Symbol:
Agtr2
Name:
angiotensin II receptor, type 2
RGD ID:
2072
Description:
Enables angiotensin type II receptor activity. Involved in several processes, including cellular response to dexamethasone stimulus; positive regulation of branching involved in ureteric bud morphogenesis; and regulation of secretion. Located in perinuclear region of cytoplasm. Used to study chronic kidney disease; congenital diaphragmatic hernia; glomerulonephritis (multiple); hypertension (multiple); and meconium aspiration syndrome. Biomarker of several diseases, including asthma; congestive heart failure; glomerulosclerosis (multiple); hypertension; and type 2 diabetes mellitus. Human ortholog(s) of this gene implicated in IgA glomerulonephritis; end stage renal disease; hypoglycemia; intellectual disability; and vesicoureteral reflux. Orthologous to human AGTR2 (angiotensin II receptor type 2); PARTICIPATES IN angiotensin III signaling pathway via AT2 receptor; angiotensin II signaling pathway via AT2 receptor; G protein mediated signaling pathway via Galphai family; INTERACTS WITH (+)-pilocarpine; (S)-nicotine; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
angiotensin II type 2 receptor; angiotensin II type-2 receptor; Angiotensin receptor 2; AT2; AT2 receptor; AT2-R; AT2R; AT2 R; type-2 angiotensin II receptor
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
AGTR2 (angiotensin II receptor type 2) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):
Agtr2 (angiotensin II receptor, type 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Agtr2 (angiotensin II receptor type 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
AGTR2 (angiotensin II receptor type 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
AGTR2 (angiotensin II receptor type 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Agtr2 (angiotensin II receptor type 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
AGTR2 (angiotensin II receptor type 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
AGTR2 (angiotensin II receptor type 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Agtr2 (angiotensin II receptor type 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Agtr2 (angiotensin II receptor, type 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
AGTR2 (angiotensin II receptor type 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
agtr2 (angiotensin II receptor, type 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
npr-33
Alliance
DIOPT (Ensembl Compara|PANTHER)
Caenorhabditis elegans (roundworm):
npr-15
Alliance
DIOPT (Ensembl Compara|PANTHER)
Xenopus tropicalis (tropical clawed frog):
agtr2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 116,914,320 - 116,918,504 (+) NCBI GRCr8 mRatBN7.2 X 112,119,876 - 112,124,060 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 112,120,228 - 112,124,057 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 114,138,672 - 114,139,763 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 117,629,475 - 117,630,566 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 115,194,251 - 115,195,342 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 119,389,480 - 119,393,845 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 119,390,013 - 119,393,842 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 119,534,483 - 119,538,667 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Celera X 111,375,374 - 111,376,465 (+) NCBI Celera Cytogenetic Map X q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Agtr2 Rat AIDS-Associated Nephropathy ISO RGD:10126 1303381 RGD Agtr2 Rat Alveolar Bone Loss treatment IEP 329956421 associated with hypertension, periodontal disease RGD Agtr2 Rat asthma IEP 5147457 mRNA, protein:increased expression:lung RGD Agtr2 Rat Brain Hypoxia-Ischemia IMP 6903872 RGD Agtr2 Rat chronic kidney disease IMP 6903863 RGD Agtr2 Rat congenital diaphragmatic hernia IMP 6903875 RGD Agtr2 Rat congestive heart failure IEP 6903846 RGD Agtr2 Rat congestive heart failure IEP 8549482 mRNA, protein:decreased expression:heart RGD Agtr2 Rat Diabetic Nephropathies IEP 6903847 associated with Diabetes Mellitus, Experimental;mRNA:decreased expression:kidney RGD Agtr2 Rat dilated cardiomyopathy ISO RGD:619558 6903900 mRNA, protein:increased expression:heart left ventricle RGD Agtr2 Rat dilated cardiomyopathy IEP 8549486 protein:increased expression:heart RGD Agtr2 Rat end stage renal disease ISO RGD:10126 6903843 RGD Agtr2 Rat end stage renal disease ISO RGD:619558 6903283 associated with Vesico-Ureteral Reflux;DNA:SNP: :-1332A>G (human) RGD Agtr2 Rat Endotoxemia IEP 6903849 protein:decreased expression:kidney RGD Agtr2 Rat Experimental Diabetes Mellitus IEP 6903861 mRNA, protein:decreased expression:kidney RGD Agtr2 Rat Experimental Radiation Injuries IMP 6903857 RGD Agtr2 Rat Fetal Growth Retardation IEP 5129179 RGD Agtr2 Rat Fibrosis IMP 6903874 associated with Hypertension RGD Agtr2 Rat Fibrosis ISO RGD:10126 6903848 associated with Ureteral Obstruction RGD Agtr2 Rat focal segmental glomerulosclerosis IEP 5129175 protein:increased expression:kidney cortex RGD Agtr2 Rat glomerulonephritis IMP 6903845 RGD Agtr2 Rat glomerulosclerosis IMP 6903284 associated with Kidney Failure, Chronic RGD Agtr2 Rat glomerulosclerosis ISO RGD:10126 6903882 RGD Agtr2 Rat glomerulosclerosis IEP 6903859 mRNA:increased expression:kidney RGD Agtr2 Rat hypertension IEP 6903865 mRNA, protein:decreased expression:kidney RGD Agtr2 Rat hypertension IMP 6903372 RGD Agtr2 Rat hypertension IMP 5129169 associated with Sleep Apnea Syndromes RGD Agtr2 Rat hypoglycemia ISO RGD:619558 2313551 associated with Diabetes Mellitus, Insulin-Dependent;DNA:polymorphism: :1675G>A (human) RGD Agtr2 Rat IgA glomerulonephritis disease_progression ISO RGD:619558 6903844 DNA:polymorphism: :1818A>T (human) RGD Agtr2 Rat IgA glomerulonephritis ISO RGD:619558 6903851 protein:increased expression:kidney tubule RGD Agtr2 Rat Inflammation ISO RGD:10126 6903855 associated with Ureteral Obstruction RGD Agtr2 Rat Insulin Resistance IEP 6903873 protein:increased expression:dorsal root ganglion, neuron RGD Agtr2 Rat intellectual disability ISO RGD:619558 1300276 RGD Agtr2 Rat meconium aspiration syndrome treatment IMP 11039054 RGD Agtr2 Rat obesity ISO RGD:10126 2313554 RGD Agtr2 Rat pancreatic cancer ISO RGD:619558 2325641 mRNA:increased expression:pancreas RGD Agtr2 Rat Prenatal Exposure Delayed Effects treatment IEP 401793718 associated with maternal adenine induced chronic kidney disease RGD Agtr2 Rat pulmonary fibrosis ISO RGD:10126 5147454 RGD Agtr2 Rat renal cell carcinoma disease_progression ISO RGD:619558 6903280 protein:increased expression:kidney RGD Agtr2 Rat renovascular hypertension IMP 6903868 RGD Agtr2 Rat renovascular hypertension IDA 6903867 RGD Agtr2 Rat Reperfusion Injury IDA 6903870 RGD Agtr2 Rat Stroke IMP 6903905 RGD Agtr2 Rat systemic lupus erythematosus ISO RGD:10126 6892717 RGD Agtr2 Rat type 2 diabetes mellitus IEP 2313550 mRNA, protein:increased expression:aorta RGD Agtr2 Rat Urogenital Abnormalities ISO RGD:619558 6903850 DNA:transition:intron RGD Agtr2 Rat Urogenital Abnormalities ISO RGD:619558 6903853 DNA:transition:intron:-1332A>G (human) RGD Agtr2 Rat vesicoureteral reflux ISO RGD:619558 6903866 RGD Agtr2 Rat vesicoureteral reflux no_association ISO RGD:619558 6903860 DNA:transition:intron:-1332A>G (human) RGD Agtr2 Rat vesicoureteral reflux ISO RGD:619558 6903853 DNA:transition:intron:-1332A>G (human) RGD
Only show annotations with direct experimental evidence (0 objects hidden)
Agtr2 Rat (+)-pilocarpine multiple interactions EXP 6480464 [Dexamethasone co-treated with Lithium Chloride co-treated with Pilocarpine] affects the expression of AGTR2 mRNA CTD PMID:32494933 Agtr2 Rat (R)-noradrenaline affects response to substance ISO RGD:10126 6480464 AGTR2 protein affects the susceptibility to Norepinephrine CTD PMID:11714657 Agtr2 Rat (S)-nicotine decreases expression EXP 6480464 Nicotine results in decreased expression of AGTR2 mRNA; Nicotine results in decreased expression of AGTR2 more ... CTD PMID:19429393 Agtr2 Rat (S)-nicotine affects expression EXP 6480464 Nicotine affects the expression of AGTR2 protein CTD PMID:22691361 Agtr2 Rat 17alpha-ethynylestradiol multiple interactions ISO RGD:10126 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of AGTR2 mRNA CTD PMID:17942748 Agtr2 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of AGTR2 mRNA; Estradiol results in increased expression of AGTR2 more ... CTD PMID:18388195 Agtr2 Rat 17beta-estradiol increases expression ISO RGD:10126 6480464 Estradiol results in increased expression of AGTR2 mRNA CTD PMID:19484750 Agtr2 Rat 17beta-estradiol multiple interactions EXP 6480464 [PD 123319 results in decreased activity of AGTR2 protein] which results in decreased susceptibility to more ... CTD PMID:18388195 Agtr2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:10126 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of AGTR2 mRNA CTD PMID:17942748 Agtr2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of AGTR2 mRNA CTD PMID:32109520 Agtr2 Rat 3',5'-cyclic GMP multiple interactions EXP 6480464 [PD 123319 results in decreased activity of AGTR2 protein] inhibits the reaction [Valsartan results in more ... CTD PMID:16982965 Agtr2 Rat 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine multiple interactions EXP 6480464 [Puromycin Aminonucleoside co-treated with Cholesterol] results in increased expression of AGTR2 mRNA CTD PMID:12495295 Agtr2 Rat 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine increases expression EXP 6480464 Puromycin Aminonucleoside results in increased expression of AGTR2 mRNA CTD PMID:12495295 Agtr2 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:10126 6480464 bisphenol S results in increased expression of AGTR2 mRNA CTD PMID:30951980 Agtr2 Rat 4-(5,6,7,8-tetrahydroimidazo[1,5-a]pyridin-5-yl)benzonitrile increases expression EXP 6480464 Fadrozole results in increased expression of AGTR2 protein CTD PMID:18586661 Agtr2 Rat 5-aza-2'-deoxycytidine increases expression EXP 6480464 Decitabine results in increased expression of AGTR2 mRNA; Decitabine results in increased expression of AGTR2 more ... CTD PMID:34536542 Agtr2 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of AGTR2 mRNA CTD PMID:24780913 Agtr2 Rat 7,9-dihydro-1H-purine-2,6,8(3H)-trione increases expression ISO RGD:10126 6480464 Uric Acid results in increased expression of AGTR2 mRNA CTD PMID:30710622 Agtr2 Rat 7,9-dihydro-1H-purine-2,6,8(3H)-trione multiple interactions ISO RGD:10126 6480464 APLN protein modified form inhibits the reaction [Uric Acid results in increased expression of AGTR2 more ... CTD PMID:30710622 Agtr2 Rat aldehydo-D-glucose multiple interactions ISO RGD:10126 6480464 CEBPB protein inhibits the reaction [Glucose results in increased expression of AGTR2 protein] CTD PMID:29266779 Agtr2 Rat aldehydo-D-glucose increases expression ISO RGD:10126 6480464 Glucose results in increased expression of AGTR2 protein CTD PMID:29266779 Agtr2 Rat aldosterone increases expression EXP 6480464 Aldosterone results in increased expression of AGTR2 mRNA CTD PMID:15809360 Agtr2 Rat amlodipine decreases expression EXP 6480464 Amlodipine results in decreased expression of AGTR2 mRNA CTD PMID:18403896 Agtr2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of AGTR2 mRNA CTD PMID:16483693 Agtr2 Rat angiotensin II increases expression EXP 6480464 Angiotensin II results in increased expression of AGTR2 mRNA; Angiotensin II results in increased expression more ... CTD PMID:12969123 Agtr2 Rat benzalkonium chloride multiple interactions ISO RGD:10126 6480464 [IL6 protein affects the susceptibility to Benzalkonium Compounds] which affects the expression of AGTR2 mRNA CTD PMID:30171875 Agtr2 Rat bisphenol A multiple interactions ISO RGD:10126 6480464 [potassium bromate co-treated with bisphenol A] affects the expression of AGTR2 mRNA; [XRCC6 gene mutant more ... CTD PMID:27082013 Agtr2 Rat bisphenol A increases expression ISO RGD:10126 6480464 bisphenol A results in increased expression of AGTR2 mRNA CTD PMID:30951980|PMID:37105096 Agtr2 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Genistein] results in increased methylation of AGTR2 gene CTD PMID:28505145 Agtr2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of AGTR2 mRNA CTD PMID:25181051 Agtr2 Rat bisphenol F increases expression ISO RGD:10126 6480464 bisphenol F results in increased expression of AGTR2 mRNA CTD PMID:30951980 Agtr2 Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of AGTR2 mRNA; Cadmium Chloride results in decreased expression more ... CTD PMID:37972751 Agtr2 Rat caffeine decreases expression EXP 6480464 Caffeine results in decreased expression of AGTR2 mRNA; Caffeine results in decreased expression of AGTR2 more ... CTD PMID:25986755|PMID:30423288 Agtr2 Rat candesartan multiple interactions ISO RGD:619558 6480464 [PD 123319 binds to and results in decreased activity of AGTR2 protein] inhibits the reaction more ... CTD PMID:18551021 Agtr2 Rat candesartan decreases expression EXP 6480464 candesartan results in decreased expression of AGTR2 mRNA CTD PMID:18796534 Agtr2 Rat Candesartan cilexetil increases expression EXP 6480464 candesartan cilexetil results in increased expression of AGTR2 protein CTD PMID:22120037 Agtr2 Rat CGP-42112A multiple interactions EXP 6480464 [CGP 42112A binds to and results in increased activity of AGTR2 protein] which affects the more ... CTD PMID:16003179|PMID:19151255 Agtr2 Rat CGP-42112A multiple interactions ISO RGD:10126 6480464 CGP 42112A promotes the reaction [[AGT protein co-treated with Rotenone] results in increased expression of more ... CTD PMID:25446015 Agtr2 Rat cholesterol multiple interactions EXP 6480464 [Cholesterol co-treated with Methylthiouracil] results in increased expression of AGTR2 mRNA; [Cholesterol co-treated with Methylthiouracil] more ... CTD PMID:12495295|PMID:21269478 Agtr2 Rat cilazapril monohydrate multiple interactions EXP 6480464 [Losartan co-treated with Cilazapril] inhibits the reaction [Doxorubicin results in decreased expression of AGTR2 mRNA]; more ... CTD PMID:15331931 Agtr2 Rat clofibrate increases expression ISO RGD:10126 6480464 Clofibrate results in increased expression of AGTR2 mRNA CTD PMID:17585979 Agtr2 Rat cobalt dichloride increases expression ISO RGD:10126 6480464 cobaltous chloride results in increased expression of AGTR2 mRNA CTD PMID:25511041 Agtr2 Rat copper atom decreases expression EXP 6480464 Copper results in decreased expression of AGTR2 mRNA CTD PMID:30556269 Agtr2 Rat copper(0) decreases expression EXP 6480464 Copper results in decreased expression of AGTR2 mRNA CTD PMID:30556269 Agtr2 Rat copper(II) sulfate affects expression ISO RGD:619558 6480464 Copper Sulfate affects the expression of AGTR2 mRNA CTD PMID:19549813 Agtr2 Rat corticosterone decreases expression EXP 6480464 Corticosterone results in decreased expression of AGTR2 mRNA; Corticosterone results in decreased expression of AGTR2 more ... CTD PMID:30423288|PMID:37972751 Agtr2 Rat corticosterone multiple interactions EXP 6480464 Mifepristone inhibits the reaction [Corticosterone results in decreased expression of AGTR2 mRNA]; Mifepristone inhibits the more ... CTD PMID:30423288|PMID:37972751 Agtr2 Rat curcumin multiple interactions EXP 6480464 Curcumin inhibits the reaction [AGT protein results in decreased expression of AGTR2 protein] CTD PMID:26648693 Agtr2 Rat D-glucose multiple interactions ISO RGD:10126 6480464 CEBPB protein inhibits the reaction [Glucose results in increased expression of AGTR2 protein] CTD PMID:29266779 Agtr2 Rat D-glucose increases expression ISO RGD:10126 6480464 Glucose results in increased expression of AGTR2 protein CTD PMID:29266779 Agtr2 Rat dexamethasone decreases expression EXP 6480464 Dexamethasone results in decreased expression of AGTR2 mRNA; Dexamethasone results in decreased expression of AGTR2 more ... CTD PMID:30359671|PMID:32494933|PMID:32791177 Agtr2 Rat dexamethasone multiple interactions EXP 6480464 [Dexamethasone co-treated with Lithium Chloride co-treated with Pilocarpine] affects the expression of AGTR2 mRNA; AGTR2 more ... CTD PMID:30359671|PMID:32494933|PMID:32791177 Agtr2 Rat diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of AGTR2 mRNA; Diethylstilbestrol results in increased expression of AGTR2 more ... CTD PMID:14722030 Agtr2 Rat dioxygen increases expression ISO RGD:10126 6480464 Oxygen deficiency results in increased expression of AGTR2 mRNA CTD PMID:16769992 Agtr2 Rat dioxygen affects expression ISO RGD:10126 6480464 Oxygen deficiency affects the expression of AGTR2 protein CTD PMID:25511041 Agtr2 Rat dioxygen multiple interactions ISO RGD:10126 6480464 Losartan inhibits the reaction [Oxygen deficiency results in decreased expression of AGTR2 protein] CTD PMID:25511041 Agtr2 Rat dioxygen increases expression EXP 6480464 Oxygen deficiency results in increased expression of AGTR2 mRNA; Oxygen deficiency results in increased expression more ... CTD PMID:19118600 Agtr2 Rat dopaminechrome (enol form) decreases expression EXP 6480464 aminochrome 1 results in decreased expression of AGTR2 mRNA CTD PMID:18522901 Agtr2 Rat doxorubicin multiple interactions EXP 6480464 [Losartan co-treated with Cilazapril] inhibits the reaction [Doxorubicin results in decreased expression of AGTR2 mRNA]; more ... CTD PMID:15331931 Agtr2 Rat doxorubicin decreases expression EXP 6480464 Doxorubicin results in decreased expression of AGTR2 mRNA CTD PMID:15331931 Agtr2 Rat edaravone multiple interactions EXP 6480464 Edaravone inhibits the reaction [Lipopolysaccharides results in increased expression of AGTR2 mRNA] CTD PMID:19118600 Agtr2 Rat enalapril increases expression EXP 6480464 Enalapril results in increased expression of AGTR2 mRNA CTD PMID:18765277 Agtr2 Rat enalapril decreases expression EXP 6480464 Enalapril results in decreased expression of AGTR2 mRNA CTD PMID:18403896|PMID:9740612 Agtr2 Rat entinostat decreases expression ISO RGD:619558 6480464 entinostat results in decreased expression of AGTR2 mRNA CTD PMID:27188386 Agtr2 Rat epoxiconazole increases expression ISO RGD:10126 6480464 epoxiconazole results in increased expression of AGTR2 mRNA CTD PMID:35436446 Agtr2 Rat esculetin multiple interactions EXP 6480464 esculetin inhibits the reaction [Dietary Fats results in increased expression of AGTR2 mRNA]; esculetin promotes more ... CTD PMID:28946194 Agtr2 Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of AGTR2 mRNA; Ethanol results in decreased expression of AGTR2 more ... CTD PMID:29548890|PMID:31887396 Agtr2 Rat ethanol multiple interactions EXP 6480464 Ethanol affects the reaction [Dietary Fats affects the expression of AGTR2 mRNA]; Ethanol affects the more ... CTD PMID:31811911 Agtr2 Rat ferric oxide decreases expression EXP 6480464 ferric oxide analog results in decreased expression of AGTR2 mRNA CTD PMID:38615722 Agtr2 Rat folic acid increases expression ISO RGD:10126 6480464 Folic Acid results in increased expression of AGTR2 mRNA; Folic Acid results in increased expression more ... CTD PMID:12969123 Agtr2 Rat fructose multiple interactions EXP 6480464 APLN protein modified form inhibits the reaction [Fructose results in increased expression of AGTR2 mRNA] CTD PMID:30710622 Agtr2 Rat fructose increases expression EXP 6480464 Fructose results in increased expression of AGTR2 mRNA CTD PMID:30710622 Agtr2 Rat genistein multiple interactions EXP 6480464 [bisphenol A co-treated with Genistein] results in increased methylation of AGTR2 gene CTD PMID:28505145 Agtr2 Rat glucose multiple interactions ISO RGD:10126 6480464 CEBPB protein inhibits the reaction [Glucose results in increased expression of AGTR2 protein] CTD PMID:29266779 Agtr2 Rat glucose increases expression ISO RGD:10126 6480464 Glucose results in increased expression of AGTR2 protein CTD PMID:29266779 Agtr2 Rat glycidol decreases expression EXP 6480464 glycidol results in decreased expression of AGTR2 mRNA CTD PMID:24395379 Agtr2 Rat GW 3965 affects expression EXP 6480464 GW 3965 affects the expression of AGTR2 mRNA CTD PMID:17420776 Agtr2 Rat hydrogen peroxide increases expression ISO RGD:10126 6480464 Hydrogen Peroxide results in increased expression of AGTR2 mRNA CTD PMID:30710622 Agtr2 Rat Ile(5)-angiotensin II increases expression EXP 6480464 Angiotensin II results in increased expression of AGTR2 mRNA; Angiotensin II results in increased expression more ... CTD PMID:12969123 Agtr2 Rat lipopolysaccharide multiple interactions EXP 6480464 AGTR2 protein inhibits the reaction [Lipopolysaccharides results in increased expression of IL1B mRNA]; AGTR2 protein more ... CTD PMID:19118600 Agtr2 Rat lipopolysaccharide increases expression EXP 6480464 Lipopolysaccharides results in increased expression of AGTR2 mRNA CTD PMID:19118600 Agtr2 Rat lithium chloride multiple interactions EXP 6480464 [Dexamethasone co-treated with Lithium Chloride co-treated with Pilocarpine] affects the expression of AGTR2 mRNA CTD PMID:32494933 Agtr2 Rat losartan multiple interactions EXP 6480464 [Losartan co-treated with Cilazapril] inhibits the reaction [Doxorubicin results in decreased expression of AGTR2 mRNA]; more ... CTD PMID:11967826|PMID:15331931 Agtr2 Rat losartan multiple interactions ISO RGD:10126 6480464 Losartan inhibits the reaction [Oxygen deficiency results in decreased expression of AGTR2 protein] CTD PMID:25511041 Agtr2 Rat losartan increases expression EXP 6480464 Losartan results in increased expression of AGTR2 protein CTD PMID:18300857 Agtr2 Rat losartan decreases expression EXP 6480464 Losartan results in decreased expression of AGTR2 mRNA CTD PMID:9336375 Agtr2 Rat Methylthiouracil multiple interactions EXP 6480464 [Cholesterol co-treated with Methylthiouracil] results in increased expression of AGTR2 mRNA; [Cholesterol co-treated with Methylthiouracil] more ... CTD PMID:21269478 Agtr2 Rat mevinphos multiple interactions EXP 6480464 [Mevinphos results in increased activity of AGTR2 protein] which results in increased abundance of Peroxynitrous more ... CTD PMID:23824088 Agtr2 Rat mevinphos increases expression EXP 6480464 Mevinphos results in increased expression of AGTR2 mRNA; Mevinphos results in increased expression of AGTR2 more ... CTD PMID:23824088 Agtr2 Rat mifepristone multiple interactions EXP 6480464 Mifepristone inhibits the reaction [Corticosterone results in decreased expression of AGTR2 mRNA]; Mifepristone inhibits the more ... CTD PMID:30359671|PMID:30423288|PMID:32791177|PMID:37972751 Agtr2 Rat Nandrolone decanoate increases expression EXP 6480464 nandrolone decanoate results in increased expression of AGTR2 mRNA CTD PMID:17906098 Agtr2 Rat nicotine decreases expression EXP 6480464 Nicotine results in decreased expression of AGTR2 mRNA; Nicotine results in decreased expression of AGTR2 more ... CTD PMID:19429393 Agtr2 Rat nicotine affects expression EXP 6480464 Nicotine affects the expression of AGTR2 protein CTD PMID:22691361 Agtr2 Rat nitric oxide affects response to substance EXP 6480464 AGTR2 protein affects the susceptibility to Nitric Oxide CTD PMID:9374809 Agtr2 Rat nitrofen decreases expression EXP 6480464 nitrofen results in decreased expression of AGTR2 mRNA CTD PMID:15578192|PMID:16292651 Agtr2 Rat organophosphorus compound multiple interactions EXP 6480464 [Dust results in increased abundance of Organophosphorus Compounds] which results in increased expression of AGTR2 more ... CTD PMID:39658253 Agtr2 Rat p-menthan-3-ol decreases expression ISO RGD:619558 6480464 Menthol results in decreased expression of AGTR2 mRNA CTD PMID:26760959 Agtr2 Rat paraquat decreases expression ISO RGD:619558 6480464 Paraquat results in decreased expression of AGTR2 mRNA CTD PMID:20035857 Agtr2 Rat PD123319 multiple interactions ISO RGD:619558 6480464 [PD 123319 binds to and results in decreased activity of AGTR2 protein] inhibits the reaction more ... CTD PMID:15807884|PMID:18551021 Agtr2 Rat PD123319 multiple interactions ISO RGD:10126 6480464 PD 123319 inhibits the reaction [CGP 42112A promotes the reaction [[AGT protein co-treated with Rotenone] more ... CTD PMID:25446015 Agtr2 Rat PD123319 decreases activity EXP 6480464 PD 123319 results in decreased activity of AGTR2 protein CTD PMID:11509473|PMID:18388195 Agtr2 Rat PD123319 increases expression EXP 6480464 PD 123319 results in increased expression of AGTR2 mRNA; PD 123319 results in increased expression more ... CTD PMID:11893553 Agtr2 Rat PD123319 decreases expression EXP 6480464 PD 123319 results in decreased expression of AGTR2 mRNA CTD PMID:9336375|PMID:9740612 Agtr2 Rat PD123319 multiple interactions EXP 6480464 [PD 123319 binds to and results in decreased activity of AGTR2 protein] which affects the more ... CTD PMID:16982965|PMID:18300857|PMID:18388195|PMID:19151255 Agtr2 Rat peroxynitrous acid multiple interactions EXP 6480464 [Mevinphos results in increased activity of AGTR2 protein] which results in increased abundance of Peroxynitrous more ... CTD PMID:23824088 Agtr2 Rat phenylephrine multiple interactions EXP 6480464 [CGP 42112A binds to and results in increased activity of AGTR2 protein] which affects the more ... CTD PMID:19151255 Agtr2 Rat phenylephrine affects response to substance ISO RGD:10126 6480464 AGTR2 protein affects the susceptibility to Phenylephrine CTD PMID:11714657 Agtr2 Rat picrotoxin decreases expression EXP 6480464 Picrotoxin results in decreased expression of AGTR2 mRNA CTD PMID:15170462 Agtr2 Rat pioglitazone multiple interactions ISO RGD:10126 6480464 [ANGPT2 protein binds to and results in increased activity of AGTR2 protein] promotes the reaction more ... CTD PMID:15992368|PMID:27935865 Agtr2 Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of AGTR2 mRNA; pirinixic acid results in increased expression more ... CTD PMID:12832660|PMID:18300857 Agtr2 Rat potassium bromate multiple interactions ISO RGD:10126 6480464 [potassium bromate co-treated with bisphenol A] affects the expression of AGTR2 mRNA; [XRCC6 gene mutant more ... CTD PMID:27082013 Agtr2 Rat reserpine increases expression EXP 6480464 Reserpine results in increased expression of AGTR2 mRNA; Reserpine results in increased expression of AGTR2 more ... CTD PMID:20964730 Agtr2 Rat rotenone multiple interactions ISO RGD:10126 6480464 [AGT protein co-treated with Rotenone] results in increased expression of AGTR2 protein; AGT protein promotes more ... CTD PMID:25446015 Agtr2 Rat rotenone increases expression ISO RGD:10126 6480464 Rotenone results in increased expression of AGTR2 mRNA; Rotenone results in increased expression of AGTR2 more ... CTD PMID:25446015|PMID:29665408 Agtr2 Rat sodium arsenite decreases expression ISO RGD:10126 6480464 sodium arsenite results in decreased expression of AGTR2 mRNA CTD PMID:37682722 Agtr2 Rat sodium chloride decreases expression EXP 6480464 Sodium Chloride results in decreased expression of AGTR2 mRNA; Sodium Chloride results in decreased expression more ... CTD PMID:15809360 Agtr2 Rat sodium chloride multiple interactions EXP 6480464 AGTR2 protein inhibits the reaction [Sodium Chloride results in increased activity of AGT protein] CTD PMID:15809360 Agtr2 Rat spironolactone increases expression EXP 6480464 Spironolactone results in increased expression of AGTR2 protein CTD PMID:18586661 Agtr2 Rat streptozocin increases expression ISO RGD:10126 6480464 Streptozocin results in increased expression of AGTR2 mRNA; Streptozocin results in increased expression of AGTR2 more ... CTD PMID:17724226|PMID:29266779 Agtr2 Rat streptozocin multiple interactions ISO RGD:10126 6480464 CEBPB protein inhibits the reaction [Streptozocin results in increased expression of AGTR2 protein]; Valsartan inhibits more ... CTD PMID:29266779 Agtr2 Rat streptozocin increases expression EXP 6480464 Streptozocin results in increased expression of AGTR2 mRNA; Streptozocin results in increased expression of AGTR2 more ... CTD PMID:15587404 Agtr2 Rat streptozocin multiple interactions EXP 6480464 [Streptozocin co-treated with Dietary Fats] results in increased expression of AGTR2 mRNA; Drugs, Chinese Herbal more ... CTD PMID:15587404|PMID:28946194 Agtr2 Rat taurine decreases expression EXP 6480464 Taurine results in decreased expression of AGTR2 protein CTD PMID:16025228 Agtr2 Rat telmisartan increases expression EXP 329956421 telmisartan increases expression of mRNA in mandible of rats with periodontal disease RGD Agtr2 Rat testosterone affects expression EXP 6480464 Testosterone affects the expression of AGTR2 mRNA CTD PMID:17237611 Agtr2 Rat tetrachloromethane multiple interactions ISO RGD:10126 6480464 AGTR2 gene mutant form promotes the reaction [Carbon Tetrachloride results in increased expression of ACTA2 more ... CTD PMID:16774739 Agtr2 Rat tetrachloromethane increases response to substance ISO RGD:10126 6480464 AGTR2 gene mutant form results in increased susceptibility to Carbon Tetrachloride CTD PMID:16774739 Agtr2 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of AGTR2 mRNA CTD PMID:12832660 Agtr2 Rat tetrathiomolybdate(2-) decreases expression ISO RGD:619558 6480464 tetrathiomolybdate analog results in decreased expression of AGTR2 mRNA CTD PMID:19323979 Agtr2 Rat tributylstannane decreases expression ISO RGD:10126 6480464 tributyltin results in decreased expression of AGTR2 protein CTD PMID:30172001 Agtr2 Rat trichloroethene decreases expression ISO RGD:10126 6480464 Trichloroethylene results in decreased expression of AGTR2 mRNA CTD PMID:15363585 Agtr2 Rat trichostatin A multiple interactions EXP 6480464 trichostatin A inhibits the reaction [Dexamethasone results in decreased expression of AGTR2 mRNA] CTD PMID:32791177 Agtr2 Rat triclosan increases expression ISO RGD:619558 6480464 Triclosan results in increased expression of AGTR2 mRNA CTD PMID:30510588 Agtr2 Rat valproic acid decreases methylation ISO RGD:619558 6480464 Valproic Acid results in decreased methylation of AGTR2 gene CTD PMID:29154799 Agtr2 Rat valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of AGTR2 mRNA CTD PMID:35594946 Agtr2 Rat valproic acid increases expression ISO RGD:10126 6480464 Valproic Acid results in increased expression of AGTR2 mRNA CTD PMID:24896083 Agtr2 Rat valsartan affects response to substance ISO RGD:10126 6480464 AGTR2 affects the susceptibility to Valsartan CTD PMID:12215461 Agtr2 Rat valsartan multiple interactions ISO RGD:10126 6480464 Valsartan inhibits the reaction [Streptozocin results in increased expression of AGTR2 protein] CTD PMID:29266779 Agtr2 Rat valsartan increases expression EXP 6480464 Valsartan results in increased expression of AGTR2 protein CTD PMID:16982965 Agtr2 Rat valsartan decreases expression EXP 6480464 Valsartan results in decreased expression of AGTR2 mRNA CTD PMID:18403896 Agtr2 Rat valsartan multiple interactions EXP 6480464 [PD 123319 results in decreased activity of AGTR2 protein] inhibits the reaction [Valsartan results in more ... CTD PMID:11403356|PMID:16982965 Agtr2 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of AGTR2 mRNA CTD PMID:20566332 Agtr2 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of AGTR2 mRNA CTD PMID:20566332 Agtr2 Rat XL147 multiple interactions ISO RGD:10126 6480464 [N-nitroso-tris-chloroethylurea co-treated with XL147] results in decreased expression of AGTR2 mRNA CTD PMID:27935865
Imported Annotations - KEGG (archival)
(+)-pilocarpine (EXP) (R)-noradrenaline (ISO) (S)-nicotine (EXP) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3',5'-cyclic GMP (EXP) 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine (EXP) 4,4'-sulfonyldiphenol (ISO) 4-(5,6,7,8-tetrahydroimidazo[1,5-a]pyridin-5-yl)benzonitrile (EXP) 5-aza-2'-deoxycytidine (EXP) 6-propyl-2-thiouracil (EXP) 7,9-dihydro-1H-purine-2,6,8(3H)-trione (ISO) aldehydo-D-glucose (ISO) aldosterone (EXP) amlodipine (EXP) ammonium chloride (EXP) angiotensin II (EXP) benzalkonium chloride (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) cadmium dichloride (EXP) caffeine (EXP) candesartan (EXP,ISO) Candesartan cilexetil (EXP) CGP-42112A (EXP,ISO) cholesterol (EXP) cilazapril monohydrate (EXP) clofibrate (ISO) cobalt dichloride (ISO) copper atom (EXP) copper(0) (EXP) copper(II) sulfate (ISO) corticosterone (EXP) curcumin (EXP) D-glucose (ISO) dexamethasone (EXP) diethylstilbestrol (EXP) dioxygen (EXP,ISO) dopaminechrome (enol form) (EXP) doxorubicin (EXP) edaravone (EXP) enalapril (EXP) entinostat (ISO) epoxiconazole (ISO) esculetin (EXP) ethanol (EXP) ferric oxide (EXP) folic acid (ISO) fructose (EXP) genistein (EXP) glucose (ISO) glycidol (EXP) GW 3965 (EXP) hydrogen peroxide (ISO) Ile(5)-angiotensin II (EXP) lipopolysaccharide (EXP) lithium chloride (EXP) losartan (EXP,ISO) Methylthiouracil (EXP) mevinphos (EXP) mifepristone (EXP) Nandrolone decanoate (EXP) nicotine (EXP) nitric oxide (EXP) nitrofen (EXP) organophosphorus compound (EXP) p-menthan-3-ol (ISO) paraquat (ISO) PD123319 (EXP,ISO) peroxynitrous acid (EXP) phenylephrine (EXP,ISO) picrotoxin (EXP) pioglitazone (ISO) pirinixic acid (EXP) potassium bromate (ISO) reserpine (EXP) rotenone (ISO) sodium arsenite (ISO) sodium chloride (EXP) spironolactone (EXP) streptozocin (EXP,ISO) taurine (EXP) telmisartan (EXP) testosterone (EXP) tetrachloromethane (EXP,ISO) tetrathiomolybdate(2-) (ISO) tributylstannane (ISO) trichloroethene (ISO) trichostatin A (EXP) triclosan (ISO) valproic acid (EXP,ISO) valsartan (EXP,ISO) vinclozolin (EXP) XL147 (ISO)
1.
Angiotensin II type 2 receptor-bradykinin B2 receptor functional heterodimerization.
Abadir PM, etal., Hypertension. 2006 Aug;48(2):316-22. Epub 2006 Jun 5.
2.
Regulation of renal 12(S)-hydroxyeicosatetraenoic acid in diabetes by angiotensin AT1 and AT2 receptors.
Abdel-Rahman EM, etal., Am J Physiol Regul Integr Comp Physiol. 2008 Nov;295(5):R1473-8. Epub 2008 Sep 17.
3.
Candesartan cilexetil protects from cardiac myosin induced cardiotoxicity via reduction of endoplasmic reticulum stress and apoptosis in rats: involvement of ACE2-Ang (1-7)-mas axis.
Arumugam S, etal., Toxicology. 2012 Jan 27;291(1-3):139-45. doi: 10.1016/j.tox.2011.11.008. Epub 2011 Nov 23.
4.
Angiotensin II type 2 receptor deficiency aggravates renal injury and reduces survival in chronic kidney disease in mice.
Benndorf RA, etal., Kidney Int. 2009 May;75(10):1039-49. Epub 2009 Feb 11.
5.
Differential responses to salt supplementation in adult male and female rat adrenal glands following intrauterine growth restriction.
Bibeau K, etal., J Endocrinol. 2011 Apr;209(1):85-94. Epub 2011 Feb 8.
6.
Renal expression of angiotensin receptors in long-term diabetes and the effects of angiotensin type 1 receptor blockade.
Bonnet F, etal., J Hypertens. 2002 Aug;20(8):1615-24.
7.
Delineation of the intimate details of the backbone conformation of pyridine nucleotide coenzymes in aqueous solution.
Bose KS and Sarma RH, Biochem Biophys Res Commun 1975 Oct 27;66(4):1173-9.
8.
Telmisartan Prevents Alveolar Bone Loss by Decreasing the Expression of Osteoclasts Markers in Hypertensive Rats With Periodontal Disease.
Brito VGB, etal., Front Pharmacol. 2020 Nov 11;11:579926. doi: 10.3389/fphar.2020.579926. eCollection 2020.
9.
Angiotensin type 2 receptor antagonism confers renal protection in a rat model of progressive renal injury.
Cao Z, etal., J Am Soc Nephrol. 2002 Jul;13(7):1773-87.
10.
Tubular expression of angiotensin II receptors and their regulation in IgA nephropathy.
Chan LY, etal., J Am Soc Nephrol. 2005 Aug;16(8):2306-17. Epub 2005 Jun 1.
11.
Upregulation of angiotensin II receptors in reflux nephropathy.
Chertin B, etal., J Pediatr Surg. 2002 Feb;37(2):251-5.
12.
Chronic infusion of angiotensin receptor antagonists in the hypothalamic paraventricular nucleus prevents hypertension in a rat model of sleep apnea.
da Silva AQ, etal., Brain Res. 2011 Jan 12;1368:231-8. Epub 2010 Oct 30.
13.
International union of pharmacology. XXIII. The angiotensin II receptors.
de Gasparo M, etal., Pharmacol Rev. 2000 Sep;52(3):415-72.
14.
Angiotensin-2 receptors (AT1-R and AT2-R), new prognostic factors for renal clear-cell carcinoma?
Dolley-Hitze T, etal., Br J Cancer. 2010 Nov 23;103(11):1698-705.
15.
Angiotensin II, via AT1 and AT2 receptors and NF-kappaB pathway, regulates the inflammatory response in unilateral ureteral obstruction.
Esteban V, etal., J Am Soc Nephrol. 2004 Jun;15(6):1514-29.
16.
Gbeta gamma -independent constitutive association of Galpha s with SHP-1 and angiotensin II receptor AT2 is essential in AT2-mediated ITIM-independent activation of SHP-1.
Feng YH, etal., Proc Natl Acad Sci U S A 2002 Sep 17;99(19):12049-54.
17.
Angiotensin-(1-9) attenuates cardiac fibrosis in the stroke-prone spontaneously hypertensive rat via the angiotensin type 2 receptor.
Flores-Munoz M, etal., Hypertension. 2012 Feb;59(2):300-7. Epub 2011 Dec 19.
18.
Angiotensin1-9 antagonises pro-hypertrophic signalling in cardiomyocytes via the angiotensin type 2 receptor.
Flores-Munoz M, etal., J Physiol. 2011 Feb 15;589(Pt 4):939-51. Epub 2010 Dec 20.
19.
Imbalance of angiotensin type 1 receptor and angiotensin II type 2 receptor in the rostral ventrolateral medulla: potential mechanism for sympathetic overactivity in heart failure.
Gao L, etal., Hypertension. 2008 Oct;52(4):708-14. Epub 2008 Sep 2.
20.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
21.
Stimulation of AT2 receptor exerts beneficial effects in stroke-prone rats: focus on renal damage.
Gelosa P, etal., J Hypertens. 2009 Dec;27(12):2444-51.
22.
The angiotensin type 2 receptor of angiotensin II and neuronal differentiation: from observations to mechanisms.
Gendron L, etal., J Mol Endocrinol 2003 Dec;31(3):359-72.
23.
The role of the renin-angiotensin system in cholesterol and puromycin mediated renal injury.
Ghosh S, etal., Am J Med Sci. 2002 Dec;324(6):296-304.
24.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
25.
Expression and role of angiotensin II type 2 receptor in the kidney and mesangial cells of spontaneously hypertensive rats.
Goto M, etal., Hypertens Res. 2002 Jan;25(1):125-33.
26.
Implication of genetic variations in congenital obstructive nephropathy.
Hahn H, etal., Pediatr Nephrol. 2005 Nov;20(11):1541-4. Epub 2005 Aug 25.
27.
Candesartan cilexetil improves angiotensin II type 2 receptor-mediated neurite outgrowth via the PI3K-Akt pathway in fructose-induced insulin-resistant rats.
Hashikawa-Hobara N, etal., Diabetes. 2012 Apr;61(4):925-32. Epub 2012 Feb 22.
28.
Angiotensin receptor subtypes in thin and muscular juxtamedullary efferent arterioles of rat kidney.
Helou CM, etal., Am J Physiol Renal Physiol 2003 Sep;285(3):F507-14. Epub 2003 May 6.
29.
Maternal Tryptophan Supplementation Protects Adult Rat Offspring against Hypertension Programmed by Maternal Chronic Kidney Disease: Implication of Tryptophan-Metabolizing Microbiome and Aryl Hydrocarbon Receptor.
Hsu CN, etal., Int J Mol Sci. 2020 Jun 26;21(12):4552. doi: 10.3390/ijms21124552.
30.
Effects on blood pressure and exploratory behaviour of mice lacking angiotensin II type-2 receptor.
Ichiki T, etal., Nature 1995 Oct 26;377(6551):748-50.
31.
Angiotensin II AT(1) and AT(2) receptors contribute to maintain basal adrenomedullary norepinephrine synthesis and tyrosine hydroxylase transcription.
Jezova M, etal., Endocrinology 2003 May;144(5):2092-101.
32.
Angiotensin II type 2 receptor gene transfer downregulates angiotensin II type 1a receptor in vascular smooth muscle cells.
Jin XQ, etal., Hypertension 2002 May;39(5):1021-7.
33.
Cardiovascular and renal function of angiotensin II type-2 receptors.
Johren O, etal., Cardiovasc Res. 2004 Jun 1;62(3):460-7.
34.
Molecular cloning of a novel angiotensin II receptor isoform involved in phosphotyrosine phosphatase inhibition.
Kambayashi Y, etal., J Biol Chem. 1993 Nov 25;268(33):24543-6.
35.
Role of intra-renal angiotensin system activation, oxidative stress, inflammation and impaired Nrf2 activity in the progression of focal glomerulosclerosis.
Kim HJ, etal., J Pharmacol Exp Ther. 2011 Feb 25.
36.
Mechanism of Ang II involvement in activation of NF-kappaB through phosphorylation of p65 during aging.
Kim JM, etal., Age (Dordr). 2011 Feb 12.
37.
Cloning, characterization, and genetic mapping of the rat type 2 angiotensin II receptor gene.
Koike G, etal., Hypertension 1995 Dec;26(6 Pt 1):998-1002.
38.
Evidence for a functional role of angiotensin II type 2 receptor in the cardiac hypertrophic process in vivo in the rat heart.
Lako-Futo Z, etal., Circulation. 2003 Nov 11;108(19):2414-22. Epub 2003 Oct 20.
39.
Association of angiotensin converting enzyme and angiotensin type 2 receptor gene polymorphisms with renal damage in posterior urethral valves.
Laksmi NK, etal., J Pediatr Urol. 2010 Dec;6(6):560-6. Epub 2010 Feb 10.
40.
Regulation and expression of a renin-angiotensin system in human pancreas and pancreatic endocrine tumours.
Lam KY and Leung PS, Eur J Endocrinol. 2002 Apr;146(4):567-72.
41.
The involvement of angiotensin type 1 and type 2 receptors in estrogen-induced cell proliferation and vascular endothelial growth factor expression in the rat anterior pituitary.
Lawnicka H, etal., ScientificWorldJournal. 2012;2012:358102. Epub 2012 Apr 26.
42.
Upregulation of AT2 receptor and iNOS impairs angiotensin II-induced contraction without endothelium influence in young normotensive diabetic rats.
Lee JH, etal., Am J Physiol Regul Integr Comp Physiol. 2008 Jul;295(1):R144-54. Epub 2008 May 7.
43.
Neuroprotective effect of an angiotensin receptor type 2 agonist following cerebral ischemia in vitro and in vivo.
Lee S, etal., Exp Transl Stroke Med. 2012 Aug 24;4(1):16.
44.
Taurine may prevent diabetic rats from developing cardiomyopathy also by downregulating angiotensin II type2 receptor expression.
Li C, etal., Cardiovasc Drugs Ther. 2005 Mar;19(2):105-12.
45.
Hypoxic preconditioning induces an AT2-R/VEGFR-2(Flk-1) interaction in the neonatal brain microvasculature for neuroprotection.
Lopez-Aguilera F, etal., Neuroscience. 2012 Aug 2;216:1-9. Epub 2012 May 6.
46.
Angiotensin II receptor blockade inhibits pneumocyte apoptosis in experimental meconium aspiration.
Lukkarinen H, etal., Pediatr Res. 2004 Feb;55(2):326-33. Epub 2003 Nov 6.
47.
Angiotensin AT(2) receptor stimulation inhibits early renal inflammation in renovascular hypertension.
Matavelli LC, etal., Hypertension. 2011 Feb;57(2):308-13. Epub 2010 Dec 28.
48.
Angiotensin AT2 receptor stimulation causes neuroprotection in a conscious rat model of stroke.
McCarthy CA, etal., Stroke. 2009 Apr;40(4):1482-9. Epub 2009 Feb 26.
49.
Direct angiotensin II type 2 receptor stimulation decreases dopamine synthesis in the rat striatum.
Mertens B, etal., Neuropharmacology. 2010 Jun;58(7):1038-44. Epub 2010 Jan 26.
50.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
51.
Angiotensin II receptor blockade inhibits acute glomerular injuries with the alteration of receptor expression.
Mii A, etal., Lab Invest. 2009 Feb;89(2):164-77. Epub 2009 Jan 12.
52.
Distribution of angiotensin AT1 and AT2 receptor subtypes in the rat kidney.
Miyata N, etal., Am J Physiol 1999 Sep;277(3 Pt 2):F437-46.
53.
Impact of angiotensin II type 2 receptor blockade on experimental radiation nephropathy.
Moulder JE, etal., Radiat Res. 2004 Mar;161(3):312-7.
54.
Angiotensin type 2 receptor actions contribute to angiotensin type 1 receptor blocker effects on kidney fibrosis.
Naito T, etal., Am J Physiol Renal Physiol. 2010 Mar;298(3):F683-91. Epub 2009 Dec 30.
55.
Overview of in vivo xenotransplantation studies: prospects for the future.
Najarian JS Transplant Proc. 1992 Apr;24(2):733-8.
56.
No involvement of the AT2-receptor in angiotensin II-enhanced sympathetic transmission in vitro.
Nap A, etal., J Renin Angiotensin Aldosterone Syst 2003 Jun;4(2):100-5.
57.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
58.
Role of the angiotensin type 2 receptor gene in congenital anomalies of the kidney and urinary tract, CAKUT, of mice and men.
Nishimura H, etal., Mol Cell 1999 Jan;3(1):1-10.
59.
Local fetal lung renin-angiotensin system as a target to treat congenital diaphragmatic hernia.
Nogueira-Silva C, etal., Mol Med. 2012 Mar 27;18(1):231-43. doi: 10.2119/molmed.2011.00210.
60.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
61.
AT2 receptors: beneficial counter-regulatory role in cardiovascular and renal function.
Padia SH and Carey RM, Pflugers Arch. 2013 Jan;465(1):99-110. doi: 10.1007/s00424-012-1146-3. Epub 2012 Sep 5.
62.
Renal angiotensin type 2 receptors mediate natriuresis via angiotensin III in the angiotensin II type 1 receptor-blocked rat.
Padia SH, etal., Hypertension. 2006 Mar;47(3):537-44. Epub 2005 Dec 27.
63.
Angiotensin II type 2 receptors and nitric oxide sustain oxygenation in the clipped kidney of early Goldblatt hypertensive rats.
Palm F, etal., Hypertension. 2008 Feb;51(2):345-51. Epub 2007 Dec 24.
64.
Genetic variation and activity of the renin-angiotensin system and severe hypoglycemia in type 1 diabetes.
Pedersen-Bjergaard U, etal., Am J Med. 2008 Mar;121(3):246.e1-8.
65.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
66.
Angiotensin III: a central regulator of vasopressin release and blood pressure.
Reaux A, etal., Trends Endocrinol Metab. 2001 May-Jun;12(4):157-62.
67.
GOA pipeline
RGD automated data pipeline
68.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
69.
Angiotensin-converting enzyme and angiotensin type 2 receptor gene genotype distributions in Italian children with congenital uropathies.
Rigoli L, etal., Pediatr Res. 2004 Dec;56(6):988-93. Epub 2004 Oct 6.
70.
Role of the angiotensin II AT2 receptor in inflammation and oxidative stress: opposing effects in lean and obese Zucker rats.
Sabuhi R, etal., Am J Physiol Renal Physiol. 2011 Mar;300(3):F700-6. Epub 2011 Jan 5.
71.
The renin-angiotensin system contributes to renal fibrosis through regulation of fibrocytes.
Sakai N, etal., J Hypertens. 2008 Apr;26(4):780-90.
72.
Inhibition of Angiotensin II receptors during pregnancy induces malformations in developing rat kidney.
Sanchez SI, etal., Eur J Pharmacol. 2008 Jun 24;588(1):114-23. Epub 2008 Apr 9.
73.
Prenatal blockade of Ang II receptors affects neonatal rat hindbrain structure and receptor localization.
Sanchez SI, etal., Exp Neurol. 2009 Dec;220(2):246-54. Epub 2009 Aug 13.
74.
Retinal angiogenesis is mediated by an interaction between the angiotensin type 2 receptor, VEGF, and angiopoietin.
Sarlos S, etal., Am J Pathol 2003 Sep;163(3):879-87.
75.
Angiotensin II type 2 receptor-mediated inhibition of norepinephrine release in isolated rat hearts.
Sasaoka T, etal., J Cardiovasc Pharmacol. 2008 Aug;52(2):176-83.
76.
A novel angiotensin II type 2 receptor signaling pathway: possible role in cardiac hypertrophy.
Senbonmatsu T, etal., EMBO J. 2003 Dec 15;22(24):6471-82.
77.
Chronic angiotensin (1-7) injection accelerates STZ-induced diabetic renal injury.
Shao Y, etal., Acta Pharmacol Sin. 2008 Jul;29(7):829-37.
78.
Effects of dexamethasone exposure on rat metanephric development: in vitro and in vivo studies.
Singh RR, etal., Am J Physiol Renal Physiol. 2007 Aug;293(2):F548-54. Epub 2007 May 30.
79.
Receptor for AGEs (RAGE) blockade may exert its renoprotective effects in patients with diabetic nephropathy via induction of the angiotensin II type 2 (AT2) receptor.
Sourris KC, etal., Diabetologia. 2010 Nov;53(11):2442-51. Epub 2010 Jul 15.
80.
Angiotensin II type 1 receptor blockade restores angiotensin-(1-7)-induced coronary vasodilation in hypertrophic rat hearts.
Souza AP, etal., Clin Sci (Lond). 2013 Nov;125(9):449-59. doi: 10.1042/CS20120519.
81.
Angiotensin-(1-7) inhibits vascular calcification in rats.
Sui YB, etal., Peptides. 2013 Apr;42:25-34. doi: 10.1016/j.peptides.2012.12.023. Epub 2013 Jan 3.
82.
Angiotensin II type 2 receptor is upregulated in human heart with interstitial fibrosis, and cardiac fibroblasts are the major cell type for its expression.
Tsutsumi Y, etal., Circ Res. 1998 Nov 16;83(10):1035-46.
83.
Blood pressure and renal hemodynamic responses to acute angiotensin II infusion are enhanced in a female mouse model of systemic lupus erythematosus.
Venegas-Pont M, etal., Am J Physiol Regul Integr Comp Physiol. 2011 Nov;301(5):R1286-92. Epub 2011 Sep 7.
84.
AGTR2 mutations in X-linked mental retardation.
Vervoort VS, etal., Science 2002 Jun 28;296(5577):2401-3.
85.
Effect of valsartan on the expression of angiotensin II receptors in the lung of chronic antigen exposure rats.
Wang T, etal., Chin Med J (Engl). 2008 Nov 20;121(22):2312-9.
86.
Angiotensin II type 2 receptor antagonist reduces bleomycin-induced pulmonary fibrosis in mice.
Waseda Y, etal., Respir Res. 2008 May 23;9:43.
87.
Angiotensin II's antiproliferative effects mediated through AT2-receptors depend on down-regulation of SM-20.
Wolf G, etal., Lab Invest 2002 Oct;82(10):1305-17.
88.
Time-dependent expression of renal vaso-regulatory molecules in LPS-induced endotoxemia in rat.
Yamaguchi N, etal., Peptides. 2006 Sep;27(9):2258-70. Epub 2006 May 24.
89.
Angiotensin II type 2 receptor gene is not responsible for familial vesicoureteral reflux.
Yoneda A, etal., J Urol. 2002 Sep;168(3):1138-41.
90.
Association of angiotensin II type 2 receptor gene A1818T polymorphism with progression of immunoglobulin A nephropathy in Korean patients.
Yoon HJ, etal., J Korean Med Sci. 2009 Jan;24 Suppl:S38-43. Epub 2009 Jan 28.
91.
Deletion of the angiotensin type 2 receptor (AT2R) reduces adipose cell size and protects from diet-induced obesity and insulin resistance.
Yvan-Charvet L, etal., Diabetes. 2005 Apr;54(4):991-9.
92.
[Angiotensin II type 2 receptors participate in the regulation of inflammatory cytokine secretion in adult rat hypertrophied cardiomyocytes].
Zhou J, etal., Nan Fang Yi Ke Da Xue Xue Bao. 2008 Nov;28(11):1971-3.
93.
Regulation of angiotensin-(1-7) and angiotensin II type 1 receptor by telmisartan and losartan in adriamycin-induced rat heart failure.
Zong WN, etal., Acta Pharmacol Sin. 2011 Nov;32(11):1345-50. doi: 10.1038/aps.2011.96. Epub 2011 Oct 3.
Agtr2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 116,914,320 - 116,918,504 (+) NCBI GRCr8 mRatBN7.2 X 112,119,876 - 112,124,060 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 112,120,228 - 112,124,057 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 114,138,672 - 114,139,763 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 117,629,475 - 117,630,566 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 115,194,251 - 115,195,342 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 119,389,480 - 119,393,845 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 119,390,013 - 119,393,842 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 119,534,483 - 119,538,667 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Celera X 111,375,374 - 111,376,465 (+) NCBI Celera Cytogenetic Map X q34 NCBI
AGTR2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 X 116,170,744 - 116,174,974 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl X 116,170,744 - 116,174,974 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 X 115,301,997 - 115,306,227 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 X 115,215,986 - 115,220,253 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 X 115,113,884 - 115,117,702 NCBI Celera X 115,832,555 - 115,836,822 (-) NCBI Celera Cytogenetic Map X q23 NCBI HuRef X 104,838,955 - 104,843,260 (+) NCBI HuRef CHM1_1 X 115,212,791 - 115,217,059 (+) NCBI CHM1_1 T2T-CHM13v2.0 X 114,580,328 - 114,584,558 (+) NCBI T2T-CHM13v2.0
Agtr2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 X 21,350,863 - 21,355,072 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl X 21,350,783 - 21,355,403 (+) Ensembl GRCm39 Ensembl GRCm38 X 21,484,624 - 21,488,833 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl X 21,484,544 - 21,489,164 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 X 21,061,752 - 21,065,957 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 X 20,641,585 - 20,646,123 (+) NCBI MGSCv36 mm8 Celera X 19,607,387 - 19,611,593 (+) NCBI Celera Cytogenetic Map X A2 NCBI cM Map X 16.71 NCBI
Agtr2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955534 3,653,157 - 3,654,248 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955534 3,653,112 - 3,654,248 (-) NCBI ChiLan1.0 ChiLan1.0
AGTR2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 X 115,602,235 - 115,606,464 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 X 115,605,843 - 115,610,072 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 X 105,252,903 - 105,257,171 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 X 115,670,022 - 115,674,287 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl X 115,671,594 - 115,672,685 (+) Ensembl panpan1.1 panPan2
AGTR2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 X 88,703,551 - 88,708,451 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl X 88,705,765 - 88,706,853 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha X 74,841,362 - 74,845,718 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 X 90,431,596 - 90,435,944 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl X 90,433,258 - 90,434,346 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 X 87,892,846 - 87,897,203 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 X 89,651,006 - 89,655,363 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 X 89,385,692 - 89,390,050 (+) NCBI UU_Cfam_GSD_1.0
Agtr2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 X 87,731,904 - 87,736,189 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936479 13,252,678 - 13,255,570 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936479 13,252,678 - 13,255,570 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
AGTR2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl X 95,269,300 - 95,270,388 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 X 95,267,709 - 95,272,237 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 X 109,822,530 - 109,826,739 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
AGTR2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Vero_WHO_p1.0 NW_023666065 28,955,602 - 28,958,335 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Agtr2
.
Predicted Target Of
Count of predictions: 500 Count of miRNA genes: 264 Interacting mature miRNAs: 323 Transcripts: ENSRNOT00000074269 Prediction methods: Microtar, Miranda, Pita, Rnahybrid, Targetscan Result types: miRGate_prediction
1598872 Memor14 Memory QTL 14 4.5 exploratory behavior trait (VT:0010471) difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678) X 93956491 138956491 Rat 1598856 Memor1 Memory QTL 1 1.9 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) X 103312877 148312877 Rat 1598809 Memor15 Memory QTL 15 4.4 exploratory behavior trait (VT:0010471) difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678) X 103312877 148312877 Rat 738025 Stresp3 Stress response QTL 3 4.61 0.0066 stress-related behavior trait (VT:0010451) defensive burying - approach X 100567703 150256146 Rat 61430 Cia18 Collagen induced arthritis QTL 18 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) X 14843113 120568734 Rat 61431 Cia19 Collagen induced arthritis QTL 19 4.4 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) X 65612192 120568734 Rat 738035 Stresp1 Stress response QTL 1 4.96 0.000011 stress-related behavior trait (VT:0010451) defensive burying - coping X 41304447 112935181 Rat 724551 Glom1 Glomerulus QTL 1 2.8 0.0004 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) X 75294106 120294106 Rat 1598837 Memor13 Memory QTL 13 3.2 exploratory behavior trait (VT:0010471) difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678) X 41052407 146860749 Rat
DXWox27
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 X 112,133,718 - 112,133,852 (+) MAPPER mRatBN7.2 Rnor_6.0 X 119,403,504 - 119,403,637 NCBI Rnor6.0 Rnor_5.0 X 119,548,326 - 119,548,459 UniSTS Rnor5.0 Celera X 111,387,746 - 111,387,873 UniSTS Cytogenetic Map X q34 UniSTS
DXMgh7
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 X 112,124,540 - 112,124,758 (+) MAPPER mRatBN7.2 mRatBN7.2 12 33,819,167 - 33,819,400 (+) MAPPER mRatBN7.2 Rnor_6.0 12 39,282,339 - 39,282,571 NCBI Rnor6.0 Rnor_6.0 X 119,394,326 - 119,394,543 NCBI Rnor6.0 Rnor_5.0 12 41,171,094 - 41,171,326 UniSTS Rnor5.0 Rnor_5.0 X 119,539,148 - 119,539,365 UniSTS Rnor5.0 RGSC_v3.4 12 34,918,461 - 34,918,693 UniSTS RGSC3.4 Celera X 111,378,557 - 111,378,785 UniSTS Celera 12 35,496,132 - 35,496,364 UniSTS SHRSP x BN Map X 33.1599 UniSTS SHRSP x BN Map X 33.1599 RGD FHH x ACI Map X 34.6 RGD Cytogenetic Map 12 q16 UniSTS Cytogenetic Map X q34 UniSTS
AW107640
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 X 112,123,581 - 112,123,668 (+) MAPPER mRatBN7.2 Rnor_6.0 X 119,393,367 - 119,393,453 NCBI Rnor6.0 Rnor_5.0 X 119,538,189 - 119,538,275 UniSTS Rnor5.0 Celera X 111,377,598 - 111,377,684 UniSTS Cytogenetic Map X q34 UniSTS
RH139933
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 X 112,123,527 - 112,123,728 (+) MAPPER mRatBN7.2 Rnor_6.0 X 119,393,313 - 119,393,513 NCBI Rnor6.0 Rnor_5.0 X 119,538,135 - 119,538,335 UniSTS Rnor5.0 Celera X 111,377,544 - 111,377,744 UniSTS RH 3.4 Map 1 1474.2 UniSTS Cytogenetic Map X q34 UniSTS
PMC153509P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 X 112,121,846 - 112,122,128 (+) MAPPER mRatBN7.2 Rnor_6.0 X 119,391,632 - 119,391,913 NCBI Rnor6.0 Rnor_5.0 X 119,536,454 - 119,536,735 UniSTS Rnor5.0 Celera X 111,375,863 - 111,376,144 UniSTS Cytogenetic Map X q34 UniSTS
Agtr2
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 X 112,122,316 - 112,122,397 (+) MAPPER mRatBN7.2 Rnor_6.0 X 119,392,102 - 119,392,182 NCBI Rnor6.0 Rnor_5.0 X 119,536,924 - 119,537,004 UniSTS Rnor5.0 Celera X 111,376,333 - 111,376,413 UniSTS Cytogenetic Map X q34 UniSTS
UniSTS:496533
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 X 112,121,421 - 112,122,383 (+) MAPPER mRatBN7.2 Rnor_6.0 X 119,391,207 - 119,392,168 NCBI Rnor6.0 Rnor_5.0 X 119,536,029 - 119,536,990 UniSTS Rnor5.0 Celera X 111,375,438 - 111,376,399 UniSTS Cytogenetic Map X q34 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
7
25
106
58
58
27
19
27
6
142
64
86
35
53
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000074269 ⟹ ENSRNOP00000064709
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 112,120,228 - 112,124,057 (+) Ensembl Rnor_6.0 Ensembl X 119,390,013 - 119,393,842 (+) Ensembl
RefSeq Acc Id:
NM_012494 ⟹ NP_036626
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 116,914,320 - 116,918,504 (+) NCBI mRatBN7.2 X 112,119,876 - 112,124,060 (+) NCBI Rnor_6.0 X 119,391,143 - 119,392,234 (+) NCBI Rnor_5.0 X 119,534,483 - 119,538,667 (+) NCBI Celera X 111,375,374 - 111,376,465 (+) RGD
Sequence:
ATGAAGGACAACTTCAGTTTTGCTGCCACCAGCAGAAACATCACCAGCAGTCTTCCTTTTGATAATCTCAACGCAACTGGCACCAATGAGTCCGCATTTAACTGCTCACACAAACCGGCAGATAAGCA
hide sequence
RefSeq Acc Id:
XM_063279775 ⟹ XP_063135845
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 116,914,384 - 116,918,504 (+) NCBI
RefSeq Acc Id:
NP_036626 ⟸ NM_012494
- UniProtKB:
P35351 (UniProtKB/Swiss-Prot), B1WBL8 (UniProtKB/TrEMBL)
- Sequence:
MKDNFSFAATSRNITSSLPFDNLNATGTNESAFNCSHKPADKHLEAIPVLYYMIFVIGFAVNIVVVSLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVFGSFLTLNM
hide sequence
Ensembl Acc Id:
ENSRNOP00000064709 ⟸ ENSRNOT00000074269
RefSeq Acc Id:
XP_063135845 ⟸ XM_063279775
- Peptide Label:
isoform X1
- UniProtKB:
P35351 (UniProtKB/Swiss-Prot), B1WBL8 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2003-04-09
Agtr2
angiotensin II receptor, type 2
Angiotensin receptor 2
Name updated
629478 APPROVED
2002-06-10
Agtr2
Angiotensin receptor 2
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_domains
contains an immunoreceptor tyrosine-based inhibitory (ITIM)-like motif (VIYPFL) in the cytoplasmic loop domain
625596
gene_expression
expressed throughout the rat kidney
1357917
gene_expression
expressed at high levels during the later stage of fetal development and in the neonate, but declines rapidly after birth
70604
gene_expression
abundant in model of retinopathy of prematurity
1298608
gene_expression
expressed in muscular and thin arterioles
1298648
gene_function
binds to angiotensin II to facilitate arteriole vascular tone
1298648
gene_mutations_overexpression
overexpression inhibits Agtr1 expression in vascular smooth muscle cells (VSMCs)
70604
gene_pathway
retinal angiogenesis actions may converge on VEGF- and angiopoietin-dependent pathways
1298608
gene_process
regulates growth and metabolism in vascular smooth muscle cells
70604
gene_process
regulates growth and metabolism in vascular smooth muscle cells
625596
gene_process
plays a role in regulating SHP-1 activity when constitutively associated with Gs and SHP-1
625596
gene_process
exerts antiproliferative effect in endothelial and vascular smooth muscle cells
1298575
gene_process
plays a role in pressure natriuresis
1298575
gene_process
does not play a role in angiotensin I-mediated sympathetic neurotransmission by angiotensin II molecule
1298649
gene_process
induces vasodilation
1298648
gene_product
belongs to the family of seven-transmembrane G protein-coupled receptors
70604
