Symbol:
Aldh3a1
Name:
aldehyde dehydrogenase 3 family, member A1
RGD ID:
2088
Description:
Enables 3-chloroallyl aldehyde dehydrogenase activity. Involved in several processes, including response to cAMP; response to glucocorticoid; and response to hypoxia. Located in cytosol. Human ortholog(s) of this gene implicated in arteriosclerosis. Orthologous to human ALDH3A1 (aldehyde dehydrogenase 3 family member A1); PARTICIPATES IN alkaptonuria pathway; cyclophosphamide pharmacodynamics pathway; cyclophosphamide pharmacokinetics pathway; INTERACTS WITH 1,2,3,7,8-Pentachlorodibenzodioxin; 1,2,4-trimethylbenzene; 2,2',4,4'-Tetrabromodiphenyl ether.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
Ahd-c; AHDC; Aldehyde dehydrogenase (Ahd-c); aldehyde dehydrogenase 3A1; aldehyde dehydrogenase class 3; aldehyde dehydrogenase family 3 member A1; aldehyde dehydrogenase family 3 subfamily A1; aldehyde dehydrogenase family 3, member A1; Aldehyde dehydrogenase family 3, subfamily A1; aldehyde dehydrogenase, dimeric NADP-preferring; Aldh; Aldh3; HTC-ALDH; tumor-associated aldehyde dehydrogenase tumor ALDH; tumor-associated aldehyde dehydrogenase, tumor ALDH
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ALDH3A1 (aldehyde dehydrogenase 3 family member A1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Aldh3a1 (aldehyde dehydrogenase family 3, subfamily A1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Aldh3a1 (aldehyde dehydrogenase 3 family member A1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ALDH3A1 (aldehyde dehydrogenase 3 family member A1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ALDH3A1 (aldehyde dehydrogenase 3 family member A1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Aldh3a1 (aldehyde dehydrogenase 3 family member A1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ALDH3A1 (aldehyde dehydrogenase 3 family member A1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ALDH3A1 (aldehyde dehydrogenase 3 family member A1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
CSTA (cystatin A) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
ALDH3A1 (aldehyde dehydrogenase 3 family member A1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Aldh3a1 (aldehyde dehydrogenase family 3, subfamily A1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
aldh3a2b (aldehyde dehydrogenase 3 family, member A2b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|OrthoFinder|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
Aldh-III
Alliance
DIOPT (Hieranoid|OMA|OrthoFinder|OrthoInspector|PANTHER)
Saccharomyces cerevisiae (baker's yeast):
HFD1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
alh-4
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
alh-5
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
aldh3a2
Alliance
DIOPT (OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 46,392,464 - 46,402,151 (+) NCBI GRCr8 mRatBN7.2 10 45,892,993 - 45,902,680 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 45,892,924 - 45,902,681 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 50,595,478 - 50,605,184 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 50,085,870 - 50,095,575 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 45,589,438 - 45,599,135 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 47,490,168 - 47,499,855 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 47,490,153 - 47,499,876 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 47,265,007 - 47,274,692 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 47,365,195 - 47,374,880 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 47,378,817 - 47,388,503 (+) NCBI Celera 10 45,146,398 - 45,156,083 (+) NCBI Celera Cytogenetic Map 10 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Aldh3a1 Rat 1,2,3,7,8-Pentachlorodibenzodioxin increases expression EXP 6480464 1 more ... CTD PMID:29738842 Aldh3a1 Rat 1,2,4-trimethylbenzene decreases expression EXP 6480464 pseudocumene results in decreased expression of ALDH3A1 protein CTD PMID:17337753 Aldh3a1 Rat 1,2-naphthoquinone increases expression ISO Aldh3a1 (Mus musculus) 6480464 1 and 2-naphthoquinone results in increased expression of ALDH3A1 mRNA CTD PMID:26558468 Aldh3a1 Rat 17beta-estradiol increases expression ISO ALDH3A1 (Homo sapiens) 6480464 Estradiol results in increased expression of ALDH3A1 mRNA CTD PMID:19619570 Aldh3a1 Rat 17beta-estradiol multiple interactions ISO Aldh3a1 (Mus musculus) 6480464 Estradiol promotes the reaction [Tetrachlorodibenzodioxin results in increased expression of ALDH3A1 mRNA] CTD PMID:18691609 Aldh3a1 Rat 17beta-estradiol multiple interactions ISO ALDH3A1 (Homo sapiens) 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in increased expression of ALDH3A1 mRNA and [Estradiol co-treated with TGFB1 protein] results in decreased expression of ALDH3A1 mRNA CTD PMID:19619570 and PMID:30165855 Aldh3a1 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression EXP 6480464 2 more ... CTD PMID:20566336 Aldh3a1 Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression EXP 6480464 2 more ... CTD PMID:29738842 Aldh3a1 Rat 2,3,3',4,4',5-Hexachlorobiphenyl increases expression EXP 6480464 2 more ... CTD PMID:29738842 Aldh3a1 Rat 2,3,4,7,8-Pentachlorodibenzofuran increases expression EXP 6480464 2 more ... CTD PMID:21724226 more ... Aldh3a1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO ALDH3A1 (Homo sapiens) 6480464 [Endosulfan co-treated with Tetrachlorodibenzodioxin] results in increased expression of ALDH3A1 mRNA more ... CTD PMID:19619570 more ... Aldh3a1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Aldh3a1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ALDH3A1 mRNA CTD PMID:21570461 and PMID:26377647 Aldh3a1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO ALDH3A1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of ALDH3A1 mRNA CTD PMID:12377990 more ... Aldh3a1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Aldh3a1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of ALDH3A1 mRNA CTD PMID:10677587 more ... Aldh3a1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases activity ISO Aldh3a1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased activity of ALDH3A1 protein CTD PMID:7828219 and PMID:7955076 Aldh3a1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 Cycloheximide promotes the reaction [Tetrachlorodibenzodioxin results in increased expression of ALDH3A1 mRNA] more ... CTD PMID:1416978 and PMID:1953764 Aldh3a1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of ALDH3A1 mRNA CTD PMID:22298810 Aldh3a1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO ALDH3A1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of ALDH3A1 mRNA CTD PMID:22298810 Aldh3a1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of ALDH3A1 mRNA and Tetrachlorodibenzodioxin results in increased expression of ALDH3A1 protein CTD PMID:1416978 more ... Aldh3a1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Aldh3a1 (Mus musculus) 6480464 AHR protein promotes the reaction [Tetrachlorodibenzodioxin results in increased expression of ALDH3A1 mRNA] more ... CTD PMID:1416978 more ... Aldh3a1 Rat 2,3,7,8-Tetrachlorodibenzofuran increases expression EXP 6480464 2 more ... CTD PMID:21724226 and PMID:24046277 Aldh3a1 Rat 2,4-diaminotoluene increases expression ISO Aldh3a1 (Mus musculus) 6480464 2 and 4-diaminotoluene results in increased expression of ALDH3A1 mRNA CTD PMID:20713471 Aldh3a1 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of ALDH3A1 mRNA CTD PMID:21346803 Aldh3a1 Rat 2-acetamidofluorene multiple interactions ISO Aldh3a1 (Mus musculus) 6480464 TRP53 protein modified form affects the reaction [2-Acetylaminofluorene results in increased expression of ALDH3A1 mRNA] CTD PMID:17317680 Aldh3a1 Rat 2-hexenal increases metabolic processing ISO Aldh3a1 (Mus musculus) 6480464 ALDH3A1 protein results in increased metabolism of 2-hexenal CTD PMID:21256123 Aldh3a1 Rat 2-hexenal affects metabolic processing ISO ALDH3A1 (Homo sapiens) 6480464 ALDH3A1 protein affects the metabolism of 2-hexenal CTD PMID:11306050 Aldh3a1 Rat 2-hexenal decreases response to substance ISO ALDH3A1 (Homo sapiens) 6480464 ALDH3A1 protein results in decreased susceptibility to 2-hexenal CTD PMID:11306050 Aldh3a1 Rat 2-hydroxypropanoic acid increases expression ISO ALDH3A1 (Homo sapiens) 6480464 Lactic Acid results in increased expression of ALDH3A1 mRNA CTD PMID:30851411 Aldh3a1 Rat 3,3',4,4',5-pentachlorobiphenyl increases expression ISO ALDH3A1 (Homo sapiens) 6480464 3 more ... CTD PMID:19692669 Aldh3a1 Rat 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3 more ... CTD PMID:19692669 more ... Aldh3a1 Rat 3,3',4,4',5-pentachlorobiphenyl increases expression ISO Aldh3a1 (Mus musculus) 6480464 3 more ... CTD PMID:23994337 Aldh3a1 Rat 3-methylcholanthrene increases expression ISO Aldh3a1 (Mus musculus) 6480464 Methylcholanthrene results in increased expression of ALDH3A1 mRNA CTD PMID:20713471 Aldh3a1 Rat 3-methylcholanthrene increases expression ISO ALDH3A1 (Homo sapiens) 6480464 Methylcholanthrene results in increased expression of ALDH3A1 mRNA CTD PMID:28601433 Aldh3a1 Rat 3-methylcholanthrene increases expression EXP 6480464 Methylcholanthrene results in increased expression of ALDH3A1 mRNA CTD PMID:1416978 Aldh3a1 Rat 4,4'-sulfonyldiphenol decreases expression ISO ALDH3A1 (Homo sapiens) 6480464 bisphenol S results in decreased expression of ALDH3A1 mRNA CTD PMID:38568856 Aldh3a1 Rat 4,4'-sulfonyldiphenol affects methylation ISO Aldh3a1 (Mus musculus) 6480464 bisphenol S affects the methylation of ALDH3A1 gene CTD PMID:31683443 Aldh3a1 Rat 4-(diethylamino)benzaldehyde increases oxidation ISO ALDH3A1 (Homo sapiens) 6480464 ALDH3A1 protein results in increased oxidation of 4-(diethylamino)benzaldehyde CTD PMID:25512087 Aldh3a1 Rat 4-hydroperoxycyclophosphamide decreases response to substance ISO ALDH3A1 (Homo sapiens) 6480464 ALDH3A1 protein results in decreased susceptibility to perfosfamide CTD PMID:16614850 Aldh3a1 Rat 4-hydroxynon-2-enal decreases response to substance ISO ALDH3A1 (Homo sapiens) 6480464 ALDH3A1 protein results in decreased susceptibility to 4-hydroxy-2-nonenal CTD PMID:11306050 Aldh3a1 Rat 4-hydroxynon-2-enal increases oxidation ISO ALDH3A1 (Homo sapiens) 6480464 ALDH3A1 protein results in increased oxidation of 4-hydroxy-2-nonenal CTD PMID:22339434 Aldh3a1 Rat 4-hydroxynon-2-enal multiple interactions ISO Aldh3a1 (Mus musculus) 6480464 [APC protein mutant form results in increased expression of ALDH3A1 mRNA] which affects the metabolism of 4-hydroxy-2-nonenal CTD PMID:21967605 Aldh3a1 Rat 4-hydroxynon-2-enal increases metabolic processing ISO Aldh3a1 (Mus musculus) 6480464 ALDH3A1 protein results in increased metabolism of 4-hydroxy-2-nonenal CTD PMID:21256123 Aldh3a1 Rat 4-hydroxynon-2-enal affects response to substance ISO ALDH3A1 (Homo sapiens) 6480464 ALDH3A1 protein affects the susceptibility to 4-hydroxy-2-nonenal CTD PMID:15905174 Aldh3a1 Rat 4-hydroxynon-2-enal affects metabolic processing EXP 6480464 ALDH3A1 protein affects the metabolism of 4-hydroxy-2-nonenal CTD PMID:11018474 Aldh3a1 Rat 4-nitrophenyl acetate increases hydrolysis ISO ALDH3A1 (Homo sapiens) 6480464 ALDH3A1 protein results in increased hydrolysis of 4-nitrophenyl acetate CTD PMID:21349255 Aldh3a1 Rat 5-azacytidine multiple interactions ISO Aldh3a1 (Mus musculus) 6480464 [Azacitidine co-treated with Butyrates] inhibits the reaction [Chromium inhibits the reaction [Benzo(a)pyrene results in increased expression of ALDH3A1 mRNA]] and Azacitidine inhibits the reaction [Chromium inhibits the reaction [Benzo(a)pyrene results in increased expression of ALDH3A1 mRNA]] CTD PMID:17682057 Aldh3a1 Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole increases expression ISO ALDH3A1 (Homo sapiens) 6480464 Omeprazole results in increased expression of ALDH3A1 mRNA CTD PMID:12040753 Aldh3a1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of ALDH3A1 mRNA CTD PMID:24780913 Aldh3a1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of ALDH3A1 mRNA CTD PMID:30047161 Aldh3a1 Rat 7,12-dimethyltetraphene increases expression ISO Aldh3a1 (Mus musculus) 6480464 9 more ... CTD PMID:32553695 Aldh3a1 Rat 7,12-dimethyltetraphene multiple interactions ISO Aldh3a1 (Mus musculus) 6480464 [9 more ... CTD PMID:32553695 Aldh3a1 Rat acetaldehyde increases oxidation ISO ALDH3A1 (Homo sapiens) 6480464 ALDH3A1 protein results in increased oxidation of Acetaldehyde CTD PMID:18940187 Aldh3a1 Rat acetaldehyde increases metabolic processing ISO Aldh3a1 (Mus musculus) 6480464 ALDH3A1 protein results in increased metabolism of Acetaldehyde CTD PMID:21256123 Aldh3a1 Rat acrolein increases metabolic processing ISO Aldh3a1 (Mus musculus) 6480464 ALDH3A1 protein results in increased metabolism of Acrolein CTD PMID:21256123 Aldh3a1 Rat actinomycin D multiple interactions ISO ALDH3A1 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of ALDH3A1 protein CTD PMID:38460933 Aldh3a1 Rat aflatoxin B1 affects expression ISO ALDH3A1 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of ALDH3A1 protein CTD PMID:20106945 Aldh3a1 Rat aflatoxin B1 increases expression ISO ALDH3A1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of ALDH3A1 mRNA CTD PMID:27153756 and PMID:32234424 Aldh3a1 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of ALDH3A1 mRNA CTD PMID:23630614 and PMID:25378103 Aldh3a1 Rat Aldophosphamide multiple interactions ISO ALDH3A1 (Homo sapiens) 6480464 [ALDH3A1 protein co-treated with NAD] results in increased oxidation of aldophosphamide and [ALDH3A1 protein co-treated with NADP] results in increased oxidation of aldophosphamide CTD PMID:10856427 Aldh3a1 Rat all-trans-retinal increases activity EXP 6480464 Retinaldehyde results in increased activity of ALDH3A1 protein CTD PMID:17126819 Aldh3a1 Rat all-trans-retinoic acid decreases expression ISO ALDH3A1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of ALDH3A1 protein CTD PMID:16614850 Aldh3a1 Rat all-trans-retinoic acid multiple interactions ISO ALDH3A1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of and results in decreased activity of ALDH3A1 protein CTD PMID:15470086 Aldh3a1 Rat all-trans-retinoic acid decreases activity ISO ALDH3A1 (Homo sapiens) 6480464 Tretinoin results in decreased activity of ALDH3A1 protein CTD PMID:16614850 Aldh3a1 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of ALDH3A1 mRNA CTD PMID:35163327 Aldh3a1 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of ALDH3A1 mRNA CTD PMID:30047161 Aldh3a1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of ALDH3A1 mRNA CTD PMID:16483693 Aldh3a1 Rat Aroclor 1254 increases expression EXP 6480464 Chlorodiphenyl (54% Chlorine) results in increased expression of ALDH3A1 mRNA CTD PMID:18178546 Aldh3a1 Rat arsane decreases expression ISO ALDH3A1 (Homo sapiens) 6480464 Arsenic results in decreased expression of ALDH3A1 protein CTD PMID:19818359 Aldh3a1 Rat arsenic atom decreases expression ISO ALDH3A1 (Homo sapiens) 6480464 Arsenic results in decreased expression of ALDH3A1 protein CTD PMID:19818359 Aldh3a1 Rat arsenite(3-) multiple interactions ISO Aldh3a1 (Mus musculus) 6480464 [arsenite co-treated with Benzo(a)pyrene] results in increased expression of ALDH3A1 mRNA CTD PMID:15894712 Aldh3a1 Rat arsenite(3-) decreases methylation ISO ALDH3A1 (Homo sapiens) 6480464 arsenite results in decreased methylation of ALDH3A1 promoter CTD PMID:23974009 Aldh3a1 Rat arsenite(3-) increases expression ISO Aldh3a1 (Mus musculus) 6480464 arsenite results in increased expression of ALDH3A1 mRNA CTD PMID:15894712 Aldh3a1 Rat arsenous acid multiple interactions ISO ALDH3A1 (Homo sapiens) 6480464 ALDH3A1 protein inhibits the reaction [PML mutant form results in increased susceptibility to Arsenic Trioxide] CTD PMID:26118777 Aldh3a1 Rat arsenous acid decreases expression ISO Aldh3a1 (Mus musculus) 6480464 Arsenic Trioxide results in decreased expression of ALDH3A1 mRNA CTD PMID:35676786 Aldh3a1 Rat arsenous acid decreases response to substance ISO ALDH3A1 (Homo sapiens) 6480464 ALDH3A1 protein results in decreased susceptibility to Arsenic Trioxide CTD PMID:20707922 Aldh3a1 Rat benzaldehyde multiple interactions ISO ALDH3A1 (Homo sapiens) 6480464 [ALDH3A1 protein co-treated with NAD] results in increased oxidation of benzaldehyde more ... CTD PMID:10856427 and PMID:23220590 Aldh3a1 Rat benzaldehyde increases oxidation ISO ALDH3A1 (Homo sapiens) 6480464 ALDH3A1 protein results in increased oxidation of benzaldehyde CTD PMID:21349255 more ... Aldh3a1 Rat benzaldehyde increases metabolic processing ISO Aldh3a1 (Mus musculus) 6480464 ALDH3A1 protein results in increased metabolism of benzaldehyde CTD PMID:21256123 Aldh3a1 Rat benzene increases expression ISO Aldh3a1 (Mus musculus) 6480464 Benzene results in increased expression of ALDH3A1 mRNA CTD PMID:34624356 Aldh3a1 Rat Benzo[a]fluorene multiple interactions ISO ALDH3A1 (Homo sapiens) 6480464 [retene co-treated with benzo(a)fluorene co-treated with benzo(b)fluorene co-treated with benzo(c)fluorene co-treated with triphenylene co-treated with benzo(e)pyrene co-treated with 1 and 12-benzoperylene] results in increased expression of ALDH3A1 mRNA CTD PMID:38673911 Aldh3a1 Rat benzo[a]pyrene increases expression ISO ALDH3A1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of ALDH3A1 mRNA CTD PMID:14645679 more ... Aldh3a1 Rat benzo[a]pyrene increases methylation ISO ALDH3A1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of ALDH3A1 5' UTR more ... CTD PMID:27901495 Aldh3a1 Rat benzo[a]pyrene increases expression ISO Aldh3a1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of ALDH3A1 mRNA CTD PMID:14625279 more ... Aldh3a1 Rat benzo[a]pyrene multiple interactions ISO ALDH3A1 (Homo sapiens) 6480464 cobaltous chloride inhibits the reaction [Benzo(a)pyrene results in increased expression of ALDH3A1 mRNA] more ... CTD PMID:14645679 Aldh3a1 Rat benzo[a]pyrene multiple interactions ISO Aldh3a1 (Mus musculus) 6480464 [arsenite co-treated with Benzo(a)pyrene] results in increased expression of ALDH3A1 mRNA more ... CTD PMID:14625279 more ... Aldh3a1 Rat Benzo[b]fluorene increases expression ISO ALDH3A1 (Homo sapiens) 6480464 benzo(b)fluorene results in increased expression of ALDH3A1 mRNA CTD PMID:38673911 Aldh3a1 Rat Benzo[b]fluorene multiple interactions ISO ALDH3A1 (Homo sapiens) 6480464 [retene co-treated with benzo(a)fluorene co-treated with benzo(b)fluorene co-treated with benzo(c)fluorene co-treated with triphenylene co-treated with benzo(e)pyrene co-treated with 1 and 12-benzoperylene] results in increased expression of ALDH3A1 mRNA CTD PMID:38673911 Aldh3a1 Rat Benzo[c]fluorene multiple interactions ISO ALDH3A1 (Homo sapiens) 6480464 [retene co-treated with benzo(a)fluorene co-treated with benzo(b)fluorene co-treated with benzo(c)fluorene co-treated with triphenylene co-treated with benzo(e)pyrene co-treated with 1 and 12-benzoperylene] results in increased expression of ALDH3A1 mRNA CTD PMID:38673911 Aldh3a1 Rat benzo[e]pyrene increases expression ISO ALDH3A1 (Homo sapiens) 6480464 benzo(e)pyrene results in increased expression of ALDH3A1 mRNA CTD PMID:38673911 Aldh3a1 Rat benzo[e]pyrene multiple interactions ISO ALDH3A1 (Homo sapiens) 6480464 [retene co-treated with benzo(a)fluorene co-treated with benzo(b)fluorene co-treated with benzo(c)fluorene co-treated with triphenylene co-treated with benzo(e)pyrene co-treated with 1 and 12-benzoperylene] results in increased expression of ALDH3A1 mRNA CTD PMID:38673911 Aldh3a1 Rat Benzo[ghi]perylene multiple interactions ISO ALDH3A1 (Homo sapiens) 6480464 [retene co-treated with benzo(a)fluorene co-treated with benzo(b)fluorene co-treated with benzo(c)fluorene co-treated with triphenylene co-treated with benzo(e)pyrene co-treated with 1 and 12-benzoperylene] results in increased expression of ALDH3A1 mRNA CTD PMID:38673911 Aldh3a1 Rat Benzo[ghi]perylene increases expression ISO ALDH3A1 (Homo sapiens) 6480464 1 and 12-benzoperylene results in increased expression of ALDH3A1 mRNA CTD PMID:38673911 Aldh3a1 Rat benzyl isothiocyanate increases response to substance ISO Aldh3a1 (Mus musculus) 6480464 ALDH3A1 protein results in increased susceptibility to benzyl isothiocyanate CTD PMID:28821405 Aldh3a1 Rat benzyl isothiocyanate multiple interactions ISO Aldh3a1 (Mus musculus) 6480464 NFE2L2 protein promotes the reaction [benzyl isothiocyanate results in increased expression of ALDH3A1 mRNA] CTD PMID:28821405 Aldh3a1 Rat benzyl isothiocyanate increases expression ISO Aldh3a1 (Mus musculus) 6480464 benzyl isothiocyanate results in increased expression of ALDH3A1 mRNA and benzyl isothiocyanate results in increased expression of ALDH3A1 protein CTD PMID:28821405 Aldh3a1 Rat beta-lapachone increases expression ISO ALDH3A1 (Homo sapiens) 6480464 beta-lapachone results in increased expression of ALDH3A1 mRNA CTD PMID:38218311 Aldh3a1 Rat beta-naphthoflavone increases expression EXP 6480464 beta-Naphthoflavone results in increased expression of ALDH3A1 mRNA CTD PMID:1416978 Aldh3a1 Rat beta-naphthoflavone increases expression ISO ALDH3A1 (Homo sapiens) 6480464 beta-Naphthoflavone results in increased expression of ALDH3A1 mRNA CTD PMID:25218365 more ... Aldh3a1 Rat beta-naphthoflavone increases expression ISO Aldh3a1 (Mus musculus) 6480464 beta-Naphthoflavone results in increased expression of ALDH3A1 mRNA CTD PMID:17998271 and PMID:23994337 Aldh3a1 Rat beta-naphthoflavone multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of ALDH3A1 mRNA CTD PMID:18164116 Aldh3a1 Rat bis(2-chloroethyl) sulfide increases expression ISO ALDH3A1 (Homo sapiens) 6480464 Mustard Gas results in increased expression of ALDH3A1 mRNA CTD PMID:25102026 Aldh3a1 Rat bisphenol A affects expression ISO ALDH3A1 (Homo sapiens) 6480464 bisphenol A affects the expression of ALDH3A1 mRNA CTD PMID:20170705 Aldh3a1 Rat bisphenol A decreases methylation ISO ALDH3A1 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of ALDH3A1 gene CTD PMID:31601247 Aldh3a1 Rat bisphenol A decreases expression ISO ALDH3A1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of ALDH3A1 mRNA CTD PMID:38568856 Aldh3a1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ALDH3A1 mRNA CTD PMID:25181051 Aldh3a1 Rat butan-1-ol multiple interactions ISO ALDH3A1 (Homo sapiens) 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of ALDH3A1 mRNA CTD PMID:29432896 Aldh3a1 Rat butylated hydroxyanisole increases expression ISO Aldh3a1 (Mus musculus) 6480464 Butylated Hydroxyanisole results in increased expression of ALDH3A1 mRNA CTD PMID:17998271 Aldh3a1 Rat cadmium dichloride increases expression ISO ALDH3A1 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of ALDH3A1 mRNA CTD PMID:38568856 Aldh3a1 Rat cadmium dichloride decreases expression ISO ALDH3A1 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of ALDH3A1 mRNA CTD PMID:38568856 Aldh3a1 Rat calciol increases expression ISO Aldh3a1 (Mus musculus) 6480464 Cholecalciferol results in increased expression of ALDH3A1 mRNA CTD PMID:17170073 Aldh3a1 Rat capsaicin decreases expression EXP 6480464 Capsaicin results in decreased expression of ALDH3A1 mRNA CTD PMID:16278290 Aldh3a1 Rat carbon nanotube decreases expression ISO Aldh3a1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Aldh3a1 Rat carboplatin affects response to substance ISO ALDH3A1 (Homo sapiens) 6480464 ALDH3A1 protein affects the susceptibility to Carboplatin CTD PMID:18854779 Aldh3a1 Rat cefaloridine increases expression EXP 6480464 Cephaloridine results in increased expression of ALDH3A1 mRNA CTD PMID:18500788 Aldh3a1 Rat chlordecone decreases expression ISO Aldh3a1 (Mus musculus) 6480464 Chlordecone results in decreased expression of ALDH3A1 mRNA CTD PMID:29980752 Aldh3a1 Rat chloroethene increases activity EXP 6480464 Vinyl Chloride results in increased activity of ALDH3A1 protein CTD PMID:15211785 Aldh3a1 Rat chloropicrin increases expression ISO ALDH3A1 (Homo sapiens) 6480464 chloropicrin results in increased expression of ALDH3A1 mRNA CTD PMID:26352163 and PMID:28476498 Aldh3a1 Rat chloroprene increases expression ISO Aldh3a1 (Mus musculus) 6480464 Chloroprene results in increased expression of ALDH3A1 mRNA CTD PMID:23125180 Aldh3a1 Rat chlorpyrifos increases methylation EXP 6480464 Chlorpyrifos results in increased methylation of ALDH3A1 gene CTD PMID:32905263 Aldh3a1 Rat chromium atom multiple interactions ISO Aldh3a1 (Mus musculus) 6480464 [Azacitidine co-treated with Butyrates] inhibits the reaction [Chromium inhibits the reaction [Benzo(a)pyrene results in increased expression of ALDH3A1 mRNA]] more ... CTD PMID:17682057 Aldh3a1 Rat cimetidine multiple interactions ISO ALDH3A1 (Homo sapiens) 6480464 Cimetidine inhibits the reaction [ALDH3A1 protein results in increased oxidation of benzaldehyde] CTD PMID:23220590 Aldh3a1 Rat cisplatin multiple interactions ISO ALDH3A1 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of ALDH3A1 mRNA CTD PMID:27392435 Aldh3a1 Rat cisplatin increases expression ISO ALDH3A1 (Homo sapiens) 6480464 Cisplatin results in increased expression of ALDH3A1 mRNA CTD PMID:27392435 Aldh3a1 Rat clofibrate multiple interactions EXP 6480464 PPARG protein promotes the reaction [Clofibrate results in decreased expression of ALDH3A1 mRNA] CTD PMID:12604186 Aldh3a1 Rat clofibrate decreases expression EXP 6480464 Clofibrate results in decreased expression of ALDH3A1 mRNA CTD PMID:12604186 Aldh3a1 Rat cobalt dichloride multiple interactions ISO ALDH3A1 (Homo sapiens) 6480464 cobaltous chloride inhibits the reaction [Benzo(a)pyrene results in increased expression of ALDH3A1 mRNA] CTD PMID:14645679 Aldh3a1 Rat cobalt dichloride increases expression EXP 6480464 cobaltous chloride results in increased expression of ALDH3A1 mRNA CTD PMID:24386269 Aldh3a1 Rat cobalt dichloride decreases expression ISO ALDH3A1 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of ALDH3A1 mRNA CTD PMID:19376846 Aldh3a1 Rat cycloheximide multiple interactions EXP 6480464 Cycloheximide promotes the reaction [Tetrachlorodibenzodioxin results in increased expression of ALDH3A1 mRNA] CTD PMID:1953764 Aldh3a1 Rat cyclophosphamide affects response to substance ISO ALDH3A1 (Homo sapiens) 6480464 ALDH3A1 protein affects the susceptibility to Cyclophosphamide CTD PMID:18854779 Aldh3a1 Rat cyclosporin A decreases expression ISO ALDH3A1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of ALDH3A1 mRNA CTD PMID:20106945 Aldh3a1 Rat DDE decreases expression ISO ALDH3A1 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of ALDH3A1 mRNA CTD PMID:38568856 Aldh3a1 Rat desferrioxamine B decreases expression ISO ALDH3A1 (Homo sapiens) 6480464 Deferoxamine results in decreased expression of ALDH3A1 mRNA CTD PMID:14645679 Aldh3a1 Rat desferrioxamine B multiple interactions ISO ALDH3A1 (Homo sapiens) 6480464 Deferoxamine inhibits the reaction [Benzo(a)pyrene results in increased expression of ALDH3A1 mRNA] CTD PMID:14645679 Aldh3a1 Rat dexamethasone decreases expression ISO Aldh3a1 (Mus musculus) 6480464 Dexamethasone results in decreased expression of ALDH3A1 mRNA CTD PMID:22733784 Aldh3a1 Rat diarsenic trioxide decreases response to substance ISO ALDH3A1 (Homo sapiens) 6480464 ALDH3A1 protein results in decreased susceptibility to Arsenic Trioxide CTD PMID:20707922 Aldh3a1 Rat diarsenic trioxide decreases expression ISO Aldh3a1 (Mus musculus) 6480464 Arsenic Trioxide results in decreased expression of ALDH3A1 mRNA CTD PMID:35676786 Aldh3a1 Rat diarsenic trioxide multiple interactions ISO ALDH3A1 (Homo sapiens) 6480464 ALDH3A1 protein inhibits the reaction [PML mutant form results in increased susceptibility to Arsenic Trioxide] CTD PMID:26118777 Aldh3a1 Rat dibenzo[a,l]pyrene decreases expression ISO ALDH3A1 (Homo sapiens) 6480464 dibenzo(a and l)pyrene results in decreased expression of ALDH3A1 mRNA CTD PMID:31255691 and PMID:32890658 Aldh3a1 Rat dibenzofuran increases expression EXP 6480464 dibenzofuran analog results in increased expression of ALDH3A1 mRNA CTD PMID:20566336 Aldh3a1 Rat diethyldithiocarbamic acid increases chemical synthesis ISO ALDH3A1 (Homo sapiens) 6480464 ALDH3A1 protein results in increased chemical synthesis of Ditiocarb CTD PMID:18591790 Aldh3a1 Rat dioxygen decreases expression ISO ALDH3A1 (Homo sapiens) 6480464 Oxygen deficiency results in decreased expression of ALDH3A1 mRNA CTD PMID:14645679 Aldh3a1 Rat dioxygen multiple interactions EXP 6480464 [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in decreased expression of ALDH3A1 mRNA CTD PMID:33729688 Aldh3a1 Rat dioxygen multiple interactions ISO ALDH3A1 (Homo sapiens) 6480464 Oxygen deficiency inhibits the reaction [Benzo(a)pyrene results in increased expression of ALDH3A1 mRNA] CTD PMID:14645679 Aldh3a1 Rat disulfiram increases metabolic processing ISO ALDH3A1 (Homo sapiens) 6480464 ALDH3A1 protein results in increased metabolism of Disulfiram CTD PMID:18591790 Aldh3a1 Rat diuron decreases expression EXP 6480464 Diuron metabolite results in decreased expression of ALDH3A1 mRNA and Diuron results in decreased expression of ALDH3A1 mRNA CTD PMID:24172598 and PMID:25152437 Aldh3a1 Rat diuron increases expression EXP 6480464 Diuron results in increased expression of ALDH3A1 mRNA CTD PMID:21551480 Aldh3a1 Rat endosulfan multiple interactions ISO ALDH3A1 (Homo sapiens) 6480464 [Endosulfan co-treated with Tetrachlorodibenzodioxin] results in increased expression of ALDH3A1 mRNA CTD PMID:26159488 Aldh3a1 Rat ethanol multiple interactions ISO Aldh3a1 (Mus musculus) 6480464 [Ethanol co-treated with Zinc Sulfate] results in increased activity of ALDH3A1 protein CTD PMID:15920153 Aldh3a1 Rat ethanol multiple interactions ISO ALDH3A1 (Homo sapiens) 6480464 [[Gasoline co-treated with Ethanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of ALDH3A1 mRNA CTD PMID:29432896 Aldh3a1 Rat ethanol increases activity ISO Aldh3a1 (Mus musculus) 6480464 Ethanol results in increased activity of ALDH3A1 protein CTD PMID:15920153 Aldh3a1 Rat etoposide affects response to substance ISO ALDH3A1 (Homo sapiens) 6480464 ALDH3A1 protein affects the susceptibility to Etoposide CTD PMID:15905174 Aldh3a1 Rat fluoranthene increases expression ISO Aldh3a1 (Mus musculus) 6480464 fluoranthene results in increased expression of ALDH3A1 mRNA CTD PMID:28329830 Aldh3a1 Rat fluoranthene multiple interactions ISO Aldh3a1 (Mus musculus) 6480464 [1-methylanthracene co-treated with fluoranthene] results in increased expression of ALDH3A1 mRNA CTD PMID:28329830 Aldh3a1 Rat folic acid decreases expression ISO Aldh3a1 (Mus musculus) 6480464 Folic Acid results in decreased expression of ALDH3A1 mRNA CTD PMID:25629700 Aldh3a1 Rat formaldehyde decreases expression ISO ALDH3A1 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of ALDH3A1 mRNA CTD PMID:27664576 Aldh3a1 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of ALDH3A1 mRNA CTD PMID:33387578 Aldh3a1 Rat glycidol decreases expression EXP 6480464 glycidol results in decreased expression of ALDH3A1 mRNA CTD PMID:24915197 Aldh3a1 Rat glycidyl methacrylate decreases expression ISO ALDH3A1 (Homo sapiens) 6480464 glycidyl methacrylate results in decreased expression of ALDH3A1 protein CTD PMID:36641056 Aldh3a1 Rat hexanal affects metabolic processing ISO ALDH3A1 (Homo sapiens) 6480464 ALDH3A1 protein affects the metabolism of n-hexanal CTD PMID:11306050 Aldh3a1 Rat hexanal decreases response to substance ISO ALDH3A1 (Homo sapiens) 6480464 ALDH3A1 protein results in decreased susceptibility to n-hexanal CTD PMID:11306050 Aldh3a1 Rat hydrogen peroxide decreases expression ISO ALDH3A1 (Homo sapiens) 6480464 Hydrogen Peroxide results in decreased expression of ALDH3A1 protein CTD PMID:32980322 Aldh3a1 Rat hydrogen peroxide multiple interactions ISO ALDH3A1 (Homo sapiens) 6480464 TGFB1 protein inhibits the reaction [Hydrogen Peroxide results in decreased expression of ALDH3A1 protein] CTD PMID:32980322 Aldh3a1 Rat hydroquinone increases expression ISO ALDH3A1 (Homo sapiens) 6480464 hydroquinone results in increased expression of ALDH3A1 mRNA CTD PMID:31256213 Aldh3a1 Rat Indeno[1,2,3-cd]pyrene increases expression ISO ALDH3A1 (Homo sapiens) 6480464 indeno(1 more ... CTD PMID:32251684 Aldh3a1 Rat indole-3-methanol affects expression EXP 6480464 indole-3-carbinol affects the expression of ALDH3A1 mRNA CTD PMID:21396975 Aldh3a1 Rat indole-3-methanol multiple interactions EXP 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine] results in increased expression of ALDH3A1 mRNA CTD PMID:22129741 Aldh3a1 Rat leflunomide increases expression ISO ALDH3A1 (Homo sapiens) 6480464 leflunomide results in increased expression of ALDH3A1 mRNA CTD PMID:28988120 Aldh3a1 Rat lipopolysaccharide multiple interactions ISO ALDH3A1 (Homo sapiens) 6480464 [NAT10 protein affects the susceptibility to Lipopolysaccharides] which affects the expression of ALDH3A1 mRNA CTD PMID:35877022 Aldh3a1 Rat malonaldehyde increases metabolic processing ISO Aldh3a1 (Mus musculus) 6480464 ALDH3A1 protein results in increased metabolism of Malondialdehyde CTD PMID:21256123 Aldh3a1 Rat MeIQx increases expression ISO ALDH3A1 (Homo sapiens) 6480464 2-amino-3 more ... CTD PMID:20816883 Aldh3a1 Rat mercury dichloride increases expression ISO ALDH3A1 (Homo sapiens) 6480464 Mercuric Chloride results in increased expression of ALDH3A1 mRNA CTD PMID:38568856 Aldh3a1 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of ALDH3A1 mRNA CTD PMID:30047161 Aldh3a1 Rat methyl methacrylate increases expression ISO Aldh3a1 (Mus musculus) 6480464 Methylmethacrylate results in increased expression of ALDH3A1 mRNA CTD PMID:16916219 Aldh3a1 Rat methylparaben decreases expression ISO ALDH3A1 (Homo sapiens) 6480464 methylparaben results in decreased expression of ALDH3A1 mRNA CTD PMID:38568856 Aldh3a1 Rat mitomycin C affects response to substance ISO ALDH3A1 (Homo sapiens) 6480464 ALDH3A1 protein affects the susceptibility to Mitomycin CTD PMID:15905174 Aldh3a1 Rat monosodium L-glutamate decreases expression ISO Aldh3a1 (Mus musculus) 6480464 Sodium Glutamate results in decreased expression of ALDH3A1 mRNA CTD PMID:20111022 Aldh3a1 Rat N,N-diethyl-m-toluamide increases expression ISO ALDH3A1 (Homo sapiens) 6480464 DEET results in increased expression of ALDH3A1 mRNA CTD PMID:27091632 Aldh3a1 Rat N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of ALDH3A1 mRNA CTD PMID:19638242 Aldh3a1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of ALDH3A1 mRNA more ... CTD PMID:18164116 more ... Aldh3a1 Rat NAD zwitterion multiple interactions ISO ALDH3A1 (Homo sapiens) 6480464 [ALDH3A1 protein co-treated with NAD] results in increased oxidation of aldophosphamide and [ALDH3A1 protein co-treated with NAD] results in increased oxidation of benzaldehyde CTD PMID:10856427 Aldh3a1 Rat NAD zwitterion increases activity ISO Aldh3a1 (Mus musculus) 6480464 NAD results in increased activity of ALDH3A1 protein CTD PMID:21256123 Aldh3a1 Rat NAD(+) multiple interactions ISO ALDH3A1 (Homo sapiens) 6480464 [ALDH3A1 protein co-treated with NAD] results in increased oxidation of aldophosphamide and [ALDH3A1 protein co-treated with NAD] results in increased oxidation of benzaldehyde CTD PMID:10856427 Aldh3a1 Rat NAD(+) increases activity ISO Aldh3a1 (Mus musculus) 6480464 NAD results in increased activity of ALDH3A1 protein CTD PMID:21256123 Aldh3a1 Rat NADP zwitterion multiple interactions ISO ALDH3A1 (Homo sapiens) 6480464 [ALDH3A1 protein co-treated with NADP] results in increased oxidation of aldophosphamide and [ALDH3A1 protein co-treated with NADP] results in increased oxidation of benzaldehyde CTD PMID:10856427 Aldh3a1 Rat NADP zwitterion increases activity ISO Aldh3a1 (Mus musculus) 6480464 NADP results in increased activity of ALDH3A1 protein CTD PMID:21256123 Aldh3a1 Rat NADP(+) multiple interactions ISO ALDH3A1 (Homo sapiens) 6480464 [ALDH3A1 protein co-treated with NADP] results in increased oxidation of aldophosphamide and [ALDH3A1 protein co-treated with NADP] results in increased oxidation of benzaldehyde CTD PMID:10856427 Aldh3a1 Rat NADP(+) increases activity ISO Aldh3a1 (Mus musculus) 6480464 NADP results in increased activity of ALDH3A1 protein CTD PMID:21256123 Aldh3a1 Rat nickel atom increases expression ISO ALDH3A1 (Homo sapiens) 6480464 Nickel results in increased expression of ALDH3A1 mRNA CTD PMID:25583101 Aldh3a1 Rat nickel dichloride multiple interactions ISO ALDH3A1 (Homo sapiens) 6480464 nickel chloride inhibits the reaction [Benzo(a)pyrene results in increased expression of ALDH3A1 mRNA] CTD PMID:14645679 Aldh3a1 Rat nickel dichloride affects expression EXP 6480464 nickel chloride affects the expression of ALDH3A1 mRNA CTD PMID:22110744 Aldh3a1 Rat non-2-enal affects metabolic processing ISO ALDH3A1 (Homo sapiens) 6480464 ALDH3A1 protein affects the metabolism of 2-nonenal CTD PMID:11306050 Aldh3a1 Rat non-2-enal decreases response to substance ISO ALDH3A1 (Homo sapiens) 6480464 ALDH3A1 protein results in decreased susceptibility to 2-nonenal CTD PMID:11306050 Aldh3a1 Rat Nutlin-3 increases expression ISO ALDH3A1 (Homo sapiens) 6480464 nutlin 3 results in increased expression of ALDH3A1 mRNA CTD PMID:38460933 Aldh3a1 Rat Nutlin-3 multiple interactions ISO ALDH3A1 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of ALDH3A1 protein CTD PMID:38460933 Aldh3a1 Rat O-methyleugenol increases expression ISO ALDH3A1 (Homo sapiens) 6480464 methyleugenol results in increased expression of ALDH3A1 mRNA CTD PMID:32234424 Aldh3a1 Rat oct-2-enal affects metabolic processing ISO ALDH3A1 (Homo sapiens) 6480464 ALDH3A1 protein affects the metabolism of 2-octenal CTD PMID:11306050 Aldh3a1 Rat oct-2-enal decreases response to substance ISO ALDH3A1 (Homo sapiens) 6480464 ALDH3A1 protein results in decreased susceptibility to 2-octenal CTD PMID:11306050 Aldh3a1 Rat omeprazole increases expression ISO ALDH3A1 (Homo sapiens) 6480464 Omeprazole results in increased expression of ALDH3A1 mRNA CTD PMID:12040753 Aldh3a1 Rat ozone multiple interactions ISO Aldh3a1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of ALDH3A1 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of ALDH3A1 mRNA CTD PMID:34911549 Aldh3a1 Rat paracetamol affects expression ISO Aldh3a1 (Mus musculus) 6480464 Acetaminophen affects the expression of ALDH3A1 mRNA CTD PMID:17562736 Aldh3a1 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of ALDH3A1 mRNA CTD PMID:33387578 Aldh3a1 Rat paracetamol decreases expression ISO ALDH3A1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of ALDH3A1 mRNA CTD PMID:29067470 Aldh3a1 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of ALDH3A1 mRNA CTD PMID:32680482 Aldh3a1 Rat perfluorodecanoic acid decreases expression ISO ALDH3A1 (Homo sapiens) 6480464 perfluorodecanoic acid results in decreased expression of ALDH3A1 mRNA CTD PMID:38568856 Aldh3a1 Rat perfluorononanoic acid decreases expression ISO ALDH3A1 (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in decreased expression of ALDH3A1 mRNA CTD PMID:32588087 Aldh3a1 Rat perfluorooctane-1-sulfonic acid decreases expression ISO ALDH3A1 (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in decreased expression of ALDH3A1 mRNA CTD PMID:38568856 Aldh3a1 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of ALDH3A1 mRNA CTD PMID:35163327 Aldh3a1 Rat permethrin increases expression ISO Aldh3a1 (Mus musculus) 6480464 Permethrin results in increased expression of ALDH3A1 mRNA CTD PMID:34427685 Aldh3a1 Rat phenanthrene increases expression ISO ALDH3A1 (Homo sapiens) 6480464 phenanthrene results in increased expression of ALDH3A1 mRNA CTD PMID:32890658 Aldh3a1 Rat phenanthrene decreases expression ISO ALDH3A1 (Homo sapiens) 6480464 phenanthrene results in decreased expression of ALDH3A1 mRNA CTD PMID:38568856 Aldh3a1 Rat PhIP increases expression ISO ALDH3A1 (Homo sapiens) 6480464 2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in increased expression of ALDH3A1 mRNA CTD PMID:20816883 Aldh3a1 Rat PhIP increases expression EXP 6480464 2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in increased expression of ALDH3A1 mRNA CTD PMID:33945839 Aldh3a1 Rat picene increases expression ISO ALDH3A1 (Homo sapiens) 6480464 picene results in increased expression of ALDH3A1 mRNA CTD PMID:32251684 Aldh3a1 Rat pirinixic acid multiple interactions ISO ALDH3A1 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of ALDH3A1 mRNA CTD PMID:19710929 Aldh3a1 Rat potassium chromate multiple interactions ISO Aldh3a1 (Mus musculus) 6480464 [Potassium Dichromate co-treated with potassium chromate(VI)] inhibits the reaction [Benzo(a)pyrene results in increased expression of ALDH3A1 mRNA] CTD PMID:14625279 Aldh3a1 Rat potassium dichromate multiple interactions ISO Aldh3a1 (Mus musculus) 6480464 [Potassium Dichromate co-treated with potassium chromate(VI)] inhibits the reaction [Benzo(a)pyrene results in increased expression of ALDH3A1 mRNA] CTD PMID:14625279 Aldh3a1 Rat progesterone decreases expression ISO ALDH3A1 (Homo sapiens) 6480464 Progesterone results in decreased expression of ALDH3A1 mRNA CTD PMID:18037150 Aldh3a1 Rat propanal increases metabolic processing ISO Aldh3a1 (Mus musculus) 6480464 ALDH3A1 protein results in increased metabolism of propionaldehyde CTD PMID:21256123 Aldh3a1 Rat propanal increases metabolic processing ISO ALDH3A1 (Homo sapiens) 6480464 ALDH3A1 protein results in increased metabolism of propionaldehyde CTD PMID:19822198 Aldh3a1 Rat propiconazole increases expression ISO ALDH3A1 (Homo sapiens) 6480464 propiconazole results in increased expression of ALDH3A1 mRNA CTD PMID:30293151 Aldh3a1 Rat propylparaben decreases expression ISO ALDH3A1 (Homo sapiens) 6480464 propylparaben results in decreased expression of ALDH3A1 mRNA CTD PMID:38568856 Aldh3a1 Rat puromycin multiple interactions EXP 6480464 Puromycin promotes the reaction [Tetrachlorodibenzodioxin results in increased expression of ALDH3A1 mRNA] CTD PMID:1953764 Aldh3a1 Rat pyrene decreases expression ISO ALDH3A1 (Homo sapiens) 6480464 pyrene results in decreased expression of ALDH3A1 mRNA CTD PMID:32890658 Aldh3a1 Rat rac-lactic acid increases expression ISO ALDH3A1 (Homo sapiens) 6480464 Lactic Acid results in increased expression of ALDH3A1 mRNA CTD PMID:30851411 Aldh3a1 Rat resveratrol multiple interactions ISO ALDH3A1 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of ALDH3A1 mRNA CTD PMID:23557933 Aldh3a1 Rat S-(1,2-dichlorovinyl)-L-cysteine increases expression ISO ALDH3A1 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in increased expression of ALDH3A1 mRNA CTD PMID:35811015 Aldh3a1 Rat silicon dioxide decreases expression ISO ALDH3A1 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of ALDH3A1 mRNA CTD PMID:23806026 Aldh3a1 Rat silicon dioxide decreases expression EXP 6480464 Silicon Dioxide results in decreased expression of ALDH3A1 mRNA CTD PMID:32721576 Aldh3a1 Rat silver atom increases expression ISO Aldh3a1 (Mus musculus) 6480464 Silver results in increased expression of ALDH3A1 mRNA CTD PMID:27131904 Aldh3a1 Rat silver(0) increases expression ISO Aldh3a1 (Mus musculus) 6480464 Silver results in increased expression of ALDH3A1 mRNA CTD PMID:27131904 Aldh3a1 Rat simvastatin increases expression ISO ALDH3A1 (Homo sapiens) 6480464 Simvastatin results in increased expression of ALDH3A1 mRNA CTD PMID:17428261 Aldh3a1 Rat sodium arsenite multiple interactions ISO ALDH3A1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of and affects the splicing of ALDH3A1 mRNA CTD PMID:25879800 Aldh3a1 Rat sodium arsenite decreases expression ISO ALDH3A1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of ALDH3A1 mRNA CTD PMID:38568856 Aldh3a1 Rat sodium arsenite increases expression ISO ALDH3A1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of ALDH3A1 mRNA CTD PMID:29301061 and PMID:34032870 Aldh3a1 Rat sodium dichromate multiple interactions ISO Aldh3a1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with sodium bichromate] results in decreased expression of ALDH3A1 mRNA and Benzo(a)pyrene promotes the reaction [sodium bichromate results in decreased expression of ALDH3A1 mRNA] CTD PMID:22613061 Aldh3a1 Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of ALDH3A1 mRNA CTD PMID:12325037 Aldh3a1 Rat sodium dichromate decreases expression ISO Aldh3a1 (Mus musculus) 6480464 sodium bichromate results in decreased expression of ALDH3A1 mRNA CTD PMID:22613061 Aldh3a1 Rat temozolomide increases expression ISO ALDH3A1 (Homo sapiens) 6480464 Temozolomide results in increased expression of ALDH3A1 mRNA CTD PMID:31758290 Aldh3a1 Rat tetraphene increases expression ISO ALDH3A1 (Homo sapiens) 6480464 benz(a)anthracene results in increased expression of ALDH3A1 mRNA CTD PMID:32890658 Aldh3a1 Rat thioacetamide multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in increased expression of ALDH3A1 mRNA CTD PMID:28943392 Aldh3a1 Rat Thiotepa affects response to substance ISO ALDH3A1 (Homo sapiens) 6480464 ALDH3A1 protein affects the susceptibility to Thiotepa CTD PMID:18854779 Aldh3a1 Rat thiram decreases expression ISO ALDH3A1 (Homo sapiens) 6480464 Thiram results in decreased expression of ALDH3A1 mRNA CTD PMID:38568856 Aldh3a1 Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of ALDH3A1 gene CTD PMID:27618143 Aldh3a1 Rat triphenylene multiple interactions ISO ALDH3A1 (Homo sapiens) 6480464 [retene co-treated with benzo(a)fluorene co-treated with benzo(b)fluorene co-treated with benzo(c)fluorene co-treated with triphenylene co-treated with benzo(e)pyrene co-treated with 1 and 12-benzoperylene] results in increased expression of ALDH3A1 mRNA CTD PMID:38673911 Aldh3a1 Rat urethane decreases expression ISO ALDH3A1 (Homo sapiens) 6480464 Urethane results in decreased expression of ALDH3A1 mRNA CTD PMID:28818685 Aldh3a1 Rat valproic acid increases methylation ISO ALDH3A1 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of ALDH3A1 gene CTD PMID:29501571 Aldh3a1 Rat valproic acid decreases expression ISO ALDH3A1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of ALDH3A1 mRNA CTD PMID:29501571 Aldh3a1 Rat zinc oxide multiple interactions ISO Aldh3a1 (Mus musculus) 6480464 Zinc Oxide affects the splicing of and results in increased expression of ALDH3A1 mRNA CTD PMID:30500950 Aldh3a1 Rat zinc sulfate multiple interactions ISO Aldh3a1 (Mus musculus) 6480464 [Ethanol co-treated with Zinc Sulfate] results in increased activity of ALDH3A1 protein CTD PMID:15920153
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
1,2,3,7,8-Pentachlorodibenzodioxin (EXP) 1,2,4-trimethylbenzene (EXP) 1,2-naphthoquinone (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3',4,4',5-Pentachlorobiphenyl (EXP) 2,3,3',4,4',5-Hexachlorobiphenyl (EXP) 2,3,4,7,8-Pentachlorodibenzofuran (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4-diaminotoluene (ISO) 2,4-dinitrotoluene (EXP) 2-acetamidofluorene (ISO) 2-hexenal (ISO) 2-hydroxypropanoic acid (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP,ISO) 3-methylcholanthrene (EXP,ISO) 4,4'-sulfonyldiphenol (ISO) 4-(diethylamino)benzaldehyde (ISO) 4-hydroperoxycyclophosphamide (ISO) 4-hydroxynon-2-enal (EXP,ISO) 4-nitrophenyl acetate (ISO) 5-azacytidine (ISO) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (ISO) 6-propyl-2-thiouracil (EXP) 7,12-dimethyltetraphene (ISO) acetaldehyde (ISO) acrolein (ISO) actinomycin D (ISO) aflatoxin B1 (EXP,ISO) Aldophosphamide (ISO) all-trans-retinal (EXP) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) amitrole (EXP) ammonium chloride (EXP) Aroclor 1254 (EXP) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) benzaldehyde (ISO) benzene (ISO) Benzo[a]fluorene (ISO) benzo[a]pyrene (ISO) Benzo[b]fluorene (ISO) Benzo[c]fluorene (ISO) benzo[e]pyrene (ISO) Benzo[ghi]perylene (ISO) benzyl isothiocyanate (ISO) beta-lapachone (ISO) beta-naphthoflavone (EXP,ISO) bis(2-chloroethyl) sulfide (ISO) bisphenol A (EXP,ISO) butan-1-ol (ISO) butylated hydroxyanisole (ISO) cadmium dichloride (ISO) calciol (ISO) capsaicin (EXP) carbon nanotube (ISO) carboplatin (ISO) cefaloridine (EXP) chlordecone (ISO) chloroethene (EXP) chloropicrin (ISO) chloroprene (ISO) chlorpyrifos (EXP) chromium atom (ISO) cimetidine (ISO) cisplatin (ISO) clofibrate (EXP) cobalt dichloride (EXP,ISO) cycloheximide (EXP) cyclophosphamide (ISO) cyclosporin A (ISO) DDE (ISO) desferrioxamine B (ISO) dexamethasone (ISO) diarsenic trioxide (ISO) dibenzo[a,l]pyrene (ISO) dibenzofuran (EXP) diethyldithiocarbamic acid (ISO) dioxygen (EXP,ISO) disulfiram (ISO) diuron (EXP) endosulfan (ISO) ethanol (ISO) etoposide (ISO) fluoranthene (ISO) folic acid (ISO) formaldehyde (ISO) gentamycin (EXP) glycidol (EXP) glycidyl methacrylate (ISO) hexanal (ISO) hydrogen peroxide (ISO) hydroquinone (ISO) Indeno[1,2,3-cd]pyrene (ISO) indole-3-methanol (EXP) leflunomide (ISO) lipopolysaccharide (ISO) malonaldehyde (ISO) MeIQx (ISO) mercury dichloride (ISO) methimazole (EXP) methyl methacrylate (ISO) methylparaben (ISO) mitomycin C (ISO) monosodium L-glutamate (ISO) N,N-diethyl-m-toluamide (ISO) N-nitrosodiethylamine (EXP) NAD zwitterion (ISO) NAD(+) (ISO) NADP zwitterion (ISO) NADP(+) (ISO) nickel atom (ISO) nickel dichloride (EXP,ISO) non-2-enal (ISO) Nutlin-3 (ISO) O-methyleugenol (ISO) oct-2-enal (ISO) omeprazole (ISO) ozone (ISO) paracetamol (EXP,ISO) paraquat (EXP) perfluorodecanoic acid (ISO) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP) permethrin (ISO) phenanthrene (ISO) PhIP (EXP,ISO) picene (ISO) pirinixic acid (ISO) potassium chromate (ISO) potassium dichromate (ISO) progesterone (ISO) propanal (ISO) propiconazole (ISO) propylparaben (ISO) puromycin (EXP) pyrene (ISO) rac-lactic acid (ISO) resveratrol (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) silicon dioxide (EXP,ISO) silver atom (ISO) silver(0) (ISO) simvastatin (ISO) sodium arsenite (ISO) sodium dichromate (EXP,ISO) temozolomide (ISO) tetraphene (ISO) thioacetamide (EXP) Thiotepa (ISO) thiram (ISO) trichloroethene (EXP) triphenylene (ISO) urethane (ISO) valproic acid (ISO) zinc oxide (ISO) zinc sulfate (ISO)
1.
Preliminary characterization of the rat class 3 aldehyde dehydrogenase gene.
Asman DC, etal., Adv Exp Med Biol 1993;328:81-6.
2.
Constitutive expression of class 3 aldehyde dehydrogenase in cultured rat corneal epithelium.
Boesch JS, etal., J Biol Chem. 1996 Mar 1;271(9):5150-7.
3.
The negative regulation of the rat aldehyde dehydrogenase 3 gene by glucocorticoids: involvement of a single imperfect palindromic glucocorticoid responsive element.
Falkner KC, etal., Mol Pharmacol. 1999 Apr;55(4):649-57.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
6.
Aldehyde dehydrogenase activity and large vessel disease in diabetes mellitus. A preliminary study.
Jerntorp P, etal., Diabetes. 1986 Mar;35(3):291-4.
7.
Cloning and complete nucleotide sequence of a full-length cDNA encoding a catalytically functional tumor-associated aldehyde dehydrogenase.
Jones DE Jr, etal., Proc Natl Acad Sci U S A 1988 Mar;85(6):1782-6.
8.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
9.
Persistent induction of hepatic and pulmonary phase II enzymes by 3-methylcholanthrene in rats.
Kondraganti SR, etal., Toxicol Sci. 2008 Apr;102(2):337-44. Epub 2008 Jan 17.
10.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
11.
Inhibition of cytosolic class 3 aldehyde dehydrogenase by antisense oligonucleotides in rat hepatoma cells.
Muzio G, etal., Chem Biol Interact. 2001 Jan 30;130-132(1-3):219-25.
12.
Antisense oligonucleotides against aldehyde dehydrogenase 3 inhibit hepatoma cell proliferation by affecting MAP kinases.
Muzio G, etal., Chem Biol Interact. 2003 Feb 1;143-144:37-43.
13.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
14.
Acute-phase response to benzopyrene and induction of rat ALDH3A1.
Pappas P, etal., Chem Biol Interact. 2003 Feb 1;143-144:55-62.
15.
Anti-inflammatory agents and inducibility of hepatic drug metabolism.
Pappas P, etal., Eur J Drug Metab Pharmacokinet. 1998 Oct-Dec;23(4):457-60.
16.
Zoxazolamine-induced paralysis in two rat substrains: differences in hepatic drug metabolism.
Pappas P, etal., Eur J Drug Metab Pharmacokinet. 1998 Oct-Dec;23(4):461-7.
17.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
18.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
19.
Aldehyde dehydrogenase 3 gene regulation: studies on constitutive and hypoxia-modulated expression.
Reisdorph R and Lindahl R, Chem Biol Interact. 2001 Jan 30;130-132(1-3):227-33.
20.
GOA pipeline
RGD automated data pipeline
21.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
22.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
23.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
24.
cAMP-dependent negative regulation of rat aldehyde dehydrogenase class 3 gene expression.
Xiao G, etal., J Biol Chem. 1997 Feb 7;272(6):3238-45.
25.
Comparative study of alcohol metabolism in stroke-prone spontaneously hypertensive rats and Wistar-Kyoto rats fed normal or low levels of dietary protein.
Yang SC, etal., J Nutr Sci Vitaminol (Tokyo). 1994 Dec;40(6):547-55.
26.
Developmental expression of aldehyde dehydrogenase in rat: a comparison of liver and lung development.
Yoon M, etal., Toxicol Sci. 2006 Feb;89(2):386-98. Epub 2005 Nov 16.
Aldh3a1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 46,392,464 - 46,402,151 (+) NCBI GRCr8 mRatBN7.2 10 45,892,993 - 45,902,680 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 45,892,924 - 45,902,681 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 50,595,478 - 50,605,184 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 50,085,870 - 50,095,575 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 45,589,438 - 45,599,135 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 47,490,168 - 47,499,855 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 47,490,153 - 47,499,876 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 47,265,007 - 47,274,692 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 47,365,195 - 47,374,880 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 47,378,817 - 47,388,503 (+) NCBI Celera 10 45,146,398 - 45,156,083 (+) NCBI Celera Cytogenetic Map 10 q22 NCBI
ALDH3A1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 19,737,984 - 19,748,298 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 19,737,984 - 19,748,943 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 19,641,297 - 19,651,611 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 19,581,889 - 19,592,200 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 19,581,891 - 19,592,200 NCBI Celera 17 17,054,645 - 17,065,094 (-) NCBI Celera Cytogenetic Map 17 p11.2 NCBI HuRef 17 19,020,080 - 19,030,532 (-) NCBI HuRef CHM1_1 17 19,650,159 - 19,660,608 (-) NCBI CHM1_1 T2T-CHM13v2.0 17 19,686,602 - 19,696,916 (-) NCBI T2T-CHM13v2.0
Aldh3a1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 61,099,336 - 61,109,244 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 61,098,363 - 61,109,247 (+) Ensembl GRCm39 Ensembl GRCm38 11 61,208,510 - 61,218,418 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 61,207,537 - 61,218,421 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 61,022,244 - 61,031,920 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 61,024,940 - 61,034,609 (+) NCBI MGSCv36 mm8 MGSCv36 11 61,638,438 - 61,648,107 (+) NCBI MGSCv36 mm8 Cytogenetic Map 11 B2 NCBI cM Map 11 37.96 NCBI
Aldh3a1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955467 96,140 - 105,738 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955467 96,140 - 105,738 (+) NCBI ChiLan1.0 ChiLan1.0
ALDH3A1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 54,728,524 - 54,738,858 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 59,540,244 - 59,550,581 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 31,384,740 - 31,395,719 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 36,531,830 - 36,539,428 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 36,531,720 - 36,542,504 (+) Ensembl panpan1.1 panPan2
ALDH3A1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 40,466,237 - 40,474,272 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 40,466,237 - 40,474,457 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 40,608,116 - 40,616,150 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 40,572,237 - 40,580,273 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 40,572,237 - 40,580,458 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 40,543,623 - 40,551,653 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 40,489,252 - 40,497,281 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 40,681,916 - 40,689,952 (+) NCBI UU_Cfam_GSD_1.0
Aldh3a1
ALDH3A1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 12 59,897,496 - 59,905,897 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 12 59,895,476 - 59,905,900 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 12 62,639,844 - 62,660,135 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ALDH3A1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 18,302,145 - 18,312,768 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 18,302,142 - 18,312,756 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666059 2,534,705 - 2,545,299 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
.
Predicted Target Of
Count of predictions: 171 Count of miRNA genes: 118 Interacting mature miRNAs: 127 Transcripts: ENSRNOT00000003182 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
61441 Btemp1 Thermal response to stress QTL 1 4 body temperature trait (VT:0005535) core body temperature (CMO:0001036) 10 35392457 63642539 Rat 9589136 Insul27 Insulin level QTL 27 10.46 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 10 11474010 56474010 Rat 152025229 Scl83 Serum cholesterol level QTL 83 4.33 blood cholesterol amount (VT:0000180) 10 35710580 68663659 Rat 1578779 Tcas10 Tongue tumor susceptibility QTL 10 3.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 10 31297439 76297439 Rat 631564 Apr3 Acute phase response QTL 3 3.9 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 10 15275955 60275955 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 631552 Vetf2 Vascular elastic tissue fragility QTL 2 4.5 0.0002 aorta elastic tissue integrity trait (VT:0010556) artery internal elastic lamina non-tumorous lesion count (CMO:0001913) 10 41142633 86142633 Rat 631554 Bp133 Blood pressure QTL 133 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 743364 63851208 Rat 631557 Bp136 Blood pressure QTL 136 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 30632053 75632053 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1298078 Stresp5 Stress response QTL 5 2.99 0.00025 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 42045676 104670812 Rat 1578761 Stresp21 Stress response QTL 21 3.3 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 6375746 51375746 Rat 2298544 Neuinf9 Neuroinflammation QTL 9 4.6 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 10 5801990 62146030 Rat 61463 Bp12 Blood pressure QTL 12 6.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 41333258 86333258 Rat 8694173 Bw149 Body weight QTL 149 4.38 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 10 44441699 89441699 Rat 2300218 Hpcl2 Hepatic cholesterol level QTL 2 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 45029650 95600334 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 1598852 Anxrr19 Anxiety related response QTL 19 5.07 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 10 18167841 63167841 Rat 1581497 Esta1 Estrogen-induced thymic atrophy QTL 1 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 21329805 61345413 Rat 2313095 Bss62 Bone structure and strength QTL 62 1.5 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 724527 Bp148 Blood pressure QTL 148 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 28453136 73453136 Rat 1358897 Stresp6 Stress response QTL 6 4.17 0.022 blood norepinephrine amount (VT:0005663) plasma norepinephrine level (CMO:0001010) 10 35392267 64155584 Rat 1331762 Rf40 Renal function QTL 40 3.873 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 10 29299504 64155584 Rat 2300171 Bmd58 Bone mineral density QTL 58 4.9 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 26944628 71944628 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 70188 BpQTLcluster1 Blood pressure QTL cluster 1 4.864 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 42323132 87323132 Rat 2313104 Bss61 Bone structure and strength QTL 61 0.9 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 9590310 Scort19 Serum corticosterone level QTL 19 6.3 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 9589030 Epfw9 Epididymal fat weight QTL 9 19.24 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 10 44441699 89441699 Rat 10402859 Bp381 Blood pressure QTL 381 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 70198 BpQTLcluster9 Blood pressure QTL cluster 9 2.94 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 42323132 87323132 Rat 6893352 Bw100 Body weight QTL 100 0.33 0.6 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 724556 Pur2 Proteinuria QTL 2 5.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 22427500 90627625 Rat 8662860 Vetf10 Vascular elastic tissue fragility QTL 10 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 10 6154182 73453136 Rat 2313066 Bss63 Bone structure and strength QTL 63 1.4 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 10 5387014 50387014 Rat 2313064 Bmd71 Bone mineral density QTL 71 0.9 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 10 5387014 50387014 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 1354587 Kidm21 Kidney mass QTL 21 3.3 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 10 15028513 60430477 Rat 6893350 Bw99 Body weight QTL 99 0.87 0.16 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 2317043 Aia7 Adjuvant induced arthritis QTL 7 3.82 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 37565079 82565079 Rat 70224 Eae3 Experimental allergic encephalomyelitis QTL 3 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 10 26521957 61345413 Rat 2317042 Aia20 Adjuvant induced arthritis QTL 20 3.38 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 37565079 82565079 Rat 2313081 Bss64 Bone structure and strength QTL 64 1.3 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 10 5387014 50387014 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 2313087 Bmd80 Bone mineral density QTL 80 3.2 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 10 19606483 64606483 Rat 1354614 Hpcl1 Hepatic cholesterol level QTL 1 3.3 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 35392267 51793994 Rat 631532 Cm50 Cardiac mass QTL 50 6.6 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 17907113 51786432 Rat 1576319 Cia29 Collagen induced arthritis QTL 29 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 33973921 78973921 Rat 8552805 Bw145 Body weight QTL 145 2.2 body mass (VT:0001259) change in body weight to body weight ratio (CMO:0002216) 10 41944526 78307017 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1600371 Mcs21 Mammary carcinoma susceptibility QTL 21 3 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 28875650 52200160 Rat 1576308 Schws1 Schwannoma susceptibility QTL 1 0.0041 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 40035094 102359817 Rat 631269 Cia22 Collagen induced arthritis QTL 22 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 9590268 Scort13 Serum corticosterone level QTL 13 3.26 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 1576311 Pia26 Pristane induced arthritis QTL 26 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 31224026 75632053 Rat 631270 Cia23 Collagen induced arthritis QTL 23 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 7411614 Foco18 Food consumption QTL 18 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 44441699 89441699 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 6893342 Cm78 Cardiac mass QTL 78 0.1 0.88 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 42876766 79813922 Rat 2292441 Bp308 Blood pressure QTL 308 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2313055 Bw96 Body weight QTL 96 3.6 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 10 19606483 64606483 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat
RH132563
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 10 46,401,809 - 46,402,115 (+) Marker Load Pipeline mRatBN7.2 10 45,902,338 - 45,902,644 (+) MAPPER mRatBN7.2 Rnor_6.0 10 47,499,514 - 47,499,819 NCBI Rnor6.0 Rnor_5.0 10 47,274,351 - 47,274,656 UniSTS Rnor5.0 RGSC_v3.4 10 47,374,539 - 47,374,844 UniSTS RGSC3.4 Celera 10 45,155,742 - 45,156,047 UniSTS Cytogenetic Map 10 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
31
95
39
43
12
25
12
6
130
74
80
27
49
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000003182 ⟹ ENSRNOP00000003182
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 45,892,924 - 45,902,680 (+) Ensembl Rnor_6.0 Ensembl 10 47,490,153 - 47,499,876 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000107161 ⟹ ENSRNOP00000078369
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 45,892,953 - 45,902,681 (+) Ensembl
RefSeq Acc Id:
NM_031972 ⟹ NP_114178
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 46,392,464 - 46,402,151 (+) NCBI mRatBN7.2 10 45,892,993 - 45,902,680 (+) NCBI Rnor_6.0 10 47,490,168 - 47,499,855 (+) NCBI Rnor_5.0 10 47,265,007 - 47,274,692 (+) NCBI RGSC_v3.4 10 47,365,195 - 47,374,880 (+) RGD Celera 10 45,146,398 - 45,156,083 (+) RGD
Sequence:
GAATTCCTGCTGCACCCATATTTGAATATTGTTTTATCCTCATCACGCGAACTTCCTGGGGAAGGACTCCAAGGTCCAAGTGGGCGGGAAGGAGGGTCCTTAAATGTGCCCTCTTTCAGCTCTTGCTC
hide sequence
RefSeq Acc Id:
NP_114178 ⟸ NM_031972
- UniProtKB:
P11883 (UniProtKB/Swiss-Prot), A6HF73 (UniProtKB/TrEMBL), A0A8L2Q0S9 (UniProtKB/TrEMBL)
- Sequence:
MSSISDTVKRAREAFNSGKTRSLQFRIQQLEALQRMINENLKSISGALASDLGKNEWTSYYEEVAHVLEELDTTIKELPDWAEDEPVAKTRQTQQDDLYIHSEPLGVVLVIGAWNYPFNLTIQPMVGA
hide sequence
Ensembl Acc Id:
ENSRNOP00000003182 ⟸ ENSRNOT00000003182
Ensembl Acc Id:
ENSRNOP00000078369 ⟸ ENSRNOT00000107161
RGD ID: 13697259 Promoter ID: EPDNEW_R7784 Type: single initiation site Name: Aldh3a1_1 Description: aldehyde dehydrogenase 3 family, member A1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 47,490,289 - 47,490,349 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-03-12
Aldh3a1
aldehyde dehydrogenase 3 family, member A1
Aldh3a1
aldehyde dehydrogenase family 3, member A1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2003-04-09
Aldh3a1
aldehyde dehydrogenase family 3, member A1
Aldehyde dehydrogenase family 3, subfamily A1
Name updated
629478 APPROVED
2001-06-12
Aldh3
Aldehyde dehydrogenase class 3
Symbol and Name withdrawn
62408 WITHDRAWN
2001-06-12
Aldh3a1
Aldehyde dehydrogenase family 3, subfamily A1
Symbol and Name updated to reflect Human and Mouse nomenclature
62408 APPROVED
Note Type
Note
Reference
gene_disease
expressed during hepatocarcinogenesis
632185
gene_function
has aldehyde dehydrogenase activity in vitro
632185
gene_product
member of the aldehyde dehydrogenase family
632185
