ibuprofen increases expression ISO RGD:30308195 6480464 Ibuprofen results in increased expression of ALDOA mRNA CTD PMID:25596134 Aldoa Rat ifosfamide increases expression ISO RGD:30308195 6480464 Ifosfamide results in increased expression of ALDOA mRNA CTD PMID:25596134 Aldoa Rat indometacin multiple interactions ISO RGD:30308195 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Aldoa Rat isoflavones multiple interactions EXP 6480464 [ENNG co-treated with Isoflavones] results in increased expression of ALDOA protein CTD PMID:22248470 Aldoa Rat ivermectin decreases expression ISO RGD:30308195 6480464 Ivermectin results in decreased expression of ALDOA protein CTD PMID:32959892 Aldoa Rat keto-D-fructose 1,6-bisphosphate multiple interactions ISO RGD:30308195 6480464 cylindrospermopsin results in increased expression of [ALDOA protein binds to fructose-1,6-diphosphate] CTD PMID:27494769 Aldoa Rat L-ascorbic acid multiple interactions ISO RGD:30308195 6480464 [[Ascorbic Acid co-treated with Chir 99021 co-treated with XAV939 co-treated with BMP4 protein co-treated with more ... CTD PMID:34480604 Aldoa Rat L-ascorbic acid 2-phosphate multiple interactions ISO RGD:30308195 6480464 [[ascorbate-2-phosphate co-treated with Chir 99021 co-treated with XAV939 co-treated with BMP4 protein] co-treated with [INHBA more ... CTD PMID:34480604 Aldoa Rat lead(0) affects expression ISO RGD:30308195 6480464 Lead affects the expression of ALDOA mRNA CTD PMID:28903495 Aldoa Rat lipopolysaccharide multiple interactions EXP 6480464 [Lipopolysaccharides co-treated with Ranitidine] results in increased expression of ALDOA mRNA CTD PMID:16415329 Aldoa Rat Macrosphelide A multiple interactions ISO RGD:30308195 6480464 macrosphelide A binds to and results in decreased activity of ALDOA protein CTD PMID:34681284 Aldoa Rat Macrosphelide A affects binding ISO RGD:30308195 6480464 macrosphelide A binds to ALDOA protein CTD PMID:34681284 Aldoa Rat manganese(II) chloride increases expression EXP 6480464 manganese chloride results in increased expression of ALDOA mRNA CTD PMID:22281203 Aldoa Rat metformin increases expression EXP 6480464 Metformin results in increased expression of ALDOA mRNA CTD PMID:25596134 Aldoa Rat methapyrilene increases expression EXP 6480464 Methapyrilene results in increased expression of ALDOA mRNA CTD PMID:16393664|PMID:28935588 Aldoa Rat methotrexate decreases expression ISO RGD:30308195 6480464 Methotrexate results in decreased expression of ALDOA protein CTD PMID:24736981 Aldoa Rat methyl methanesulfonate decreases expression ISO RGD:30308195 6480464 Methyl Methanesulfonate results in decreased expression of ALDOA mRNA CTD PMID:23649840 Aldoa Rat metronidazole multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in more ... CTD PMID:30545405 Aldoa Rat N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of ALDOA mRNA CTD PMID:19638242 Aldoa Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of ALDOA mRNA; [Diethylnitrosamine co-treated with Thioacetamide] more ... CTD PMID:17602206|PMID:28943392 Aldoa Rat N1'-[2-[[5-[(dimethylamino)methyl]-2-furanyl]methylthio]ethyl]-N1-methyl-2-nitroethene-1,1-diamine multiple interactions EXP 6480464 [Lipopolysaccharides co-treated with Ranitidine] results in increased expression of ALDOA mRNA CTD PMID:16415329 Aldoa Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of ALDOA mRNA CTD PMID:24136188 Aldoa Rat neomycin multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in more ... CTD PMID:30545405 Aldoa Rat nitrofurantoin increases expression EXP 6480464 Nitrofurantoin results in increased expression of ALDOA mRNA; Nitrofurantoin results in increased expression of ALDOA more ... CTD PMID:11841787 Aldoa Rat obeticholic acid decreases expression ISO RGD:30308195 6480464 obeticholic acid results in decreased expression of ALDOA mRNA CTD PMID:27939613 Aldoa Rat okadaic acid decreases expression ISO RGD:30308195 6480464 Okadaic Acid results in decreased expression of ALDOA protein CTD PMID:19397276 Aldoa Rat ozone increases phosphorylation EXP 6480464 Ozone results in increased phosphorylation of ALDOA protein CTD PMID:33146391 Aldoa Rat ozone increases expression EXP 6480464 Ozone results in increased expression of ALDOA mRNA CTD PMID:25838073|PMID:35737395 Aldoa Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of ALDOA protein CTD PMID:15800402 Aldoa Rat perfluorooctane-1-sulfonic acid increases expression ISO RGD:30308195 6480464 perfluorooctane sulfonic acid results in increased expression of ALDOA mRNA CTD PMID:27153767 Aldoa Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of ALDOA mRNA; [Zeranol co-treated with more ... CTD PMID:35163327 Aldoa Rat perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of ALDOA mRNA CTD PMID:19162173|PMID:21318169 Aldoa Rat PhIP increases expression EXP 6480464 2-amino-1-methyl-6-phenylimidazo(4,5-b)pyridine results in increased expression of ALDOA mRNA CTD PMID:15215175 Aldoa Rat phorone increases expression EXP 6480464 phorone results in increased expression of ALDOA mRNA; phorone results in increased expression of ALDOA more ... CTD PMID:11841787 Aldoa Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of ALDOA mRNA CTD PMID:19162173|PMID:21318169 Aldoa Rat quercetin decreases expression EXP 6480464 Quercetin results in decreased expression of ALDOA protein CTD PMID:18095365 Aldoa Rat quercetin increases expression ISO RGD:30308195 6480464 Quercetin results in increased expression of ALDOA protein CTD PMID:17292933 Aldoa Rat quinidine increases expression EXP 6480464 Quinidine results in increased expression of ALDOA mRNA CTD PMID:17522070 Aldoa Rat ranitidine multiple interactions EXP 6480464 [Lipopolysaccharides co-treated with Ranitidine] results in increased expression of ALDOA mRNA CTD PMID:16415329 Aldoa Rat S-butyl-DL-homocysteine (S,R)-sulfoximine increases expression EXP 6480464 Buthionine Sulfoximine results in increased expression of ALDOA mRNA; Buthionine Sulfoximine results in increased expression more ... CTD PMID:11841787|PMID:23736079 Aldoa Rat sarin decreases expression ISO RGD:30308195 6480464 Sarin results in decreased expression of ALDOA mRNA CTD PMID:19522546 Aldoa Rat SB 431542 multiple interactions ISO RGD:30308195 6480464 [LDN 193189 co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with EGF protein co-treated with FGF2 protein] results in more ... CTD PMID:34480604|PMID:37664457 Aldoa Rat selenium atom increases expression ISO RGD:30308195 6480464 Selenium results in increased expression of ALDOA mRNA CTD PMID:19244175 Aldoa Rat silicon dioxide increases secretion ISO RGD:30308195 6480464 Silicon Dioxide analog results in increased secretion of ALDOA protein CTD PMID:25895662 Aldoa Rat sodium arsenite increases expression ISO RGD:30308195 6480464 sodium arsenite results in increased expression of ALDOA mRNA; sodium arsenite results in increased expression more ... CTD PMID:15899475|PMID:28713220|PMID:38568856 Aldoa Rat sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of ALDOA protein CTD PMID:29459688 Aldoa Rat sodium chloride multiple interactions ISO RGD:30308195 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of more ... CTD PMID:38598786 Aldoa Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of ALDOA mRNA CTD PMID:25993096 Aldoa Rat sunitinib increases expression ISO RGD:30308195 6480464 Sunitinib results in increased expression of ALDOA mRNA CTD PMID:31533062 Aldoa Rat tamoxifen increases expression EXP 6480464 Tamoxifen results in increased expression of ALDOA mRNA CTD PMID:19400957 Aldoa Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of ALDOA mRNA CTD PMID:17522070|PMID:31150632 Aldoa Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of ALDOA mRNA] CTD PMID:31150632 Aldoa Rat tetracycline increases expression EXP 6480464 Tetracycline results in increased expression of ALDOA mRNA CTD PMID:17522070 Aldoa Rat thapsigargin increases expression EXP 6480464 Thapsigargin results in increased expression of ALDOA protein CTD PMID:35544339 Aldoa Rat thifluzamide increases expression ISO RGD:30308195 6480464 thifluzamide results in increased expression of ALDOA mRNA CTD PMID:33512557 Aldoa Rat thimerosal decreases expression ISO RGD:30308195 6480464 Thimerosal results in decreased expression of ALDOA mRNA CTD PMID:27188386 Aldoa Rat thioacetamide multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in increased expression of ALDOA mRNA CTD PMID:28943392 Aldoa Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of ALDOA mRNA CTD PMID:23411599 Aldoa Rat trichostatin A decreases expression ISO RGD:30308195 6480464 trichostatin A results in decreased expression of ALDOA mRNA CTD PMID:27188386 Aldoa Rat trichostatin A increases expression ISO RGD:30308195 6480464 trichostatin A results in increased expression of ALDOA mRNA CTD PMID:24935251 Aldoa Rat triclosan decreases expression ISO RGD:30308195 6480464 Triclosan results in decreased expression of ALDOA mRNA CTD PMID:30510588 Aldoa Rat triphenyl phosphate affects expression ISO RGD:30308195 6480464 triphenyl phosphate affects the expression of ALDOA mRNA CTD PMID:37042841 Aldoa Rat triphenylstannane decreases expression ISO RGD:30308195 6480464 triphenyltin analog results in decreased expression of ALDOA protein CTD PMID:31634547 Aldoa Rat troglitazone increases expression EXP 6480464 Troglitazone results in increased expression of ALDOA mRNA CTD PMID:25596134 Aldoa Rat valproic acid decreases expression ISO RGD:30308195 6480464 Valproic Acid results in decreased expression of ALDOA mRNA CTD PMID:23179753 Aldoa Rat valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of ALDOA mRNA CTD PMID:21318169 Aldoa Rat valproic acid increases methylation ISO RGD:30308195 6480464 Valproic Acid results in increased methylation of ALDOA gene CTD PMID:29154799 Aldoa Rat vancomycin multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in more ... CTD PMID:30545405 Aldoa Rat vitamin E increases expression ISO RGD:30308195 6480464 Vitamin E results in increased expression of ALDOA mRNA CTD PMID:19244175 Aldoa Rat vorinostat decreases expression ISO RGD:30308195 6480464 Vorinostat results in decreased expression of ALDOA mRNA CTD PMID:27188386 Aldoa Rat XAV939 multiple interactions ISO RGD:30308195 6480464 [[ascorbate-2-phosphate co-treated with Chir 99021 co-treated with XAV939 co-treated with BMP4 protein] co-treated with [INHBA more ... CTD PMID:34480604 Aldoa Rat Yessotoxin increases expression ISO RGD:30308195 6480464 yessotoxin analog results in increased expression of ALDOA mRNA CTD PMID:30679557 Aldoa Rat zinc atom affects binding ISO RGD:30308195 6480464 ALDOA protein binds to Zinc CTD PMID:14534351 Aldoa Rat zinc dichloride multiple interactions ISO RGD:30308195 6480464 zinc chloride inhibits the reaction [cobaltous chloride results in increased expression of ALDOA mRNA] CTD PMID:22202117 Aldoa Rat zinc(0) affects binding ISO RGD:30308195 6480464 ALDOA protein binds to Zinc CTD PMID:14534351
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
Aldoa Rat cytoskeletal protein binding enables ISO RGD:30308195 1624291 PMID:9244396 RGD PMID:9244396 Aldoa Rat fructose binding enables ISO RGD:30308195 1624291 PMID:10048322, PMID:14766013 RGD PMID:10048322|PMID:14766013 Aldoa Rat fructose-bisphosphate aldolase activity enables ISS UniProtKB:P00883 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Aldoa Rat fructose-bisphosphate aldolase activity enables IEA EC:4.1.2.13 1600115 GO_REF:0000003 UniProt GO_REF:0000003 Aldoa Rat fructose-bisphosphate aldolase activity enables IEA RHEA:14729 1600115 GO_REF:0000116 RHEA GO_REF:0000116 Aldoa Rat fructose-bisphosphate aldolase activity enables IBA FB:FBgn0000064|MGI:101863|MGI:87994|MGI:87995|PANTHER:PTN000179343|RGD:2090|RGD:2091|TAIR:locus:2044856|UniProtKB:P04075|UniProtKB:P05062|UniProtKB:P08440|UniProtKB:P09972|UniProtKB:P16096|UniProtKB:P29356|WB:WBGene00011474 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Aldoa Rat fructose-bisphosphate aldolase activity enables ISO RGD:13986036 1624291 PMID:19081846 RGD PMID:19081846 Aldoa Rat fructose-bisphosphate aldolase activity enables ISO RGD:30308195 1624291 PMID:14766013, PMID:9244396 RGD PMID:14766013|PMID:9244396 Aldoa Rat fructose-bisphosphate aldolase activity enables IEA InterPro:IPR000741 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Aldoa Rat identical protein binding enables ISO RGD:30308195,UniProtKB:P04075-2 1624291 UniProtKB:P04075-2 PMID:25416956, PMID:32296183 RGD PMID:25416956|PMID:32296183 Aldoa Rat identical protein binding enables ISO RGD:30308195 1624291 UniProtKB:P04075 PMID:10944123, PMID:21988832 RGD PMID:10944123|PMID:21988832 Aldoa Rat lyase activity enables IEA UniProtKB-KW:KW-0456 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Aldoa Rat protein binding enables ISO RGD:30308195 1624291 UniProtKB:P05062|UniProtKB:P09972|UniProtKB:P12004|UniProtKB:Q12836|UniProtKB:Q86X55 PMID:20849852, PMID:21988832, PMID:23355646, PMID:26496610, PMID:28514442, PMID:31515488, PMID:33961781 RGD PMID:20849852|PMID:21988832|PMID:23355646|PMID:26496610|PMID:28514442|PMID:31515488|PMID:33961781 Aldoa Rat protein binding enables ISO RGD:30308195,UniProtKB:P04075-2 1624291 UniProtKB:P05014|UniProtKB:P09972|UniProtKB:P42858 PMID:25416956, PMID:25910212, PMID:32814053 RGD PMID:25416956|PMID:25910212|PMID:32814053 Aldoa Rat protein binding enables IPI UniProtKB:Q80Z30 8553307 PMID:15680915 IntAct
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(+)-schisandrin B (EXP) (-)-epigallocatechin 3-gallate (ISO) 1,10-phenanthroline (ISO) 1-naphthyl isothiocyanate (EXP) 14-Deoxy-11,12-didehydroandrographolide (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP) 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP) 2,4-dinitrotoluene (EXP) 2,6-dimethoxyphenol (ISO) 3-chloropropane-1,2-diol (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-amino-2,6-dinitrotoluene (EXP) 4-hydroxynon-2-enal (ISO) 6-propyl-2-thiouracil (EXP) 7,12-dimethyltetraphene (EXP) acetamide (EXP) acetylsalicylic acid (ISO) acrylamide (EXP) aflatoxin B1 (EXP,ISO) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) ammonium chloride (EXP) ampicillin (EXP) antimycin A (ISO) aristolochic acid A (ISO) arotinoid acid (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) atrazine (ISO) azoxystrobin (ISO) beauvericin (ISO) benzo[a]pyrene (ISO) beta-D-fructofuranose 1,6-bisphosphate (ISO) bexarotene (EXP) bis(2-chloroethyl) sulfide (EXP) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) butan-1-ol (ISO) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) calcidiol (EXP) carbamazepine (ISO) carbon nanotube (ISO) cefaloridine (EXP) CGP 52608 (ISO)
References
References - curated
#
Reference Title
Reference Citation
1.
Estrogen regulation of the rat anterior pituitary gland proteome.
Blake CA, etal., Exp Biol Med (Maywood). 2005 Dec;230(11):800-7.
2.
Proteomic analysis of pancreatic ductal adenocarcinoma compared with normal adjacent pancreatic tissue and pancreatic benign cystadenoma.
Cui Y, etal., Pancreatology. 2009;9(1-2):89-98. Epub 2008 Dec 12.
3.
Changes in endoplasmic reticulum stress proteins and aldolase A in cells exposed to dopamine.
Dukes AA, etal., J Neurochem. 2008 Jul;106(1):333-46. Epub 2008 Jul 1.
4.
Simvastatin induces apoptosis of cultured rat cardiomyocytes.
El-Ani D and Zimlichman R, J Basic Clin Physiol Pharmacol. 2001;12(4):325-38.
5.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
7.
Location of adult and fetal aldolases A, B, and C by immunoperoxidase technique in LF fast-growing rat hepatomas.
Hatzfeld A, etal., Cancer Res. 1978 Jan;38(1):16-22.
8.
Proteins differentially expressed in response to nicotine in five rat brain regions: identification using a 2-DE/MS-based proteomics approach.
Hwang YY and Li MD, Proteomics. 2006 May;6(10):3138-53.
9.
Identification of major Ca(2+)/calmodulin-dependent protein kinase phosphatase-binding proteins in brain: biochemical analysis of the interaction.
Ishida A, etal., Arch Biochem Biophys. 2005 Mar 1;435(1):134-46.
10.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
11.
Upregulation of aldolase B and overproduction of methylglyoxal in vascular tissues from rats with metabolic syndrome.
Liu J, etal., Cardiovasc Res. 2011 Dec 1;92(3):494-503. doi: 10.1093/cvr/cvr239. Epub 2011 Sep 2.
12.
Aldolase A is present in smooth muscle cell nuclei.
Mamczur P and Dzugaj A, Acta Biochim Pol. 2008;55(4):799-805. Epub 2008 Dec 16.
13.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
14.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
15.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
16.
Aldolase-B knockout in mice phenocopies hereditary fructose intolerance in humans.
Oppelt SA, etal., Mol Genet Metab. 2015 Mar;114(3):445-50. doi: 10.1016/j.ymgme.2015.01.001. Epub 2015 Jan 22.
17.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
18.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
19.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
20.
GOA pipeline
RGD automated data pipeline
21.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
22.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
23.
Comprehensive gene review and curation
RGD comprehensive gene curation
24.
Aldolase variants: structure and physiological significance.
Rutter WJ, etal., Ann N Y Acad Sci. 1968 Jun 14;151(1):102-17.
25.
LPS increases hepatic HIF-1alpha protein and expression of the HIF-1-dependent gene aldolase A in rats.
Scharte M, etal., J Surg Res. 2006 Oct;135(2):262-7. Epub 2006 Aug 23.
26.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
27.
Differential activation of some transcription factors during rat liver ischemia, reperfusion, and heat shock.
Tacchini L, etal., J Cell Physiol. 1999 Aug;180(2):255-62.
28.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
29.
Two different aldolase A mRNA species in rat tissues.
Tsutsumi R, etal., Eur J Biochem 1984 Jul 2;142(1):161-4.
Additional References at PubMed
Genomics
Comparative Map Data
Aldoa (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 190,832,820 - 190,838,021 (-) NCBI GRCr8 mRatBN7.2 1 181,402,275 - 181,407,476 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 181,402,275 - 181,406,182 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 189,753,603 - 189,758,803 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 196,939,676 - 196,944,877 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 189,607,009 - 189,612,203 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 198,228,387 - 198,233,988 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 198,228,387 - 198,233,588 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 205,208,255 - 205,213,627 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 185,970,658 - 185,974,615 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 186,120,538 - 186,124,496 (-) NCBI Celera 1 179,057,793 - 179,062,995 (-) NCBI Celera RH 2.0 Map 1 968.2 RGD Cytogenetic Map 1 q36 NCBI
ALDOA (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 16 30,064,279 - 30,070,420 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 16 30,064,164 - 30,070,457 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 16 30,075,600 - 30,081,741 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Cytogenetic Map 16 p11.2 NCBI HuRef 16 27,725,968 - 27,743,009 (+) NCBI HuRef CHM1_1 16 31,280,168 - 31,297,498 (+) NCBI CHM1_1 T2T-CHM13v2.0 16 30,346,925 - 30,353,065 (+) NCBI T2T-CHM13v2.0
ALDOA (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 18 30,814,063 - 30,820,272 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 16 35,405,588 - 35,411,803 (-) NCBI NHGRI_mPanPan1
ALDOA (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 6 18,077,241 - 18,083,053 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 6 19,655,871 - 19,661,649 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 6 18,213,209 - 18,218,992 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 6 18,205,846 - 18,218,992 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 6 18,012,169 - 18,017,945 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 6 17,927,573 - 17,933,346 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 6 18,243,185 - 18,248,968 (+) NCBI UU_Cfam_GSD_1.0
ALDOA (Sus scrofa - pig)
ALDOA (Chlorocebus sabaeus - green monkey)
miRNA Target Status (No longer updated)
Predicted Target Of
Count of predictions: 50 Count of miRNA genes: 45 Interacting mature miRNAs: 49 Transcripts: ENSRNOT00000032362 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
QTLs in Region (GRCr8)
1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 1354652 Kidm20 Kidney mass QTL 20 4.3 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 177227632 256448636 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 1354653 Despr9 Despair related QTL 9 0.00019 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 167909849 212909849 Rat 1578770 Stresp23 Stress response QTL 23 kidney sympathetic nerve activity (VT:0004050) stimulated renal sympathetic nerve activity to basal renal sympathetic nerve activity ratio (CMO:0001786) 1 123350408 182418476 Rat 2293673 Bss27 Bone structure and strength QTL 27 18.63 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 1 171629477 216629477 Rat 61326 Eae6 Experimental allergic encephalomyelitis QTL 6 5.3 body mass (VT:0001259) change in body weight (CMO:0002045) 1 172949660 181830018 Rat 2293677 Bss41 Bone structure and strength QTL 41 9.38 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 1 171629477 216629477 Rat 1302787 Stl25 Serum triglyceride level QTL 25 2.7 0.0073 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 1 180359209 210702199 Rat 70160 Bw18 Body weight QTL 18 5.7 body mass (VT:0001259) body weight (CMO:0000012) 1 144267353 196383668 Rat 1549830 Bss1 Bone structure and strength QTL 1 4.8 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 172609619 217609619 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 70163 Bw20 Body weight QTL 20 5.1 body mass (VT:0001259) body weight (CMO:0000012) 1 174133260 219133260 Rat 1578763 Kidm29 Kidney mass QTL 29 3.3 0.0001 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 1 179567751 260522016 Rat 1354624 Cm35 Cardiac mass QTL35 5.7 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 177227632 256448636 Rat 1558658 Bw59 Body weight QTL 59 3.5 0.0003 body mass (VT:0001259) body weight (CMO:0000012) 1 178784622 223784622 Rat 1354636 Lmblg1 Limb length QTL 1 6.4 tibia length (VT:0004357) tibia length (CMO:0000450) 1 151162512 201278233 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 2293689 Bss47 Bone structure and strength QTL 47 7.25 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 1 171629477 216629477 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1598853 Memor3 Memory QTL 3 4.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 1 143506580 212458660 Rat 61341 Bp26 Blood pressure QTL 26 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 169537671 214537671 Rat 1354634 Kidm12 Kidney mass QTL 12 3.9 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 1 151162512 201278233 Rat 4889428 Stresp24 Stress response QTL 24 0.05 heart pumping trait (VT:2000009) absolute change in electrocardiographic low frequency R-R spectral component to high frequency R-R spectral component ratio (CMO:0002162) 1 155866514 200866514 Rat 152025232 Bw192 Body weight QTL 192 3.93 body mass (VT:0001259) 1 117917486 196963478 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 61343 Bp28 Blood pressure QTL 28 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 151646613 196646613 Rat 2293693 Bss22 Bone structure and strength QTL 22 33.52 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 1 171629477 216629477 Rat 2300161 Bmd43 Bone mineral density QTL 43 8.4 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 61347 Bp197 Blood pressure QTL 197 4.2 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 1 158633083 203633083 Rat 61348 Bp30 Blood pressure QTL 30 2.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 144017057 197814409 Rat 8655649 Arrd1 Age-related retinal degeneration QTL 1 4.89 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 100357752 183970443 Rat 2303622 Vencon6 Ventilatory control QTL 6 0.001 respiration trait (VT:0001943) respiration rate (CMO:0000289) 1 154561505 199561505 Rat 631214 Bw61 Body weight QTL61 3.4 0.0001 intramuscular adipose amount (VT:0010044) intramuscular fat area (CMO:0001162) 1 173108781 218108781 Rat 7771612 Cm80 Cardiac mass QTL 80 8.4 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 1 149448574 221264292 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 631205 Bp196 Blood pressure QTL 196 4 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118944897 199050459 Rat 1300158 Bp173 Blood pressure QTL 173 3.48 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 1 115540693 185145286 Rat 2300174 Bmd42 Bone mineral density QTL 42 8.4 0.0001 lumbar vertebra mineral mass (VT:0010511) bone mineral density (CMO:0001226) 1 171629477 216629477 Rat 737828 Hcas3 Hepatocarcinoma susceptibility QTL 3 4.9 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 1 144267353 222987745 Rat 1331749 Hrtrt11 Heart rate QTL 11 2.973 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 94494440 198211706 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1358886 Bp260 Blood pressure QTL 260 3.67 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 151162766 225824951 Rat 737977 Bp160 Blood pressure QTL 160 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 181133855 226133855 Rat 1331751 Bp199 Blood pressure QTL 199 3.60022 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 94494440 181830018 Rat 2293654 Bss30 Bone structure and strength QTL 30 32.65 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 1 171629477 216629477 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 2300187 Bmd41 Bone mineral density QTL 41 8.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 1641895 Bp298 Blood pressure QTL 298 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 123350408 182418476 Rat 70209 Niddm23 Non-insulin dependent diabetes mellitus QTL 23 2.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 94494440 198324465 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 1358294 Bw37 Body weight QTL 37 5 0.000011 body mass (VT:0001259) body weight (CMO:0000012) 1 171310381 216310381 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 2312420 Pur17 Proteinuria QTL 17 7.1 0.0001 urine protein amount (VT:0005160) urine total protein excretion rate (CMO:0000756) 1 156677124 218753816 Rat 10059600 Bp378 Blood pressure QTL 378 3.08 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 176869060 221869060 Rat 1354591 Cm36 Cardiac mass QTL 36 4.1 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 102813953 201278233 Rat 724550 Thym3 Thymus enlargement QTL 3 7.82 0.001 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 136829932 181829932 Rat 2312558 Glom17 Glomerulus QTL 17 3.9 0.001 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 1 166532971 191278129 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 71118 Thym1 Thymus enlargement QTL 1 10.17 0.001 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 136829932 181829932 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 619613 Bp77 Blood pressure QTL 77 0.01 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 164747424 209747424 Rat 631519 Pia11 Pristane induced arthritis QTL 11 5.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 1 136830018 181830018 Rat 619614 Bp78 Blood pressure QTL 78 0.001 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 169112897 197261052 Rat 634321 Hc1 Hypercalciuria QTL 1 2.91 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 178810256 240830002 Rat 724562 Rends1 Renal damage susceptibility QTL 1 0.05 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 1 169537671 214537671 Rat 2292222 Bp307 Blood pressure QTL 307 3.06 0.0014 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 213533942 Rat 2292220 Bp306 Blood pressure QTL 306 3.47 0.00087 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 243914901 Rat 1354615 Cm32 Cardiac mass QTL 32 5.2 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 102813953 201278233 Rat 1600380 Niddm70 Non-insulin dependent diabetes mellitus QTL 70 3.1 0.0008 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 176550523 221550523 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1354620 Kidm19 Kidney mass QTL 19 4 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 201278233 Rat 1354618 Kidm15 Kidney mass QTL 15 5 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 1 156677124 201278233 Rat 6903303 Scl34 Serum cholesterol QTL 34 2.5 0.0033 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 180359209 218108781 Rat 631544 Bp84 Blood pressure QTL 84 5.6 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350408 181759564 Rat 152025212 Bw190 Body weight QTL 190 5.7 body mass (VT:0001259) 1 123556856 196963478 Rat 631549 Bp89 Blood pressure QTL 89 5.7 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350581 201284552 Rat 1358189 Cstrr1 Cold stress response QTL 1 0.0001 catecholamine amount (VT:0010543) urine norepinephrine level (CMO:0001629) 1 123350408 182418476 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat 738032 Hcas5 Hepatocarcinoma susceptibility QTL 5 3.12 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 176426412 257976495 Rat 1354602 Bw35 Body weight QTL 35 12.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 201278233 Rat 2325725 Eae31 Experimental allergic encephalomyelitis QTL 31 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis severity score (CMO:0001419) 1 178810256 188377506 Rat 631670 Iddm10 Insulin dependent diabetes mellitus QTL 10 1.9 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 174133260 196383668 Rat
Markers in Region
D1Arb19
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 181,406,902 - 181,407,091 (+) MAPPER mRatBN7.2 Rnor_6.0 1 198,233,015 - 198,233,203 NCBI Rnor6.0 Rnor_5.0 1 205,212,888 - 205,213,076 UniSTS Rnor5.0 RGSC_v3.4 1 185,975,285 - 185,975,474 RGD RGSC3.4 RGSC_v3.4 1 185,975,286 - 185,975,474 UniSTS RGSC3.4 RGSC_v3.1 1 186,125,166 - 186,125,355 RGD Celera 1 179,062,422 - 179,062,610 UniSTS Cytogenetic Map 1 q36 UniSTS
D1Mco16
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 181,402,086 - 181,402,308 (+) MAPPER mRatBN7.2 Rnor_6.0 1 198,228,199 - 198,228,420 NCBI Rnor6.0 Rnor_5.0 1 205,208,067 - 205,208,288 UniSTS Rnor5.0 RGSC_v3.4 1 185,970,469 - 185,970,691 RGD RGSC3.4 RGSC_v3.4 1 185,970,470 - 185,970,691 UniSTS RGSC3.4 RGSC_v3.1 1 186,120,350 - 186,120,572 RGD Celera 1 179,057,605 - 179,057,826 UniSTS Cytogenetic Map 1 q36 UniSTS
D1Wox41
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 181,406,863 - 181,406,982 (+) MAPPER mRatBN7.2 Rnor_6.0 1 198,232,976 - 198,233,094 NCBI Rnor6.0 Rnor_5.0 1 205,212,849 - 205,212,967 UniSTS Rnor5.0 RGSC_v3.4 1 185,975,247 - 185,975,365 UniSTS RGSC3.4 Celera 1 179,062,383 - 179,062,501 UniSTS Cytogenetic Map 1 q36 UniSTS
RH47250
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 181,402,672 - 181,402,798 (+) MAPPER mRatBN7.2 mRatBN7.2 13 34,330,138 - 34,330,264 (+) MAPPER mRatBN7.2 Rnor_6.0 13 39,163,263 - 39,163,388 NCBI Rnor6.0 Rnor_6.0 1 198,228,785 - 198,228,910 NCBI Rnor6.0 Rnor_5.0 13 44,288,027 - 44,288,152 UniSTS Rnor5.0 Rnor_5.0 1 205,208,653 - 205,208,778 UniSTS Rnor5.0 RGSC_v3.4 1 185,971,056 - 185,971,181 UniSTS RGSC3.4 RGSC_v3.4 13 35,262,315 - 35,262,440 UniSTS RGSC3.4 Celera 13 34,151,560 - 34,151,685 UniSTS Celera 1 179,058,191 - 179,058,316 UniSTS Cytogenetic Map 1 q36 UniSTS
ALDOA
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 18 29,096,639 - 29,096,885 (+) MAPPER mRatBN7.2 Rnor_6.0 18 30,466,289 - 30,466,534 NCBI Rnor6.0 Rnor_5.0 18 30,173,484 - 30,173,729 UniSTS Rnor5.0 RGSC_v3.4 18 30,200,938 - 30,201,183 UniSTS RGSC3.4 Celera 18 28,792,419 - 28,792,664 UniSTS Cytogenetic Map 18 p11 UniSTS Cytogenetic Map 1 q36 UniSTS
Aldoa
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 18 29,095,655 - 29,096,644 (+) MAPPER mRatBN7.2 Rnor_6.0 18 30,465,305 - 30,466,293 NCBI Rnor6.0 Rnor_5.0 18 30,172,500 - 30,173,488 UniSTS Rnor5.0 RGSC_v3.4 18 30,199,954 - 30,200,942 UniSTS RGSC3.4 Celera 18 28,791,435 - 28,792,423 UniSTS Cytogenetic Map 18 p11 UniSTS Cytogenetic Map 1 q36 UniSTS
Expression
RNA-SEQ Expression
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Sequence
Ensembl Acc Id:
ENSRNOT00000080988 ⟹ ENSRNOP00000068764
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 181,402,275 - 181,406,182 (-) Ensembl Rnor_6.0 Ensembl 1 198,228,387 - 198,232,344 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000087928 ⟹ ENSRNOP00000069507
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 181,402,275 - 181,406,182 (-) Ensembl Rnor_6.0 Ensembl 1 198,228,387 - 198,233,215 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000088473 ⟹ ENSRNOP00000069540
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 1 198,228,387 - 198,233,588 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000112001 ⟹ ENSRNOP00000093578
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 181,402,437 - 181,406,181 (-) Ensembl
RefSeq Acc Id:
NM_001177305 ⟹ NP_001170776
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 190,832,820 - 190,837,648 (-) NCBI mRatBN7.2 1 181,402,275 - 181,407,103 (-) NCBI Rnor_6.0 1 198,228,387 - 198,233,215 (-) NCBI Rnor_5.0 1 205,208,255 - 205,213,627 (-) NCBI Celera 1 179,057,793 - 179,062,622 (-) NCBI
Sequence:
GCTGCTGACCAGGCTCTGCGGCTTCTTTCACTGCACCACAGGAAAGCGCTGCCACCGGCACCAT GCCCCACCCATACCCAGCACTGACCCCGGAGCAGAAGAAGGAGCTGGCTGACATCGCTCACCGA ATTGTAGCTCCGGGCAAGGGCATCCTGGCTGCAGACGAGTCCACTGGAAGCATTGCCAAGCGCC TGCAGTCCATTGGCACCGAGAACACCGAGGAGAACAGGCGCTTCTACCGCCAACTGCTGCTGAC TGCCGATGACCGTGTGAATCCCTGCATTGGAGGGGTGATCCTTTTCCACGAGACACTGTACCAG AAGGCAGATGATGGCCGTCCCTTCCCCCAAGTTATCAAGTCCAAGGGTGGTGTTGTGGGCATTA AGGTAGATAAGGGTGTAGTGCCCCTGGCTGGAACCAATGGCGAGACCACTACTCAAGGGCTGGA CGGGCTGTCTGAGCGCTGTGCCCAGTATAAGAAGGATGGAGCCGACTTTGCCAAGTGGCGCTGT GTGCTAAAGATTGGGGAGCATACTCCCTCGTCCCTCGCCATCATGGAAAATGCCAATGTTCTGG CCCGTTACGCCAGCATCTGCCAGCAGAATGGCATTGTACCCATTGTGGAGCCTGAAATTCTCCC TGATGGGGACCATGACTTGAAGCGCTGCCAGTATGTAACTGAGAAGGTACTGGCAGCTGTCTAC AAGGCTCTGAGTGACCACCATGTCTATCTGGAAGGCACACTGCTGAAGCCCAACATGGTCACCC CTGGCCATGCTTGCACCCAGAAATTTTCCAATGAGGAAATTGCCATGGCAACCGTCACAGCACT TCGTCGAACAGTGCCCCCTGCCGTCCCTGGGGTCACTTTCCTGTCTGGAGGGCAGAGTGAGGAA GAGGCATCCATCAACCTCAATGCTATCAACAAGTGTCCCCTGCTGAAGCCATGGGCCTTGACTT TCTCCTATGGCCGAGCCCTGCAGGCCTCTGCTCTAAAGGCTTGGGGTGGGAAGAAGGAGAACCT GAAGGCAGCCCAGGAGGAGTACATCAAGCGAGCCCTGGCCAACAGCCTCGCTTGTCAAGGAAAG TACACTCCAAGTGGCCAGTCTGGAGCCGCAGCCAGTGAATCTCTCTTCATCTCTAACCATGCCT ACTAACCAGAGCTGATCTAAGGCTGCTCCATCGACACTCCAGGCCCCTGCCTACCCACTTGCTA TTGAAGAGGGGCCTTCAGGCTCTTTCCCATCACTCTTGCTGCCCTCGTGTGTGCAGTGTTGTCT GTGAATGCTAAATCTGCCATCCCTTCCAGCCCACTGCCAATAAACAGCTATTTAAGGGGGAAAA AAAAAAAAAAAAAAAAAAA
hide sequence
RefSeq Acc Id:
NM_001271536 ⟹ NP_001258465
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 190,832,820 - 190,838,021 (-) NCBI mRatBN7.2 1 181,402,275 - 181,407,476 (-) NCBI Rnor_6.0 1 198,228,387 - 198,233,588 (-) NCBI Rnor_5.0 1 205,208,255 - 205,213,627 (-) NCBI Celera 1 179,057,793 - 179,062,995 (-) NCBI
Sequence:
CGGAGTCAGTGGGAGGCAGCATCTAGATGTTTTCCCTTCTTGTTCTGCCTTAACAGATCCCGGA CCTGAGATTGATTTCTCGACGAAGGTCACTGTATTTCTAAGGAAGAGTTTCTTCTAAAGACCGG AAAGCGCTGCCACCGGCACCATGCCCCACCCATACCCAGCACTGACCCCGGAGCAGAAGAAGGA GCTGGCTGACATCGCTCACCGAATTGTAGCTCCGGGCAAGGGCATCCTGGCTGCAGACGAGTCC ACTGGAAGCATTGCCAAGCGCCTGCAGTCCATTGGCACCGAGAACACCGAGGAGAACAGGCGCT TCTACCGCCAACTGCTGCTGACTGCCGATGACCGTGTGAATCCCTGCATTGGAGGGGTGATCCT TTTCCACGAGACACTGTACCAGAAGGCAGATGATGGCCGTCCCTTCCCCCAAGTTATCAAGTCC AAGGGTGGTGTTGTGGGCATTAAGGTAGATAAGGGTGTAGTGCCCCTGGCTGGAACCAATGGCG AGACCACTACTCAAGGGCTGGACGGGCTGTCTGAGCGCTGTGCCCAGTATAAGAAGGATGGAGC CGACTTTGCCAAGTGGCGCTGTGTGCTAAAGATTGGGGAGCATACTCCCTCGTCCCTCGCCATC ATGGAAAATGCCAATGTTCTGGCCCGTTACGCCAGCATCTGCCAGCAGAATGGCATTGTACCCA TTGTGGAGCCTGAAATTCTCCCTGATGGGGACCATGACTTGAAGCGCTGCCAGTATGTAACTGA GAAGGTACTGGCAGCTGTCTACAAGGCTCTGAGTGACCACCATGTCTATCTGGAAGGCACACTG CTGAAGCCCAACATGGTCACCCCTGGCCATGCTTGCACCCAGAAATTTTCCAATGAGGAAATTG CCATGGCAACCGTCACAGCACTTCGTCGAACAGTGCCCCCTGCCGTCCCTGGGGTCACTTTCCT GTCTGGAGGGCAGAGTGAGGAAGAGGCATCCATCAACCTCAATGCTATCAACAAGTGTCCCCTG CTGAAGCCATGGGCCTTGACTTTCTCCTATGGCCGAGCCCTGCAGGCCTCTGCTCTAAAGGCTT GGGGTGGGAAGAAGGAGAACCTGAAGGCAGCCCAGGAGGAGTACATCAAGCGAGCCCTGGCCAA CAGCCTCGCTTGTCAAGGAAAGTACACTCCAAGTGGCCAGTCTGGAGCCGCAGCCAGTGAATCT CTCTTCATCTCTAACCATGCCTACTAACCAGAGCTGATCTAAGGCTGCTCCATCGACACTCCAG GCCCCTGCCTACCCACTTGCTATTGAAGAGGGGCCTTCAGGCTCTTTCCCATCACTCTTGCTGC CCTCGTGTGTGCAGTGTTGTCTGTGAATGCTAAATCTGCCATCCCTTCCAGCCCACTGCCAATA AACAGCTATTTAAGGGGGAAAAAAAAAAAAAAAAAAAAAAA
hide sequence
RefSeq Acc Id:
NM_012495 ⟹ NP_036627
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 190,832,820 - 190,836,777 (-) NCBI mRatBN7.2 1 181,402,275 - 181,406,232 (-) NCBI Rnor_6.0 1 198,228,387 - 198,232,344 (-) NCBI Rnor_5.0 1 205,208,255 - 205,213,627 (-) NCBI RGSC_v3.4 1 185,970,658 - 185,974,615 (-) RGD Celera 1 179,057,793 - 179,061,750 (-) NCBI
Sequence:
GTCCCCCCCACCCCAGCTGAATAGGCTGCGTTCTCTTGGAACGCGCCGCAGAACGAGGTTCTGG TGACCCTAGCCGCGTTCCCTCCTTAGTCCTTTCGCCTACCCACCCGCGTACCCGACAGACCCAC CCCGTCCTGTGCCAGGAAAGCGCTGCCACCGGCACCATGCCCCACCCATACCCAGCACTGACCC CGGAGCAGAAGAAGGAGCTGGCTGACATCGCTCACCGAATTGTAGCTCCGGGCAAGGGCATCCT GGCTGCAGACGAGTCCACTGGAAGCATTGCCAAGCGCCTGCAGTCCATTGGCACCGAGAACACC GAGGAGAACAGGCGCTTCTACCGCCAACTGCTGCTGACTGCCGATGACCGTGTGAATCCCTGCA TTGGAGGGGTGATCCTTTTCCACGAGACACTGTACCAGAAGGCAGATGATGGCCGTCCCTTCCC CCAAGTTATCAAGTCCAAGGGTGGTGTTGTGGGCATTAAGGTAGATAAGGGTGTAGTGCCCCTG GCTGGAACCAATGGCGAGACCACTACTCAAGGGCTGGACGGGCTGTCTGAGCGCTGTGCCCAGT ATAAGAAGGATGGAGCCGACTTTGCCAAGTGGCGCTGTGTGCTAAAGATTGGGGAGCATACTCC CTCGTCCCTCGCCATCATGGAAAATGCCAATGTTCTGGCCCGTTACGCCAGCATCTGCCAGCAG AATGGCATTGTACCCATTGTGGAGCCTGAAATTCTCCCTGATGGGGACCATGACTTGAAGCGCT GCCAGTATGTAACTGAGAAGGTACTGGCAGCTGTCTACAAGGCTCTGAGTGACCACCATGTCTA TCTGGAAGGCACACTGCTGAAGCCCAACATGGTCACCCCTGGCCATGCTTGCACCCAGAAATTT TCCAATGAGGAAATTGCCATGGCAACCGTCACAGCACTTCGTCGAACAGTGCCCCCTGCCGTCC CTGGGGTCACTTTCCTGTCTGGAGGGCAGAGTGAGGAAGAGGCATCCATCAACCTCAATGCTAT CAACAAGTGTCCCCTGCTGAAGCCATGGGCCTTGACTTTCTCCTATGGCCGAGCCCTGCAGGCC TCTGCTCTAAAGGCTTGGGGTGGGAAGAAGGAGAACCTGAAGGCAGCCCAGGAGGAGTACATCA AGCGAGCCCTGGCCAACAGCCTCGCTTGTCAAGGAAAGTACACTCCAAGTGGCCAGTCTGGAGC CGCAGCCAGTGAATCTCTCTTCATCTCTAACCATGCCTACTAACCAGAGCTGATCTAAGGCTGC TCCATCGACACTCCAGGCCCCTGCCTACCCACTTGCTATTGAAGAGGGGCCTTCAGGCTCTTTC CCATCACTCTTGCTGCCCTCGTGTGTGCAGTGTTGTCTGTGAATGCTAAATCTGCCATCCCTTC CAGCCCACTGCCAATAAACAGCTATTTAAGGGGGAAAAAAAAAAAAAAAAAAAAAAA
hide sequence
RefSeq Acc Id:
NP_036627 ⟸ NM_012495
- UniProtKB:
Q63038 (UniProtKB/Swiss-Prot), P05065 (UniProtKB/Swiss-Prot), A6I9E6 (UniProtKB/TrEMBL), A0A8L2R123 (UniProtKB/TrEMBL)
- Sequence:
MPHPYPALTPEQKKELADIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLL TADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGL DGLSERCAQYKKDGADFAKWRCVLKIGEHTPSSLAIMENANVLARYASICQQNGIVPIVEPEIL PDGDHDLKRCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTPGHACTQKFSNEEIAMATVTA LRRTVPPAVPGVTFLSGGQSEEEASINLNAINKCPLLKPWALTFSYGRALQASALKAWGGKKEN LKAAQEEYIKRALANSLACQGKYTPSGQSGAAASESLFISNHAY
hide sequence
RefSeq Acc Id:
NP_001170776 ⟸ NM_001177305
- UniProtKB:
Q63038 (UniProtKB/Swiss-Prot), P05065 (UniProtKB/Swiss-Prot), A6I9E6 (UniProtKB/TrEMBL), A0A8L2R123 (UniProtKB/TrEMBL)
- Sequence:
MPHPYPALTPEQKKELADIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLL TADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGL DGLSERCAQYKKDGADFAKWRCVLKIGEHTPSSLAIMENANVLARYASICQQNGIVPIVEPEIL PDGDHDLKRCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTPGHACTQKFSNEEIAMATVTA LRRTVPPAVPGVTFLSGGQSEEEASINLNAINKCPLLKPWALTFSYGRALQASALKAWGGKKEN LKAAQEEYIKRALANSLACQGKYTPSGQSGAAASESLFISNHAY
hide sequence
RefSeq Acc Id:
NP_001258465 ⟸ NM_001271536
- UniProtKB:
Q63038 (UniProtKB/Swiss-Prot), P05065 (UniProtKB/Swiss-Prot), A6I9E6 (UniProtKB/TrEMBL), A0A8L2R123 (UniProtKB/TrEMBL)
- Sequence:
MPHPYPALTPEQKKELADIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLL TADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGL DGLSERCAQYKKDGADFAKWRCVLKIGEHTPSSLAIMENANVLARYASICQQNGIVPIVEPEIL PDGDHDLKRCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTPGHACTQKFSNEEIAMATVTA LRRTVPPAVPGVTFLSGGQSEEEASINLNAINKCPLLKPWALTFSYGRALQASALKAWGGKKEN LKAAQEEYIKRALANSLACQGKYTPSGQSGAAASESLFISNHAY
hide sequence
Ensembl Acc Id:
ENSRNOP00000069507 ⟸ ENSRNOT00000087928
Ensembl Acc Id:
ENSRNOP00000068764 ⟸ ENSRNOT00000080988
Ensembl Acc Id:
ENSRNOP00000069540 ⟸ ENSRNOT00000088473
Ensembl Acc Id:
ENSRNOP00000093578 ⟸ ENSRNOT00000112001
Promoters
RGD ID: 13690413
Promoter ID: EPDNEW_R936
Type: initiation region
Name: Aldoa_2
Description: aldolase, fructose-bisphosphate A
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Alternative Promoters: null; see alsoEPDNEW_R937 EPDNEW_R938
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 198,232,297 - 198,232,357 EPDNEW
RGD ID: 13690414
Promoter ID: EPDNEW_R937
Type: multiple initiation site
Name: Aldoa_1
Description: aldolase, fructose-bisphosphate A
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Alternative Promoters: null; see alsoEPDNEW_R936 EPDNEW_R938
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 198,233,219 - 198,233,279 EPDNEW
RGD ID: 13690416
Promoter ID: EPDNEW_R938
Type: initiation region
Name: Aldoa_3
Description: aldolase, fructose-bisphosphate A
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Alternative Promoters: null; see alsoEPDNEW_R936 EPDNEW_R937
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 198,233,553 - 198,233,613 EPDNEW
Additional Information
Nomenclature History
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-12-09
Aldoa
aldolase, fructose-bisphosphate A
Aldoa
aldolase A, fructose-bisphosphate
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2008-05-15
Aldoa
aldolase A, fructose-bisphosphate
Aldoa
aldolase A
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2002-11-06
Aldoa
aldolase A
Aldolase A, fructose-bisphosphate
Name updated
625702
APPROVED
2002-06-10
Aldoa
Aldolase A, fructose-bisphosphate
Symbol and Name status set to approved
70586
APPROVED
RGD Curation Notes
Note Type
Note
Reference
gene_disease
expressed in hepatoma cells
632186
gene_product
member of the aldolase enzyme family
632186
gene_transcript
has three transcripts that differ in the 5 noncoding region
632186