Symbol:
Actg2
Name:
actin gamma 2, smooth muscle
RGD ID:
2027
Description:
Predicted to enable ATP binding activity; hydrolase activity; and protein kinase binding activity. Predicted to be involved in mesenchyme migration and positive regulation of gene expression. Predicted to be located in several cellular components, including filopodium; lamellipodium; and myosin filament. Predicted to be part of protein-containing complex. Predicted to be active in actin cytoskeleton. Human ortholog(s) of this gene implicated in megacystis-microcolon-intestinal hypoperistalsis syndrome. Orthologous to human ACTG2 (actin gamma 2, smooth muscle); INTERACTS WITH 1,2-dimethylhydrazine; 17alpha-ethynylestradiol; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
ACTGE; Actin gamma 2 smooth muscle enteric; actin, gamma 2; actin, gamma 2, smooth muscle, enteric; actin, gamma-enteric smooth muscle; alpha-actin-3; alpha-smooth muscle actin; gamma-2-actin; gamma-enteric smooth muscle actin; MGC105507; SMGA; smooth muscle gamma-actin
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ACTG2 (actin gamma 2, smooth muscle)
HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, Panther, PhylomeDB
Mus musculus (house mouse):
Actg2 (actin, gamma 2, smooth muscle, enteric)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Actg2 (actin gamma 2, smooth muscle)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ACTG2 (actin gamma 2, smooth muscle)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ACTG2 (actin gamma 2, smooth muscle)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Actg2 (actin gamma 2, smooth muscle)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ACTG2 (actin gamma 2, smooth muscle)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ACTG2 (actin gamma 2, smooth muscle)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Actg2 (actin gamma 2, smooth muscle)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Actg2 (actin, gamma 2, smooth muscle, enteric)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
ACTG2 (actin gamma 2, smooth muscle)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
ACT1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
acta2
Alliance
DIOPT (OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 117,579,513 - 117,604,379 (-) NCBI GRCr8 mRatBN7.2 4 116,021,832 - 116,046,475 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 116,021,832 - 116,046,465 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 121,500,276 - 121,514,993 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 117,275,441 - 117,290,158 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 115,889,059 - 115,903,778 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 115,215,160 - 115,239,746 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 115,215,060 - 115,239,723 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 179,805,782 - 179,830,362 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 117,732,482 - 117,747,006 NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 4 105,015,569 - 105,030,100 (-) NCBI Celera Cytogenetic Map 4 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Actg2 Rat autosomal dominant familial visceral neuropathy ISO RGD:737318 8554872 ClinVar Annotator: match by term: Pseudoobstruction idiopathic intestinal | ClinVar Annotator: match by term: Visceral more ... ClinVar PMID:11474115|PMID:21681106|PMID:22960657|PMID:23806086|PMID:24088041|PMID:24337657|PMID:24676022|PMID:24777424|PMID:25326635|PMID:25741868|PMID:25998219|PMID:26072522|PMID:26647307|PMID:26813947|PMID:26938784|PMID:27481187|PMID:28422808|PMID:29387497|PMID:29608093|PMID:29781137|PMID:31769566|PMID:32814715|PMID:33294969 Actg2 Rat congenital disorder of glycosylation type IIb ISO RGD:737318 8554872 ClinVar Annotator: match by term: Congenital disorder of glycosylation type 2B ClinVar PMID:24716661|PMID:25531304|PMID:26805780|PMID:27208207|PMID:27696117|PMID:28492532 Actg2 Rat Constipation ISO RGD:737318 8554872 ClinVar Annotator: match by term: Constipation ClinVar PMID:23806086|PMID:24088041|PMID:24676022|PMID:25326635|PMID:25741868|PMID:26072522|PMID:26647307|PMID:28422808|PMID:29781137|PMID:31769566|PMID:33294969 Actg2 Rat dystonia ISO RGD:737318 8554872 ClinVar Annotator: match by term: Dystonia ClinVar PMID:16697227|PMID:16752391|PMID:22522443|PMID:23542699|PMID:28492532|PMID:30682498 Actg2 Rat genetic disease ISO RGD:737318 8554872 ClinVar Annotator: match by term: Inborn genetic diseases ClinVar PMID:11474115|PMID:23806086|PMID:24088041|PMID:24337657|PMID:24676022|PMID:25741868|PMID:25998219|PMID:26072522|PMID:26647307|PMID:26813947|PMID:27481187|PMID:28422808|PMID:29781137|PMID:31769566|PMID:32814715|PMID:33294969 Actg2 Rat intestinal obstruction ISO RGD:737318 8554872 ClinVar Annotator: match by term: Intestinal obstruction ClinVar PMID:22960657|PMID:24777424|PMID:25741868|PMID:29781137 Actg2 Rat intestinal pseudo-obstruction ISO RGD:737318 8554872 ClinVar Annotator: match by term: Chronic intestinal pseudoobstruction | ClinVar Annotator: match by term: Intestinal more ... ClinVar PMID:11474115|PMID:21681106|PMID:22960657|PMID:23806086|PMID:24088041|PMID:24337657|PMID:24676022|PMID:24777424|PMID:25326635|PMID:25741868|PMID:25998219|PMID:26072522|PMID:26647307|PMID:26813947|PMID:26938784|PMID:27481187|PMID:28422808|PMID:29387497|PMID:29608093|PMID:29781137|PMID:31769566|PMID:32814715|PMID:33294969 Actg2 Rat megacystis-microcolon-intestinal hypoperistalsis syndrome ISO RGD:737318 8554872 ClinVar Annotator: match by term: Infantile visceral myopathy | ClinVar Annotator: match by term: Megacystis-microcolon-intestinal more ... ClinVar PMID:11474115|PMID:21681106|PMID:22960657|PMID:23806086|PMID:24088041|PMID:24337657|PMID:24676022|PMID:24777424|PMID:25326635|PMID:25741868|PMID:25998219|PMID:26072522|PMID:26647307|PMID:26813947|PMID:26938784|PMID:27481187|PMID:28422808|PMID:29387497|PMID:29608093|PMID:29781137|PMID:30019982|PMID:31769566|PMID:32814715|PMID:33294969 Actg2 Rat Megacystis-Microcolon-Intestinal Hypoperistalsis Syndrome 5 ISO RGD:737318 8554872 ClinVar Annotator: match by term: ACTG2-related condition | ClinVar Annotator: match by term: Megacystis-microcolon-intestinal hypoperistalsis more ... ClinVar PMID:11474115|PMID:22960657|PMID:23806086|PMID:24088041|PMID:24337657|PMID:24676022|PMID:25326635|PMID:25741868|PMID:25998219|PMID:26072522|PMID:26647307|PMID:26813947|PMID:26938784|PMID:27481187|PMID:28422808|PMID:28492532|PMID:29608093|PMID:29781137|PMID:31769566|PMID:32814715|PMID:33294969 Actg2 Rat Megaduodenum ISO RGD:737318 8554872 ClinVar Annotator: match by term: Megacystis ClinVar PMID:23806086|PMID:24088041|PMID:24337657|PMID:24676022|PMID:25741868|PMID:25998219|PMID:26072522|PMID:26647307|PMID:26813947|PMID:27481187|PMID:28422808|PMID:29781137|PMID:31769566|PMID:32814715|PMID:33294969 Actg2 Rat Methylmalonyl-CoA Epimerase Deficiency ISO RGD:737318 8554872 ClinVar Annotator: match by term: METHYLMALONIC ACIDURIA III ClinVar PMID:16697227|PMID:16752391|PMID:22522443|PMID:23542699|PMID:28492532|PMID:30682498
Only show annotations with direct experimental evidence (0 objects hidden)
Actg2 Rat 1,2-dimethylhydrazine multiple interactions EXP 6480464 [APC protein affects the susceptibility to 1,2-Dimethylhydrazine] which results in increased expression of ACTG2 mRNA CTD PMID:27840820 Actg2 Rat 1,2-dimethylhydrazine increases expression ISO RGD:10077 6480464 1,2-Dimethylhydrazine results in increased expression of ACTG2 mRNA CTD PMID:22206623 Actg2 Rat 1,2-dimethylhydrazine multiple interactions ISO RGD:10077 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of ACTG2 mRNA CTD PMID:22206623 Actg2 Rat 17alpha-ethynylestradiol increases expression ISO RGD:10077 6480464 Ethinyl Estradiol results in increased expression of ACTG2 mRNA CTD PMID:17942748 Actg2 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of ACTG2 mRNA CTD PMID:12655037|PMID:15576828 Actg2 Rat 17alpha-ethynylestradiol multiple interactions ISO RGD:10077 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of ACTG2 mRNA CTD PMID:17942748 Actg2 Rat 17beta-estradiol decreases expression ISO RGD:737318 6480464 Estradiol results in decreased expression of ACTG2 mRNA CTD PMID:25878060 Actg2 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of ACTG2 mRNA CTD PMID:32145629 Actg2 Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of ACTG2 mRNA CTD PMID:26496021 Actg2 Rat 2,2',5,5'-tetrachlorobiphenyl decreases expression ISO RGD:737318 6480464 2,5,2',5'-tetrachlorobiphenyl analog results in decreased expression of ACTG2 mRNA CTD PMID:36804509 Actg2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:10077 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of ACTG2 mRNA CTD PMID:17942748 Actg2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of ACTG2 mRNA CTD PMID:32109520|PMID:34747641 Actg2 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2,3,7,8-tetrachlorodibenzofuran results in decreased expression of ACTG2 mRNA CTD PMID:32109520 Actg2 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether decreases expression ISO RGD:10077 6480464 2,2',4,4',5-brominated diphenyl ether results in decreased expression of ACTG2 protein CTD PMID:18550172 Actg2 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether increases expression ISO RGD:10077 6480464 2,2',4,4',5-brominated diphenyl ether results in increased expression of ACTG2 protein CTD PMID:18550172 Actg2 Rat 2-nitrotoluene decreases expression EXP 6480464 2-nitrotoluene results in decreased expression of ACTG2 mRNA CTD PMID:16460773 Actg2 Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3,4,5,3',4'-pentachlorobiphenyl results in decreased expression of ACTG2 mRNA CTD PMID:32119087 Actg2 Rat 3,7-dihydropurine-6-thione decreases expression EXP 6480464 Mercaptopurine results in decreased expression of ACTG2 mRNA CTD PMID:23358152 Actg2 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RGD:10077 6480464 [Dexamethasone co-treated with rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in decreased expression more ... CTD PMID:16054899 Actg2 Rat 4,4'-sulfonyldiphenol multiple interactions ISO RGD:10077 6480464 [bisphenol S co-treated with Tretinoin] results in decreased expression of ACTG2 mRNA CTD PMID:30951980 Actg2 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:10077 6480464 bisphenol S results in increased expression of ACTG2 mRNA CTD PMID:30951980 Actg2 Rat 5-fluorouracil decreases expression ISO RGD:737318 6480464 Fluorouracil results in decreased expression of ACTG2 mRNA CTD PMID:16709241 Actg2 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of ACTG2 mRNA CTD PMID:24780913 Actg2 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of ACTG2 mRNA CTD PMID:30047161 Actg2 Rat 7,12-dimethyltetraphene increases expression EXP 6480464 9,10-Dimethyl-1,2-benzanthracene results in increased expression of ACTG2 mRNA CTD PMID:19480007 Actg2 Rat 9-cis-retinoic acid decreases expression EXP 6480464 Alitretinoin results in decreased expression of ACTG2 protein CTD PMID:16043492 Actg2 Rat acetaldehyde multiple interactions EXP 598108049 IL6 antibody inhibited the reaction [[Leptin cotreatment with acetaldehyde] increased expression of aSMA mRNA and more ... RGD Actg2 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of ACTG2 mRNA CTD PMID:31881176 Actg2 Rat all-trans-retinoic acid decreases expression EXP 6480464 Tretinoin results in decreased expression of ACTG2 protein CTD PMID:16043492 Actg2 Rat all-trans-retinoic acid multiple interactions ISO RGD:10077 6480464 [bisphenol A co-treated with Tretinoin] results in decreased expression of ACTG2 mRNA; [bisphenol F co-treated more ... CTD PMID:30951980 Actg2 Rat all-trans-retinoic acid increases expression ISO RGD:737318 6480464 Tretinoin results in increased expression of ACTG2 mRNA CTD PMID:15894607 Actg2 Rat all-trans-retinoic acid multiple interactions ISO RGD:737318 6480464 [Tretinoin co-treated with arsenic trioxide] results in increased expression of ACTG2 mRNA CTD PMID:15894607 Actg2 Rat all-trans-retinol decreases expression EXP 6480464 Vitamin A results in decreased expression of ACTG2 protein CTD PMID:16043492 Actg2 Rat all-trans-retinol multiple interactions EXP 6480464 Vitamin A results in decreased expression of [Ethanol results in increased expression of ACTG2 protein] CTD PMID:16043492 Actg2 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of ACTG2 mRNA CTD PMID:30047161 Actg2 Rat arsenite(3-) increases expression ISO RGD:10077 6480464 arsenite results in increased expression of ACTG2 mRNA CTD PMID:18296743 Actg2 Rat arsenite(3-) multiple interactions ISO RGD:10077 6480464 Dietary Fats promotes the reaction [arsenite results in increased expression of ACTG2 mRNA] CTD PMID:18296743 Actg2 Rat arsenous acid increases expression ISO RGD:737318 6480464 Arsenic Trioxide results in increased expression of ACTG2 mRNA CTD PMID:15894607 Actg2 Rat arsenous acid multiple interactions ISO RGD:737318 6480464 [Tretinoin co-treated with Arsenic Trioxide] results in increased expression of ACTG2 mRNA CTD PMID:15894607 Actg2 Rat benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of ACTG2 mRNA CTD PMID:21839799 Actg2 Rat benzo[a]pyrene affects methylation ISO RGD:737318 6480464 Benzo(a)pyrene affects the methylation of ACTG2 5' UTR; Benzo(a)pyrene affects the methylation of ACTG2 promoter CTD PMID:27901495 Actg2 Rat benzo[a]pyrene increases expression ISO RGD:10077 6480464 Benzo(a)pyrene results in increased expression of ACTG2 mRNA CTD PMID:22228805 Actg2 Rat benzo[a]pyrene decreases expression ISO RGD:10077 6480464 Benzo(a)pyrene results in decreased expression of ACTG2 mRNA CTD PMID:20713471 Actg2 Rat bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate] affects the methylation of ACTG2 more ... CTD PMID:23359474 Actg2 Rat bis(2-ethylhexyl) phthalate increases expression ISO RGD:737318 6480464 Diethylhexyl Phthalate results in increased expression of ACTG2 mRNA CTD PMID:31163220 Actg2 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate] affects the methylation of ACTG2 more ... CTD PMID:23359474|PMID:26496021 Actg2 Rat bisphenol A decreases expression ISO RGD:10077 6480464 bisphenol A results in decreased expression of ACTG2 mRNA CTD PMID:37105096 Actg2 Rat bisphenol A increases expression ISO RGD:10077 6480464 bisphenol A results in increased expression of ACTG2 mRNA CTD PMID:30951980 Actg2 Rat bisphenol A decreases expression ISO RGD:737318 6480464 bisphenol A results in decreased expression of ACTG2 mRNA CTD PMID:29275510 Actg2 Rat bisphenol A multiple interactions ISO RGD:10077 6480464 [bisphenol A co-treated with Tretinoin] results in decreased expression of ACTG2 mRNA CTD PMID:30951980 Actg2 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of ACTG2 gene CTD PMID:28505145 Actg2 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of ACTG2 mRNA CTD PMID:25181051 Actg2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ACTG2 mRNA CTD PMID:24134786|PMID:32145629 Actg2 Rat bisphenol F multiple interactions ISO RGD:10077 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of ACTG2 mRNA CTD PMID:30951980 Actg2 Rat bisphenol F decreases expression ISO RGD:10077 6480464 bisphenol F results in decreased expression of ACTG2 mRNA CTD PMID:38685157 Actg2 Rat bisphenol F increases expression ISO RGD:10077 6480464 bisphenol F results in increased expression of ACTG2 mRNA CTD PMID:30951980 Actg2 Rat bromochloroacetic acid decreases expression EXP 6480464 bromochloroacetic acid results in decreased expression of ACTG2 mRNA CTD PMID:16460773 Actg2 Rat butanal increases expression ISO RGD:737318 6480464 butyraldehyde results in increased expression of ACTG2 mRNA CTD PMID:26079696 Actg2 Rat cadmium acetate decreases expression ISO RGD:737318 6480464 cadmium acetate results in decreased expression of ACTG2 mRNA CTD PMID:18155341 Actg2 Rat cadmium atom increases expression ISO RGD:737318 6480464 Cadmium results in increased expression of ACTG2 mRNA CTD PMID:24376830 Actg2 Rat cadmium atom multiple interactions ISO RGD:10077 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of ACTG2 more ... CTD PMID:37325564 Actg2 Rat cadmium atom multiple interactions ISO RGD:737318 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of ACTG2 more ... CTD PMID:35301059 Actg2 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of ACTG2 mRNA CTD PMID:21297351 Actg2 Rat cadmium dichloride multiple interactions ISO RGD:10077 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of ACTG2 more ... CTD PMID:37325564 Actg2 Rat cadmium dichloride multiple interactions ISO RGD:737318 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of ACTG2 more ... CTD PMID:35301059 Actg2 Rat calcitriol multiple interactions ISO RGD:737318 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of ACTG2 mRNA CTD PMID:21592394 Actg2 Rat calcitriol increases expression ISO RGD:737318 6480464 Calcitriol results in increased expression of ACTG2 mRNA CTD PMID:21592394|PMID:26485663 Actg2 Rat carbamazepine affects expression ISO RGD:737318 6480464 Carbamazepine affects the expression of ACTG2 mRNA CTD PMID:25979313 Actg2 Rat carbon nanotube affects expression ISO RGD:10077 6480464 Nanotubes, Carbon affects the expression of ACTG2 mRNA CTD PMID:25554681 Actg2 Rat carbon nanotube decreases expression ISO RGD:10077 6480464 Nanotubes, Carbon analog results in decreased expression of ACTG2 mRNA CTD PMID:25620056 Actg2 Rat carbon nanotube increases expression ISO RGD:10077 6480464 Nanotubes, Carbon analog results in increased expression of ACTG2 mRNA CTD PMID:25554681 Actg2 Rat carmustine decreases expression ISO RGD:737318 6480464 Carmustine results in decreased expression of ACTG2 mRNA CTD PMID:15980968 Actg2 Rat chromium(6+) multiple interactions ISO RGD:737318 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in decreased expression more ... CTD PMID:38479592 Actg2 Rat cocaine decreases expression ISO RGD:737318 6480464 Cocaine results in decreased expression of ACTG2 mRNA CTD PMID:20948987 Actg2 Rat copper atom decreases expression EXP 6480464 Copper results in decreased expression of ACTG2 mRNA CTD PMID:30556269 Actg2 Rat copper(0) decreases expression EXP 6480464 Copper results in decreased expression of ACTG2 mRNA CTD PMID:30556269 Actg2 Rat copper(II) sulfate increases expression ISO RGD:737318 6480464 Copper Sulfate results in increased expression of ACTG2 mRNA CTD PMID:19549813 Actg2 Rat corticosterone increases expression EXP 6480464 Corticosterone results in increased expression of ACTG2 mRNA CTD PMID:15755911 Actg2 Rat cyclosporin A increases expression ISO RGD:737318 6480464 Cyclosporine results in increased expression of ACTG2 mRNA CTD PMID:25562108 Actg2 Rat DDT increases expression EXP 6480464 DDT results in increased expression of ACTG2 mRNA CTD PMID:30207508 Actg2 Rat dexamethasone multiple interactions ISO RGD:10077 6480464 [Dexamethasone co-treated with rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in decreased expression more ... CTD PMID:16054899 Actg2 Rat dexamethasone increases expression ISO RGD:10077 6480464 Dexamethasone results in increased expression of ACTG2 mRNA CTD PMID:22733784 Actg2 Rat diarsenic trioxide increases expression ISO RGD:737318 6480464 Arsenic Trioxide results in increased expression of ACTG2 mRNA CTD PMID:15894607 Actg2 Rat diarsenic trioxide multiple interactions ISO RGD:737318 6480464 [Tretinoin co-treated with Arsenic Trioxide] results in increased expression of ACTG2 mRNA CTD PMID:15894607 Actg2 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of ACTG2 mRNA CTD PMID:21266533 Actg2 Rat dibutyl phthalate multiple interactions EXP 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate] affects the methylation of ACTG2 more ... CTD PMID:23359474 Actg2 Rat dibutyl phthalate increases expression ISO RGD:10077 6480464 Dibutyl Phthalate results in increased expression of ACTG2 mRNA CTD PMID:17361019|PMID:21266533 Actg2 Rat diethylcarbamazine multiple interactions EXP 598130086 diethylcarbamazine inhibits the reaction [ethanol increases expression of alpha SMA protein in liver parenchyma] RGD Actg2 Rat diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of ACTG2 mRNA CTD PMID:21658437 Actg2 Rat diethylstilbestrol increases expression ISO RGD:737318 6480464 Diethylstilbestrol results in increased expression of ACTG2 mRNA CTD PMID:36621641 Actg2 Rat dioxygen increases expression EXP 6480464 Oxygen results in increased expression of ACTG2 mRNA CTD PMID:22911455 Actg2 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of ACTG2 mRNA CTD PMID:21551480 Actg2 Rat diuron increases expression EXP 6480464 Diuron results in increased expression of ACTG2 mRNA CTD PMID:21551480 Actg2 Rat doramapimod increases expression EXP 6480464 doramapimod results in increased expression of ACTG2 mRNA CTD PMID:24303162 Actg2 Rat dorsomorphin multiple interactions ISO RGD:737318 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Actg2 Rat ethanol multiple interactions EXP 6480464 Vitamin A results in decreased expression of [Ethanol results in increased expression of ACTG2 protein] CTD PMID:16043492 Actg2 Rat ethanol increases expression EXP 598130086 ethanol increases expression of alpha-SMA protein in liver parenchyma RGD Actg2 Rat ethanol increases expression EXP 6480464 Ethanol results in increased expression of ACTG2 protein CTD PMID:16043492 Actg2 Rat fipronil increases expression EXP 6480464 fipronil results in increased expression of ACTG2 mRNA CTD PMID:34044035 Actg2 Rat folic acid multiple interactions ISO RGD:10077 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of ACTG2 mRNA CTD PMID:22206623 Actg2 Rat genistein decreases expression ISO RGD:737318 6480464 Genistein results in decreased expression of ACTG2 mRNA CTD PMID:22228119 Actg2 Rat glyphosate affects expression ISO RGD:10077 6480464 Glyphosate affects the expression of ACTG2 protein CTD PMID:20045496 Actg2 Rat Heliotrine decreases expression EXP 6480464 heliotrine results in decreased expression of ACTG2 mRNA CTD PMID:34185104 Actg2 Rat hesperidin multiple interactions EXP 598130086 hesperidin inhibits the reaction [ethanol increases expression of alpha SMA protein in liver parenchyma] RGD Actg2 Rat hyaluronic acid decreases expression EXP 6480464 Hyaluronic Acid analog results in decreased expression of ACTG2 protein CTD PMID:23178681 Actg2 Rat hyaluronic acid multiple interactions EXP 6480464 Hyaluronic Acid analog inhibits the reaction [Hydrogen Peroxide results in decreased expression of ACTG2 protein] CTD PMID:23178681 Actg2 Rat hydrogen peroxide decreases expression EXP 6480464 Hydrogen Peroxide results in decreased expression of ACTG2 protein CTD PMID:23178681 Actg2 Rat hydrogen peroxide multiple interactions EXP 6480464 Hyaluronic Acid analog inhibits the reaction [Hydrogen Peroxide results in decreased expression of ACTG2 protein] CTD PMID:23178681 Actg2 Rat isoprenaline increases expression ISO RGD:10077 6480464 Isoproterenol results in increased expression of ACTG2 mRNA CTD PMID:21335049 Actg2 Rat ketamine decreases expression EXP 6480464 Ketamine results in decreased expression of ACTG2 mRNA CTD PMID:20080153 Actg2 Rat leflunomide increases expression ISO RGD:737318 6480464 leflunomide results in increased expression of ACTG2 mRNA CTD PMID:28988120 Actg2 Rat Leptin multiple interactions EXP 598108049 IL6 antibody inhibited the reaction [[Leptin cotreatment with acetaldehyde] increased expression of aSMA mRNA and more ... RGD Actg2 Rat lipopolysaccharide multiple interactions ISO RGD:737318 6480464 [S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of ACTG2 mRNA; [S-(1,2-dichlorovinyl)cysteine more ... CTD PMID:35811015 Actg2 Rat losartan decreases expression EXP 6480464 Losartan results in decreased expression of ACTG2 mRNA CTD PMID:15100363 Actg2 Rat mercaptopurine decreases expression EXP 6480464 Mercaptopurine results in decreased expression of ACTG2 mRNA CTD PMID:23358152 Actg2 Rat mercury dibromide multiple interactions ISO RGD:737318 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Actg2 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of ACTG2 mRNA CTD PMID:30047161 Actg2 Rat methylmercury chloride decreases expression ISO RGD:737318 6480464 methylmercuric chloride results in decreased expression of ACTG2 mRNA CTD PMID:34089799 Actg2 Rat methylseleninic acid increases expression ISO RGD:737318 6480464 methylselenic acid results in increased expression of ACTG2 mRNA CTD PMID:18548127 Actg2 Rat mitoxantrone affects response to substance ISO RGD:737318 6480464 ACTG2 protein affects the susceptibility to Mitoxantrone CTD PMID:16217747 Actg2 Rat Monobutylphthalate decreases expression ISO RGD:10077 6480464 monobutyl phthalate results in decreased expression of ACTG2 mRNA CTD PMID:35278568 Actg2 Rat N-nitrosodiethylamine decreases expression ISO RGD:737318 6480464 Diethylnitrosamine results in decreased expression of ACTG2 mRNA CTD PMID:21527772 Actg2 Rat nickel atom decreases expression ISO RGD:737318 6480464 Nickel results in decreased expression of ACTG2 mRNA CTD PMID:25583101 Actg2 Rat nickel subsulfide affects expression EXP 6480464 nickel subsulfide affects the expression of ACTG2 mRNA CTD PMID:24952340 Actg2 Rat nickel sulfate increases expression ISO RGD:737318 6480464 nickel sulfate results in increased expression of ACTG2 mRNA CTD PMID:16780908 Actg2 Rat nitrofen decreases expression EXP 6480464 nitrofen results in decreased expression of ACTG2 mRNA CTD PMID:26720608|PMID:33484710 Actg2 Rat paracetamol affects expression ISO RGD:10077 6480464 Acetaminophen affects the expression of ACTG2 mRNA CTD PMID:17562736 Actg2 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of ACTG2 mRNA CTD PMID:32680482 Actg2 Rat phenylmercury acetate increases expression ISO RGD:737318 6480464 Phenylmercuric Acetate results in increased expression of ACTG2 mRNA CTD PMID:26272509 Actg2 Rat phenylmercury acetate multiple interactions ISO RGD:737318 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Actg2 Rat PhIP decreases expression EXP 6480464 2-amino-1-methyl-6-phenylimidazo(4,5-b)pyridine results in decreased expression of ACTG2 mRNA CTD PMID:15059925|PMID:29877212 Actg2 Rat pioglitazone multiple interactions ISO RGD:10077 6480464 [N-nitroso-tris-chloroethylurea co-treated with pioglitazone] results in decreased expression of ACTG2 mRNA CTD PMID:27935865 Actg2 Rat pirinixic acid multiple interactions ISO RGD:737318 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ... CTD PMID:19710929 Actg2 Rat progesterone affects expression ISO RGD:10077 6480464 Progesterone affects the expression of ACTG2 mRNA CTD PMID:17251523 Actg2 Rat progesterone increases expression ISO RGD:737318 6480464 Progesterone results in increased expression of ACTG2 mRNA CTD PMID:20864642 Actg2 Rat purine-6-thiol decreases expression EXP 6480464 Mercaptopurine results in decreased expression of ACTG2 mRNA CTD PMID:23358152 Actg2 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO RGD:737318 6480464 [S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of ACTG2 mRNA; [S-(1,2-dichlorovinyl)cysteine more ... CTD PMID:35811015 Actg2 Rat S-(1,2-dichlorovinyl)-L-cysteine decreases expression ISO RGD:737318 6480464 S-(1,2-dichlorovinyl)cysteine results in decreased expression of ACTG2 mRNA CTD PMID:35811015 Actg2 Rat SB 203580 multiple interactions EXP 598108049 SB203580 inhibited the reaction [[Leptin cotreatment with acetaldehyde] increased expression of aSMA protein in cultured more ... RGD Actg2 Rat SB 431542 multiple interactions ISO RGD:737318 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Actg2 Rat senecionine decreases expression EXP 6480464 senecionine results in decreased expression of ACTG2 mRNA CTD PMID:34185104 Actg2 Rat serpentine asbestos decreases expression ISO RGD:737318 6480464 Asbestos, Serpentine results in decreased expression of ACTG2 mRNA CTD PMID:29523930 Actg2 Rat silibinin multiple interactions EXP 598130086 silibinin inhibits the reaction [ethanol increases expression of alpha SMA protein in liver parenchyma] RGD Actg2 Rat silicon dioxide decreases expression ISO RGD:737318 6480464 Silicon Dioxide analog results in decreased expression of ACTG2 mRNA CTD PMID:25895662 Actg2 Rat silicon dioxide decreases expression EXP 6480464 Silicon Dioxide results in decreased expression of ACTG2 mRNA CTD PMID:22431001 Actg2 Rat silver atom decreases expression ISO RGD:737318 6480464 Silver analog results in decreased expression of ACTG2 mRNA CTD PMID:24974767 Actg2 Rat silver(0) decreases expression ISO RGD:737318 6480464 Silver analog results in decreased expression of ACTG2 mRNA CTD PMID:24974767 Actg2 Rat sodium fluoride decreases expression ISO RGD:10077 6480464 Sodium Fluoride results in decreased expression of ACTG2 protein CTD PMID:27548804 Actg2 Rat sorafenib decreases expression EXP 6480464 sorafenib results in decreased expression of ACTG2 mRNA CTD PMID:19338580 Actg2 Rat succimer multiple interactions ISO RGD:737318 6480464 [Succimer co-treated with Magnetite Nanoparticles] results in increased expression of ACTG2 mRNA CTD PMID:26378955 Actg2 Rat sulforaphane increases expression ISO RGD:10077 6480464 sulforaphane results in increased expression of ACTG2 mRNA CTD PMID:30529165 Actg2 Rat temozolomide increases expression ISO RGD:737318 6480464 Temozolomide results in increased expression of ACTG2 mRNA CTD PMID:31758290 Actg2 Rat tert-butyl hydroperoxide increases expression ISO RGD:737318 6480464 tert-Butylhydroperoxide results in increased expression of ACTG2 mRNA CTD PMID:15336504 Actg2 Rat testosterone multiple interactions ISO RGD:737318 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of ACTG2 mRNA CTD PMID:21592394 Actg2 Rat testosterone increases expression ISO RGD:737318 6480464 Testosterone results in increased expression of ACTG2 mRNA CTD PMID:21592394 Actg2 Rat tetrachloromethane decreases expression ISO RGD:10077 6480464 Carbon Tetrachloride results in decreased expression of ACTG2 mRNA CTD PMID:17484886 Actg2 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of ACTG2 mRNA CTD PMID:38504479 Actg2 Rat thioacetamide multiple interactions EXP 6480464 Silymarin inhibits the reaction [Thioacetamide results in increased expression of ACTG2 mRNA]; thymoquinone inhibits the more ... CTD PMID:38504479 Actg2 Rat thymoquinone multiple interactions EXP 6480464 thymoquinone inhibits the reaction [Thioacetamide results in increased expression of ACTG2 mRNA] CTD PMID:38504479 Actg2 Rat titanium dioxide decreases expression EXP 6480464 titanium dioxide results in decreased expression of ACTG2 mRNA CTD PMID:30012374 Actg2 Rat topotecan affects response to substance ISO RGD:737318 6480464 ACTG2 protein affects the susceptibility to Topotecan CTD PMID:16217747 Actg2 Rat triadimefon decreases expression ISO RGD:737318 6480464 triadimefon results in decreased expression of ACTG2 mRNA CTD PMID:26705709 Actg2 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of ACTG2 mRNA CTD PMID:33387578 Actg2 Rat valproic acid affects expression ISO RGD:10077 6480464 Valproic Acid affects the expression of ACTG2 mRNA CTD PMID:17292431 Actg2 Rat valproic acid affects expression ISO RGD:737318 6480464 Valproic Acid affects the expression of ACTG2 mRNA CTD PMID:25979313 Actg2 Rat valproic acid decreases expression ISO RGD:737318 6480464 Valproic Acid results in decreased expression of ACTG2 mRNA CTD PMID:23179753|PMID:24935251|PMID:29154799 Actg2 Rat XL147 multiple interactions ISO RGD:10077 6480464 [N-nitroso-tris-chloroethylurea co-treated with XL147] results in decreased expression of ACTG2 mRNA CTD PMID:27935865 Actg2 Rat zoledronic acid decreases expression ISO RGD:737318 6480464 zoledronic acid results in decreased expression of ACTG2 mRNA CTD PMID:24714768
1,2-dimethylhydrazine (EXP,ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP,ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-nitrotoluene (EXP) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3,7-dihydropurine-6-thione (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) 7,12-dimethyltetraphene (EXP) 9-cis-retinoic acid (EXP) acetaldehyde (EXP) acetamide (EXP) all-trans-retinoic acid (EXP,ISO) all-trans-retinol (EXP) amitrole (EXP) arsenite(3-) (ISO) arsenous acid (ISO) benzo[a]pyrene (EXP,ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) bromochloroacetic acid (EXP) butanal (ISO) cadmium acetate (ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) calcitriol (ISO) carbamazepine (ISO) carbon nanotube (ISO) carmustine (ISO) chromium(6+) (ISO) cocaine (ISO) copper atom (EXP) copper(0) (EXP) copper(II) sulfate (ISO) corticosterone (EXP) cyclosporin A (ISO) DDT (EXP) dexamethasone (ISO) diarsenic trioxide (ISO) dibutyl phthalate (EXP,ISO) diethylcarbamazine (EXP) diethylstilbestrol (EXP,ISO) dioxygen (EXP) diuron (EXP) doramapimod (EXP) dorsomorphin (ISO) ethanol (EXP) fipronil (EXP) folic acid (ISO) genistein (ISO) glyphosate (ISO) Heliotrine (EXP) hesperidin (EXP) hyaluronic acid (EXP) hydrogen peroxide (EXP) isoprenaline (ISO) ketamine (EXP) leflunomide (ISO) Leptin (EXP) lipopolysaccharide (ISO) losartan (EXP) mercaptopurine (EXP) mercury dibromide (ISO) methimazole (EXP) methylmercury chloride (ISO) methylseleninic acid (ISO) mitoxantrone (ISO) Monobutylphthalate (ISO) N-nitrosodiethylamine (ISO) nickel atom (ISO) nickel subsulfide (EXP) nickel sulfate (ISO) nitrofen (EXP) paracetamol (ISO) paraquat (EXP) phenylmercury acetate (ISO) PhIP (EXP) pioglitazone (ISO) pirinixic acid (ISO) progesterone (ISO) purine-6-thiol (EXP) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 203580 (EXP) SB 431542 (ISO) senecionine (EXP) serpentine asbestos (ISO) silibinin (EXP) silicon dioxide (EXP,ISO) silver atom (ISO) silver(0) (ISO) sodium fluoride (ISO) sorafenib (EXP) succimer (ISO) sulforaphane (ISO) temozolomide (ISO) tert-butyl hydroperoxide (ISO) testosterone (ISO) tetrachloromethane (ISO) thioacetamide (EXP) thymoquinone (EXP) titanium dioxide (EXP) topotecan (ISO) triadimefon (ISO) trichloroethene (EXP) valproic acid (ISO) XL147 (ISO) zoledronic acid (ISO)
1.
Antifibrotic effect of diethylcarbamazine combined with hesperidin against ethanol induced liver fibrosis in rats.
El-Sisi AEE, etal., Biomed Pharmacother. 2017 May;89:1196-1206. doi: 10.1016/j.biopha.2017.03.013. Epub 2017 Mar 14.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Leptin and acetaldehyde synergistically promotes αSMA expression in hepatic stellate cells by an interleukin 6-dependent mechanism.
Liu Y, etal., Alcohol Clin Exp Res. 2011 May;35(5):921-8. doi: 10.1111/j.1530-0277.2010.01422.x. Epub 2011 Feb 5.
4.
The development expression of the rat alpha-vascular and gamma-enteric smooth muscle isoactins: isolation and characterization of a rat gamma-enteric actin cDNA.
McHugh KM and Lessard JL, Mol Cell Biol 1988 Dec;8(12):5224-31.
5.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
6.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
8.
[Complex evaluation of the health status indicators of military personnel].
Poliakov LE, etal., Voen Med Zh. 1978 Nov;(11):15-20.
9.
GOA pipeline
RGD automated data pipeline
10.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
12.
Comprehensive gene review and curation
RGD comprehensive gene curation
13.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
14.
Polski tygodnik lekarski (Warsaw, Poland : 1960)
Woyton A Pol Tyg Lek 1978 Aug 7;33(32):1263-4.
Actg2 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 117,579,513 - 117,604,379 (-) NCBI GRCr8 mRatBN7.2 4 116,021,832 - 116,046,475 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 116,021,832 - 116,046,465 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 121,500,276 - 121,514,993 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 117,275,441 - 117,290,158 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 115,889,059 - 115,903,778 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 115,215,160 - 115,239,746 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 115,215,060 - 115,239,723 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 179,805,782 - 179,830,362 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 117,732,482 - 117,747,006 NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 4 105,015,569 - 105,030,100 (-) NCBI Celera Cytogenetic Map 4 q34 NCBI
ACTG2 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 73,893,008 - 73,919,865 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 73,892,314 - 73,919,865 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 74,120,135 - 74,146,992 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 73,973,601 - 74,000,288 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 74,031,789 - 74,058,434 NCBI Celera 2 73,951,347 - 73,978,043 (+) NCBI Celera Cytogenetic Map 2 p13.1 NCBI HuRef 2 73,854,905 - 73,882,444 (+) NCBI HuRef CHM1_1 2 74,049,434 - 74,076,040 (+) NCBI CHM1_1 T2T-CHM13v2.0 2 73,901,172 - 73,928,327 (+) NCBI T2T-CHM13v2.0
Actg2 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 83,489,891 - 83,513,233 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 83,489,887 - 83,513,247 (-) Ensembl GRCm39 Ensembl GRCm38 6 83,512,909 - 83,536,251 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 83,512,905 - 83,536,265 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 83,462,903 - 83,486,245 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 83,478,568 - 83,501,883 (-) NCBI MGSCv36 mm8 Celera 6 85,494,063 - 85,517,393 (-) NCBI Celera Cytogenetic Map 6 C3 NCBI cM Map 6 35.94 NCBI
Actg2 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955424 11,779,597 - 11,802,446 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955424 11,779,805 - 11,802,446 (-) NCBI ChiLan1.0 ChiLan1.0
ACTG2 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 12 52,464,021 - 52,490,974 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2A 52,466,775 - 52,493,728 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2A 73,966,939 - 73,993,862 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2A 75,476,877 - 75,503,658 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2A 75,476,877 - 75,503,658 (+) Ensembl panpan1.1 panPan2
ACTG2 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 17 49,144,184 - 49,168,872 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 17 49,104,546 - 49,168,782 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 17 48,784,850 - 48,810,117 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 17 50,003,715 - 50,028,411 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 17 50,003,722 - 50,028,328 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 17 49,019,875 - 49,044,569 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 17 49,087,331 - 49,111,998 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 17 49,645,142 - 49,670,439 (-) NCBI UU_Cfam_GSD_1.0
Actg2 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
ACTG2 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 69,096,782 - 69,121,351 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 69,097,366 - 69,121,542 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 72,251,872 - 72,257,786 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ACTG2 (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 14 33,363,170 - 33,390,710 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 14 33,363,023 - 33,390,937 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666045 78,776,828 - 78,804,281 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Actg2 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 53 Count of miRNA genes: 51 Interacting mature miRNAs: 53 Transcripts: ENSRNOT00000042699 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1582232 Gluco25 Glucose level QTL 25 3.6 0.0023 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 85253748 148090731 Rat 631689 Scl4 Serum cholesterol level QTL 4 1.9 0.008 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 4 95174120 140174120 Rat 1358352 Srcrt3 Stress Responsive Cort QTL 3 2.29 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 38465774 146803430 Rat 1578655 Bmd11 Bone mineral density QTL 11 11 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 4 90850165 135850165 Rat 10755501 Bp390 Blood pressure QTL 390 2.5 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 4 26775591 168368347 Rat 1357342 Bw40 Body weight QTL 40 0.001 body mass (VT:0001259) body weight (CMO:0000012) 4 76647384 117676292 Rat 631556 Bp135 Blood pressure QTL 135 0.017 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 78881294 117676292 Rat 61330 Eau1 Experimental allergic uveoretinitis QTL 1 0.0003 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 4 70362013 132642728 Rat 70167 Bw22 Body weight QTL 22 3.1 body mass (VT:0001259) body weight (CMO:0000012) 4 76647384 117676292 Rat 731165 Uae21 Urinary albumin excretion QTL 21 2.4 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 4 106649412 151649412 Rat 737821 Hcar9 Hepatocarcinoma resistance QTL 9 3.7 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 4 109866907 167139601 Rat 1549832 Bss3 Bone structure and strength QTL 3 11 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 4 109827074 154827074 Rat 70177 Xhs1 X-ray hypersensitivity QTL 1 25.1 intestine integrity trait (VT:0010554) post-insult time to onset of moribundity (CMO:0001896) 4 82798864 152731274 Rat 724522 Bp146 Blood pressure QTL 146 2.2 0.0021 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 73630210 118630210 Rat 61476 Aia3 Adjuvant induced arthritis QTL 3 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 86730991 131730991 Rat 1641919 Alc22 Alcohol consumption QTL 22 0.0005 drinking behavior trait (VT:0001422) ethanol drink intake rate (CMO:0001407) 4 81192555 126192555 Rat 1354660 Salc1 Saline consumption QTL 1 11.26 drinking behavior trait (VT:0001422) saline drink intake rate (CMO:0001627) 4 44463908 148090542 Rat 1298082 Stresp4 Stress response QTL 4 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 50119848 146803430 Rat 1578670 Bss14 Bone structure and strength QTL 14 16.4 femur morphology trait (VT:0000559) bone trabecular cross-sectional area (CMO:0002311) 4 87327165 132327165 Rat 1300139 Hrtrt6 Heart rate QTL 6 2.85 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 39524264 116179656 Rat 70200 Alc18 Alcohol consumption QTL 18 9.2 drinking behavior trait (VT:0001422) ethanol intake volume to total fluid intake volume ratio (CMO:0001591) 4 56647873 149491524 Rat 1331759 Hrtrt13 Heart rate QTL 13 3.54628 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 110275411 168266883 Rat 2316958 Gluco58 Glucose level QTL 58 10 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 11320076 180699135 Rat 1578662 Bss15 Bone structure and strength QTL 15 19.6 femur width (VT:1000666) femoral neck width (CMO:0001695) 4 87327165 132327165 Rat 2302051 Pia28 Pristane induced arthritis QTL 28 5.3 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112) 4 73630210 118630210 Rat 2302049 Pia32 Pristane induced arthritis QTL 32 5.1 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112) 4 105789505 150789505 Rat 6478763 Anxrr46 Anxiety related response QTL 46 0.07428 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 110870972 155870972 Rat 6478760 Anxrr45 Anxiety related response QTL 45 0.06717 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 110870972 155870972 Rat 738009 Sach4 Saccharine consumption QTL 4 4.9 0.000016 consumption behavior trait (VT:0002069) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 4 59948935 154902892 Rat 2312567 Glom19 Glomerulus QTL 19 1.9 0.006 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 4 45456990 146803430 Rat 738015 Pia9 Pristane induced arthritis QTL 9 4.5 0.048 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 80694870 125694870 Rat 7207480 Bss105 Bone structure and strength QTL 105 8.1 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 4 109827074 154827074 Rat 634335 Anxrr16 Anxiety related response QTL 16 7.22 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 4 93308457 167139447 Rat 631646 Stl4 Serum triglyceride level QTL 4 6.5 0.0001 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 4 73169846 132642728 Rat 634334 Xhs3 X-ray hypersensitivity QTL 3 10 intestine integrity trait (VT:0010554) post-insult time to onset of moribundity (CMO:0001896) 4 84728680 129854654 Rat 61406 Scwia1 Streptococcal cell wall induced arthritis QTL 1 2.3 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 4 106805662 151805662 Rat 1354612 Foco1 Food consumption QTL 1 8.87 eating behavior trait (VT:0001431) food intake rate (CMO:0000427) 4 44463908 148090542 Rat 2303168 Bp330 Blood pressure QTL 330 4.25 0.017 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 5214602 146446691 Rat 738031 Alc14 Alcohol consumption QTL 14 7.6 0.00003 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1576316 Ept5 Estrogen-induced pituitary tumorigenesis QTL 5 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 4 83428419 177635233 Rat 631662 Hcar2 Hepatocarcinoma resistance QTL 2 3.1 0.0003 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 4 78878504 123878504 Rat 1576305 Emca6 Estrogen-induced mammary cancer QTL 6 5.8 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 4 44463720 155883716 Rat 61418 Pia5 Pristane induced arthritis QTL 5 4.5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 62277855 128289560 Rat 738016 Alc16 Alcohol consumption QTL 16 3.6 0.00015 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1358202 Gluco11 Glucose level QTL 11 2.4 0.02 adipocyte glucose uptake trait (VT:0004185) absolute change in adipocyte glucose uptake (CMO:0000873) 4 85379421 167139601 Rat 1641833 Alc21 Alcohol consumption QTL 21 8.6 0.0001 drinking behavior trait (VT:0001422) ethanol drink intake rate (CMO:0001407) 4 56698790 126192555 Rat 2306899 Bp338 Blood pressure QTL 338 0.071 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 81006124 120102625 Rat 631674 Iddm14 Insulin dependent diabetes mellitus QTL 14 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 4 64528739 157573521 Rat 12798519 Anxrr54 Anxiety related response QTL 54 2.54 0.05 locomotor behavior trait (VT:0001392) distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493) 4 114627026 159627026 Rat 12798523 Anxrr56 Anxiety related response QTL 56 2.83 0.05 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 85253748 150276390 Rat 61434 Cia3 Collagen induced arthritis QTL 3 4.8 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 103194656 148194656 Rat
PMC20960P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,665,621 - 11,665,967 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,718,353 - 13,718,698 NCBI Rnor6.0 Rnor_5.0 12 15,748,366 - 15,748,711 UniSTS Rnor5.0 RGSC_v3.4 12 12,049,580 - 12,049,925 UniSTS RGSC3.4 Celera 12 13,454,953 - 13,455,298 UniSTS Cytogenetic Map 12 p11 UniSTS Cytogenetic Map 4 q34 UniSTS
STS_ADH2
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 100,812,851 - 100,813,988 (+) MAPPER mRatBN7.2 mRatBN7.2 4 37,621,193 - 37,621,465 (+) MAPPER mRatBN7.2 Rnor_6.0 4 35,593,637 - 35,593,908 NCBI Rnor6.0 Rnor_6.0 3 105,508,268 - 105,509,404 NCBI Rnor6.0 Rnor_5.0 4 35,451,038 - 35,451,309 UniSTS Rnor5.0 Rnor_5.0 3 112,081,718 - 112,082,854 UniSTS Rnor5.0 RGSC_v3.4 3 99,901,887 - 99,903,023 UniSTS RGSC3.4 RGSC_v3.4 4 34,652,200 - 34,652,471 UniSTS RGSC3.4 Celera 4 33,105,107 - 33,105,378 UniSTS Celera 3 99,782,375 - 99,783,511 UniSTS Cytogenetic Map 3 q35 UniSTS Cytogenetic Map 4 q21 UniSTS Cytogenetic Map 4 q34 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
111
91
90
59
25
59
6
218
97
91
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000042699 ⟹ ENSRNOP00000050322
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 116,021,832 - 116,046,465 (-) Ensembl Rnor_6.0 Ensembl 4 115,215,060 - 115,239,723 (-) Ensembl
RefSeq Acc Id:
NM_012893 ⟹ NP_037025
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 117,579,513 - 117,594,039 (-) NCBI mRatBN7.2 4 116,021,832 - 116,036,358 (-) NCBI Rnor_6.0 4 115,215,160 - 115,229,684 (-) NCBI Rnor_5.0 4 179,805,782 - 179,830,362 (-) NCBI RGSC_v3.4 4 117,732,482 - 117,747,006 (-) RGD Celera 4 105,015,569 - 105,030,100 (-) RGD
Sequence:
TCCACCGCGCCCACCATGTGTGAAGAAGAGACCACCGCCCTTGTGTGTGACAATGGGTCTGGCCTGTGCAAGGCAGGCTTTGCAGGAGACGACGCTCCCAGGGCTGTCTTTCCCTCCATTGTGGGCCG CCCTCGGCATCAGGGCGTGATGGTGGGAATGGGCCAGAAAGACAGCTATGTGGGGGACGAAGCCCAGAGCAAGCGTGGGATCCTGACCCTCAAATACCCCATTGAGCACGGCATCATCACGAACTGGG ATGACATGGAGAAGATCTGGCACCACTCCTTCTACAACGAGCTGCGAGTAGCACCAGAAGAGCACCCGACCCTGCTCACAGAGGCCCCCCTAAACCCTAAAGCCAACAGGGAGAAGATGACCCAGATC ATGTTCGAAACCTTCAATGTTCCTGCCATGTATGTTGCCATTCAAGCTGTGCTCTCGCTCTATGCATCTGGCCGCACCACAGGCATCGTCCTGGATTCAGGGGATGGCGTCACCCACAATGTCCCCAT CTACGAGGGCTATGCACTGCCCCATGCCATCATGCGTCTTGACCTGGCTGGACGGGATCTCACAGACTACCTCATGAAAATTCTCACAGAAAGAGGCTATTCCTTTGTGACCACAGCTGAGAGAGAAA TTGTGCGAGACATCAAGGAGAAGCTGTGCTACGTAGCCCTGGATTTTGAGAATGAGATGGCCACGGCGGCTTCGTCTTCTTCCCTGGAGAAGAGCTACGAGTTGCCTGATGGGCAGGTCATCACGATT GGCAATGAGCGCTTCCGCTGCCCGGAGACCCTGTTCCAGCCTTCCTTCATTGGCATGGAGTCAGCTGGAATTCATGAGACAACATACAATTCCATCATGAAGTGTGACATTGACATCCGCAAGGATTT GTATGCTAACAATGTCCTCTCTGGGGGCACTACCATGTACCCTGGGATTGCTGACAGGATGCAGAAGGAGATCACAGCCTTGGCTCCCAGCACCATGAAGATCAAGATCATCGCTCCTCCGGAGCGGA AGTACTCAGTCTGGATTGGAGGCTCCATCCTGGCTTCTCTCTCCACCTTCCAGCAAATGTGGATCAGCAAGCCAGAGTATGATGAAGCGGGGCCCTCCATTGTCCACAGGAAATGCTTCTAAAGTCAC AGGGCCTTCTCTGGGGATCCCTGCAAGACTGCTGTCACCAGTCACAGATCATTAAAACCTTCAAGCCTTAAAAAAAAAAAAAAAA
hide sequence
RefSeq Acc Id:
XM_006236728 ⟹ XP_006236790
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 117,579,513 - 117,604,379 (-) NCBI mRatBN7.2 4 116,021,832 - 116,046,475 (-) NCBI Rnor_6.0 4 115,215,160 - 115,239,746 (-) NCBI Rnor_5.0 4 179,805,782 - 179,830,362 (-) NCBI
Sequence:
TTTAAAGAAGATCCGCCTTGGGGGTTTTATATTGCTCTGGTATTTCTGCCAAAGACACCACGGCCCTCAGTCTCTCGGAGAAGGACTTCTCACACCCTTGGTGCTCCAGCCCCCAGCTCTCTCCACCG CGCCCACCATGTGTGAAGAAGAGACCACCGCCCTTGTGTGTGACAATGGGTCTGGCCTGTGCAAGGCAGGCTTTGCAGGAGACGACGCTCCCAGGGCTGTCTTTCCCTCCATTGTGGGCCGCCCTCGG CATCAGGGCGTGATGGTGGGAATGGGCCAGAAAGACAGCTATGTGGGGGACGAAGCCCAGAGCAAGCGTGGGATCCTGACCCTCAAATACCCCATTGAACACGGCATCATCACGAACTGGGATGACAT GGAGAAGATCTGGCACCACTCCTTCTACAACGAGCTGCGAGTAGCACCAGAAGAGCACCCGACCCTGCTCACAGAGGCCCCCCTAAACCCTAAAGCCAACAGGGAGAAGATGACCCAGATCATGTTCG AAACCTTCAATGTTCCTGCCATGTATGTTGCCATTCAAGCTGTGCTCTCGCTCTATGCATCTGGCCGCACCACAGGCATCGTCCTGGATTCAGGGGATGGCGTCACCCACAATGTCCCCATCTACGAG GGCTATGCACTGCCCCATGCCATCATGCGTCTTGACCTGGCTGGACGGGATCTCACAGACTACCTCATGAAGATTCTCACAGAAAGAGGCTATTCCTTTGTGACCACAGCTGAGAGAGAAATTGTGCG AGACATCAAGGAGAAGCTGTGCTACGTAGCCCTGGATTTTGAGAATGAGATGGCCACGGCGGCTTCGTCTTCTTCCCTGGAGAAGAGCTACGAGTTGCCTGATGGGCAGGTCATCACGATTGGCAATG AGCGCTTCCGCTGCCCGGAGACCCTGTTCCAGCCTTCCTTCATTGGCATGGAGTCAGCTGGAATTCATGAGACAACATACAATTCCATCATGAAGTGTGACATTGACATCCGCAAGGATTTGTATGCT AACAATGTCCTCTCTGGGGGCACTACCATGTACCCTGGGATTGCTGACAGGATGCAGAAGGAGATCACAGCCTTGGCTCCCAGCACCATGAAGATCAAGATCATCGCTCCTCCGGAGCGGAAGTACTC AGTCTGGATTGGAGGCTCCATCCTGGCTTCTCTCTCCACCTTCCAGCAAATGTGGATCAGCAAGCCAGAGTATGATGAAGCGGGGCCCTCCATTGTCCACAGGAAATGCTTCTAAAGTCACAGGGCCT TCTCTGGGGATCCCTGCAAGACTGCTGTCACCAGTCACAGATCATTAAAACCTTCAAGCCTTA
hide sequence
RefSeq Acc Id:
NP_037025 ⟸ NM_012893
- UniProtKB:
P63269 (UniProtKB/Swiss-Prot), A6IAN1 (UniProtKB/TrEMBL), A0A0G2K4M6 (UniProtKB/TrEMBL)
- Sequence:
MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETF NVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERF RCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKPEYDEAGPSIVHRKCF
hide sequence
RefSeq Acc Id:
XP_006236790 ⟸ XM_006236728
- Peptide Label:
isoform X1
- UniProtKB:
P63269 (UniProtKB/Swiss-Prot), A6IAN1 (UniProtKB/TrEMBL), A0A0G2K4M6 (UniProtKB/TrEMBL)
- Sequence:
MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETF NVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERF RCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKPEYDEAGPSIVHRKCF
hide sequence
Ensembl Acc Id:
ENSRNOP00000050322 ⟸ ENSRNOT00000042699
RGD ID: 13693181
Promoter ID: EPDNEW_R3705
Type: multiple initiation site
Name: Actg2_1
Description: actin, gamma 2, smooth muscle, enteric
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 4 115,239,689 - 115,239,749 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2019-03-25
Actg2
actin gamma 2, smooth muscle
Actg2
actin, gamma 2, smooth muscle, enteric
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2008-02-14
Actg2
actin, gamma 2, smooth muscle, enteric
Actg2
actin, gamma 2
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2002-11-06
Actg2
actin, gamma 2
Actin, gamma 2, smooth muscle, enteric
Name updated
625702
APPROVED
2002-06-10
Actg2
Actin, gamma 2, smooth muscle, enteric
Symbol and Name status set to approved
70586
APPROVED
Note Type
Note
Reference
gene_expression
expressed in stomach smooth muscle
631723
gene_homology
mature protein is nearly identical to that of the chicken gizzard gamma actin sequence with one differing amino acid
631723
gene_product
member of the actin family
631723