Symbol:
Actc1
Name:
actin, alpha, cardiac muscle 1
RGD ID:
2026
Description:
Predicted to enable ATP binding activity; microfilament motor activity; and myosin binding activity. Involved in cardiac muscle contraction; response to ethanol; and response to xenobiotic stimulus. Predicted to be located in several cellular components, including I band; filopodium; and lamellipodium. Predicted to be part of protein-containing complex. Predicted to be active in actin filament; glutamatergic synapse; and sarcomere. Biomarker of hypertension. Human ortholog(s) of this gene implicated in atrial heart septal defect 5; dilated cardiomyopathy; dilated cardiomyopathy 1R; and hypertrophic cardiomyopathy 11. Orthologous to human ACTC1 (actin alpha cardiac muscle 1); PARTICIPATES IN dilated cardiomyopathy pathway; hypertrophic cardiomyopathy pathway; INTERACTS WITH 2,2,2-tetramine; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
actin alpha cardiac; actin alpha cardiac 1; actin, alpha cardiac muscle 1; actin, alpha, cardiac; actin, alpha, cardiac 1; alpha-actin cardiac; alpha-cardiac actin; MGC156490
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ACTC1 (actin alpha cardiac muscle 1) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, PhylomeDB, Treefam
Mus musculus (house mouse):
Actc1 (actin, alpha, cardiac muscle 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Actc1 (actin alpha cardiac muscle 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
LOC100987752 (actin alpha cardiac muscle 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ACTC1 (actin alpha cardiac muscle 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Actc1 (actin alpha cardiac muscle 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ACTC1 (actin alpha cardiac muscle 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ACTC1 (actin alpha cardiac muscle 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Actc1 (actin alpha cardiac muscle 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
ACTC1 (actin alpha cardiac muscle 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Actc1 (actin, alpha, cardiac muscle 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
zgc:86709
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
ACT1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
actc1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 121,266,291 - 121,271,827 (-) NCBI GRCr8 mRatBN7.2 3 100,811,987 - 100,817,523 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 100,811,987 - 100,817,523 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 104,444,093 - 104,449,627 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 113,043,134 - 113,048,668 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 110,726,488 - 110,732,015 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 105,507,403 - 105,512,939 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 105,507,403 - 105,512,939 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 112,080,853 - 112,086,389 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 99,901,022 - 99,906,558 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 99,797,449 - 99,798,402 (-) NCBI Celera 3 99,781,510 - 99,787,044 (-) NCBI Celera Cytogenetic Map 3 q35 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Actc1 Rat (1->4)-beta-D-glucan multiple interactions ISO Actc1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of ACTC1 mRNA CTD PMID:36331819 Actc1 Rat 1,2-dimethylhydrazine increases expression ISO Actc1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of ACTC1 mRNA CTD PMID:22206623 Actc1 Rat 17alpha-ethynylestradiol affects expression ISO Actc1 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of ACTC1 mRNA CTD PMID:17555576 Actc1 Rat 17beta-estradiol affects expression ISO ACTC1 (Homo sapiens) 6480464 Estradiol affects the expression of ACTC1 mRNA CTD PMID:23184660 Actc1 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Actc1 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Actc1 Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Actc1 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Actc1 Rat 2,2',5,5'-tetrachlorobiphenyl increases expression ISO ACTC1 (Homo sapiens) 6480464 2 more ... CTD PMID:36804509 Actc1 Rat 2,2,2-tetramine decreases expression EXP 6480464 Trientine results in decreased expression of ACTC1 protein CTD PMID:21136691 Actc1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Actc1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin promotes the reaction [[Dexamethasone co-treated with rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in decreased expression of ACTC1 mRNA] CTD PMID:16054899 Actc1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of ACTC1 mRNA CTD PMID:32109520 Actc1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Actc1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ACTC1 mRNA CTD PMID:21570461 Actc1 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Actc1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO Actc1 (Mus musculus) 6480464 [Dexamethasone co-treated with rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in decreased expression of ACTC1 mRNA and Tetrachlorodibenzodioxin promotes the reaction [[Dexamethasone co-treated with rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in decreased expression of ACTC1 mRNA] CTD PMID:16054899 Actc1 Rat 4,4'-sulfonyldiphenol increases expression ISO Actc1 (Mus musculus) 6480464 bisphenol S results in increased expression of ACTC1 mRNA CTD PMID:30951980 Actc1 Rat 4,4'-sulfonyldiphenol decreases expression ISO Actc1 (Mus musculus) 6480464 bisphenol S results in decreased expression of ACTC1 mRNA CTD PMID:34850234 Actc1 Rat 5-fluorouracil decreases expression ISO Actc1 (Mus musculus) 6480464 Fluorouracil results in decreased expression of ACTC1 protein CTD PMID:21296659 Actc1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of ACTC1 mRNA CTD PMID:24780913 Actc1 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of ACTC1 mRNA CTD PMID:31881176 Actc1 Rat acetic acid decreases expression ISO Actc1 (Mus musculus) 6480464 Acetic Acid results in decreased expression of ACTC1 protein CTD PMID:21296659 Actc1 Rat acrolein affects metabolic processing ISO Actc1 (Mus musculus) 6480464 Acrolein affects the metabolism of ACTC1 protein CTD PMID:17921335 Actc1 Rat aflatoxin B1 decreases expression ISO Actc1 (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of ACTC1 mRNA CTD PMID:19770486 Actc1 Rat all-trans-retinoic acid increases expression ISO ACTC1 (Homo sapiens) 6480464 Tretinoin results in increased expression of ACTC1 mRNA CTD PMID:33167477 Actc1 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of ACTC1 mRNA CTD PMID:35163327 Actc1 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of ACTC1 mRNA CTD PMID:30779732 Actc1 Rat benzo[a]pyrene increases expression ISO ACTC1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of ACTC1 mRNA CTD PMID:22316170 Actc1 Rat benzo[a]pyrene decreases methylation ISO ACTC1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of ACTC1 5' UTR and Benzo(a)pyrene results in decreased methylation of ACTC1 promoter CTD PMID:27901495 Actc1 Rat benzo[a]pyrene increases methylation ISO ACTC1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of ACTC1 3' UTR CTD PMID:27901495 Actc1 Rat benzo[a]pyrene decreases expression ISO Actc1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of ACTC1 mRNA CTD PMID:19770486 and PMID:22228805 Actc1 Rat bexarotene increases expression EXP 6480464 bexarotene results in increased expression of ACTC1 mRNA CTD PMID:16648578 Actc1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ACTC1 mRNA CTD PMID:27178563 and PMID:32145629 Actc1 Rat bisphenol A increases expression ISO ACTC1 (Homo sapiens) 6480464 bisphenol A results in increased expression of ACTC1 protein CTD PMID:37567409 Actc1 Rat bisphenol A decreases expression ISO Actc1 (Mus musculus) 6480464 bisphenol A results in decreased expression of ACTC1 mRNA CTD PMID:34850234 Actc1 Rat bisphenol A increases expression ISO Actc1 (Mus musculus) 6480464 bisphenol A results in increased expression of ACTC1 mRNA CTD PMID:30951980 Actc1 Rat bisphenol A decreases expression ISO ACTC1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of ACTC1 mRNA CTD PMID:27685785 Actc1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ACTC1 mRNA CTD PMID:24134786 Actc1 Rat bisphenol F increases expression ISO Actc1 (Mus musculus) 6480464 bisphenol F results in increased expression of ACTC1 mRNA CTD PMID:30951980 Actc1 Rat cadmium dichloride increases expression ISO ACTC1 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of ACTC1 mRNA CTD PMID:38568856 Actc1 Rat cantharidin decreases expression ISO Actc1 (Mus musculus) 6480464 Cantharidin results in decreased expression of ACTC1 mRNA CTD PMID:36907384 Actc1 Rat carbamazepine affects expression ISO ACTC1 (Homo sapiens) 6480464 Carbamazepine affects the expression of ACTC1 mRNA CTD PMID:25979313 Actc1 Rat carbon nanotube affects expression ISO Actc1 (Mus musculus) 6480464 Nanotubes and Carbon affects the expression of ACTC1 mRNA CTD PMID:23845593 Actc1 Rat carbon nanotube decreases expression ISO Actc1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Actc1 Rat carmustine decreases expression ISO ACTC1 (Homo sapiens) 6480464 Carmustine results in decreased expression of ACTC1 mRNA CTD PMID:15980968 Actc1 Rat choline multiple interactions ISO Actc1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of ACTC1 mRNA CTD PMID:20938992 Actc1 Rat chromium(6+) multiple interactions ISO ACTC1 (Homo sapiens) 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in decreased expression of ACTC1 mRNA CTD PMID:38479592 Actc1 Rat clofibrate multiple interactions ISO Actc1 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of ACTC1 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of ACTC1 mRNA] CTD PMID:17585979 Actc1 Rat cobalt atom decreases expression ISO Actc1 (Mus musculus) 6480464 Cobalt results in decreased expression of ACTC1 mRNA CTD PMID:34468815 Actc1 Rat copper(II) sulfate decreases expression ISO ACTC1 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of ACTC1 mRNA CTD PMID:19549813 Actc1 Rat Cuprizon affects expression EXP 6480464 Cuprizone affects the expression of ACTC1 mRNA CTD PMID:27523638 Actc1 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of ACTC1 mRNA CTD PMID:26577399 Actc1 Rat cytarabine decreases expression ISO ACTC1 (Homo sapiens) 6480464 Cytarabine results in decreased expression of ACTC1 mRNA CTD PMID:21198554 Actc1 Rat decabromodiphenyl ether decreases expression EXP 6480464 decabromobiphenyl ether results in decreased expression of ACTC1 mRNA CTD PMID:23640034 Actc1 Rat decabromodiphenyl ether increases expression EXP 6480464 decabromobiphenyl ether results in increased expression of ACTC1 mRNA CTD PMID:23914054 Actc1 Rat dexamethasone multiple interactions ISO Actc1 (Mus musculus) 6480464 [Dexamethasone co-treated with rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in decreased expression of ACTC1 mRNA and Tetrachlorodibenzodioxin promotes the reaction [[Dexamethasone co-treated with rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in decreased expression of ACTC1 mRNA] CTD PMID:16054899 Actc1 Rat diethyl malate affects expression ISO Actc1 (Mus musculus) 6480464 diethyl malate affects the expression of ACTC1 mRNA CTD PMID:24814887 Actc1 Rat dimethyl sulfoxide increases expression ISO ACTC1 (Homo sapiens) 6480464 Dimethyl Sulfoxide results in increased expression of ACTC1 mRNA CTD PMID:22105179 Actc1 Rat dimethyl sulfoxide decreases expression ISO ACTC1 (Homo sapiens) 6480464 Dimethyl Sulfoxide results in decreased expression of ACTC1 mRNA CTD PMID:22105179 Actc1 Rat dioxygen multiple interactions ISO Actc1 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of ACTC1 mRNA CTD PMID:30529165 Actc1 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of ACTC1 mRNA CTD PMID:21551480 Actc1 Rat dorsomorphin multiple interactions ISO ACTC1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Actc1 Rat doxorubicin increases expression ISO Actc1 (Mus musculus) 6480464 Doxorubicin results in increased expression of ACTC1 protein CTD PMID:21251210 Actc1 Rat doxorubicin affects expression ISO ACTC1 (Homo sapiens) 6480464 Doxorubicin affects the expression of ACTC1 mRNA CTD PMID:29803840 Actc1 Rat doxorubicin multiple interactions ISO Actc1 (Mus musculus) 6480464 sodium nitrate inhibits the reaction [Doxorubicin results in increased expression of ACTC1 protein] CTD PMID:21251210 Actc1 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of ACTC1 mRNA CTD PMID:29391264 Actc1 Rat entinostat decreases expression ISO ACTC1 (Homo sapiens) 6480464 entinostat results in decreased expression of ACTC1 mRNA CTD PMID:26272509 Actc1 Rat entinostat multiple interactions ISO ACTC1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of ACTC1 mRNA CTD PMID:27188386 Actc1 Rat enzyme inhibitor multiple interactions ISO ACTC1 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of ACTC1 protein CTD PMID:23301498 Actc1 Rat estriol affects expression ISO ACTC1 (Homo sapiens) 6480464 Estriol affects the expression of ACTC1 mRNA CTD PMID:23184660 Actc1 Rat folic acid affects expression ISO ACTC1 (Homo sapiens) 6480464 Folic Acid affects the expression of ACTC1 mRNA CTD PMID:17320366 Actc1 Rat folic acid increases expression ISO ACTC1 (Homo sapiens) 6480464 Folic Acid results in increased expression of ACTC1 mRNA CTD PMID:34742744 Actc1 Rat folic acid multiple interactions ISO Actc1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of ACTC1 mRNA CTD PMID:20938992 Actc1 Rat formaldehyde decreases expression ISO ACTC1 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of ACTC1 mRNA CTD PMID:17938736 Actc1 Rat furan increases methylation EXP 6480464 furan results in increased methylation of ACTC1 gene CTD PMID:22079235 Actc1 Rat graphite affects expression EXP 6480464 Graphite affects the expression of ACTC1 mRNA CTD PMID:29933104 Actc1 Rat hyaluronic acid multiple interactions EXP 6480464 Hyaluronic Acid analog inhibits the reaction [Hydrogen Peroxide results in decreased expression of ACTC1 protein] CTD PMID:23178681 Actc1 Rat hydrogen peroxide multiple interactions EXP 6480464 Hyaluronic Acid analog inhibits the reaction [Hydrogen Peroxide results in decreased expression of ACTC1 protein] CTD PMID:23178681 Actc1 Rat hydrogen peroxide decreases expression EXP 6480464 Hydrogen Peroxide results in decreased expression of ACTC1 protein CTD PMID:23178681 Actc1 Rat L-methionine multiple interactions ISO Actc1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of ACTC1 mRNA CTD PMID:20938992 Actc1 Rat methamphetamine decreases expression ISO ACTC1 (Homo sapiens) 6480464 Methamphetamine results in decreased expression of ACTC1 mRNA CTD PMID:25290377 Actc1 Rat methylmercury chloride decreases expression ISO ACTC1 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of ACTC1 mRNA CTD PMID:23179753 Actc1 Rat methylmercury chloride multiple interactions ISO ACTC1 (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ACTC1 mRNA CTD PMID:27188386 Actc1 Rat methylmercury chloride increases expression ISO ACTC1 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of ACTC1 mRNA CTD PMID:23179753 more ... Actc1 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal decreases expression ISO Actc1 (Mus musculus) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in decreased expression of ACTC1 mRNA CTD PMID:25566086 Actc1 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions ISO Actc1 (Mus musculus) 6480464 MYBPC3 protein affects the reaction [benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in decreased expression of ACTC1 mRNA] CTD PMID:25566086 Actc1 Rat nickel subsulfide increases expression EXP 6480464 nickel subsulfide results in increased expression of ACTC1 mRNA CTD PMID:21086188 Actc1 Rat nickel subsulfide affects expression EXP 6480464 nickel subsulfide affects the expression of ACTC1 mRNA CTD PMID:24952340 Actc1 Rat nickel sulfate decreases expression ISO Actc1 (Mus musculus) 6480464 nickel sulfate results in decreased expression of ACTC1 mRNA CTD PMID:16100012 Actc1 Rat nitrofen decreases expression EXP 6480464 nitrofen results in decreased expression of ACTC1 mRNA CTD PMID:26720608 Actc1 Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of ACTC1 mRNA CTD PMID:33484710 Actc1 Rat ozone decreases expression ISO Actc1 (Mus musculus) 6480464 Ozone results in decreased expression of ACTC1 mRNA CTD PMID:12763052 Actc1 Rat ozone multiple interactions ISO Actc1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of ACTC1 mRNA CTD PMID:34911549 Actc1 Rat ozone increases phosphorylation EXP 6480464 Ozone results in increased phosphorylation of ACTC1 protein CTD PMID:33146391 Actc1 Rat p-chloromercuribenzoic acid increases expression ISO ACTC1 (Homo sapiens) 6480464 p-Chloromercuribenzoic Acid results in increased expression of ACTC1 mRNA CTD PMID:26272509 Actc1 Rat p-chloromercuribenzoic acid multiple interactions ISO ACTC1 (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ACTC1 mRNA CTD PMID:27188386 Actc1 Rat paracetamol multiple interactions ISO Actc1 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of ACTC1 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of ACTC1 mRNA] CTD PMID:17585979 Actc1 Rat paracetamol affects expression ISO Actc1 (Mus musculus) 6480464 Acetaminophen affects the expression of ACTC1 mRNA CTD PMID:17562736 Actc1 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of ACTC1 mRNA CTD PMID:32680482 Actc1 Rat PCB138 multiple interactions ISO Actc1 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Actc1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Actc1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of ACTC1 mRNA CTD PMID:36331819 Actc1 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of ACTC1 mRNA CTD PMID:35163327 Actc1 Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of ACTC1 mRNA CTD PMID:19162173 Actc1 Rat pioglitazone multiple interactions ISO Actc1 (Mus musculus) 6480464 [N-nitroso-tris-chloroethylurea co-treated with pioglitazone] results in decreased expression of ACTC1 mRNA CTD PMID:27935865 Actc1 Rat pirinixic acid increases expression ISO Actc1 (Mus musculus) 6480464 pirinixic acid results in increased expression of ACTC1 mRNA CTD PMID:17951219 Actc1 Rat progesterone decreases expression ISO ACTC1 (Homo sapiens) 6480464 Progesterone results in decreased expression of ACTC1 mRNA CTD PMID:21795739 Actc1 Rat propiconazole increases expression ISO Actc1 (Mus musculus) 6480464 propiconazole results in increased expression of ACTC1 mRNA CTD PMID:21278054 Actc1 Rat quercetin increases expression EXP 6480464 Quercetin results in increased expression of ACTC1 protein CTD PMID:18095365 Actc1 Rat SB 431542 multiple interactions ISO ACTC1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Actc1 Rat silicon dioxide decreases expression EXP 6480464 Silicon Dioxide results in decreased expression of ACTC1 mRNA CTD PMID:32721576 Actc1 Rat sodium arsenate increases expression ISO Actc1 (Mus musculus) 6480464 sodium arsenate results in increased expression of ACTC1 mRNA CTD PMID:21795629 Actc1 Rat sodium arsenite multiple interactions ISO ACTC1 (Homo sapiens) 6480464 monoisoamyl-2 and 3-dimercaptosuccinate inhibits the reaction [sodium arsenite results in decreased expression of ACTC1 mRNA] CTD PMID:19615344 Actc1 Rat sodium arsenite increases expression ISO ACTC1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of ACTC1 mRNA CTD PMID:38568856 Actc1 Rat sodium arsenite decreases expression ISO ACTC1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of ACTC1 mRNA CTD PMID:19615344 Actc1 Rat sodium fluoride decreases expression ISO Actc1 (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of ACTC1 protein CTD PMID:27548804 and PMID:28918527 Actc1 Rat sodium nitrate multiple interactions ISO Actc1 (Mus musculus) 6480464 sodium nitrate inhibits the reaction [Doxorubicin results in increased expression of ACTC1 protein] CTD PMID:21251210 Actc1 Rat streptozocin decreases expression EXP 6480464 Streptozocin results in decreased expression of ACTC1 protein CTD PMID:21136691 Actc1 Rat succimer multiple interactions ISO ACTC1 (Homo sapiens) 6480464 [Succimer co-treated with Magnetite Nanoparticles] results in decreased expression of ACTC1 mRNA CTD PMID:26378955 Actc1 Rat sulforaphane increases expression ISO Actc1 (Mus musculus) 6480464 sulforaphane results in increased expression of ACTC1 mRNA CTD PMID:30529165 Actc1 Rat sulforaphane decreases expression ISO ACTC1 (Homo sapiens) 6480464 sulforaphane results in decreased expression of ACTC1 mRNA CTD PMID:31838189 Actc1 Rat sunitinib decreases expression ISO ACTC1 (Homo sapiens) 6480464 Sunitinib results in decreased expression of ACTC1 mRNA CTD PMID:31533062 Actc1 Rat tamoxifen affects expression ISO Actc1 (Mus musculus) 6480464 Tamoxifen affects the expression of ACTC1 mRNA CTD PMID:17555576 Actc1 Rat titanium dioxide decreases expression ISO Actc1 (Mus musculus) 6480464 titanium dioxide results in decreased expression of ACTC1 mRNA CTD PMID:23557971 and PMID:35295148 Actc1 Rat toluene decreases expression ISO ACTC1 (Homo sapiens) 6480464 Toluene results in decreased expression of ACTC1 mRNA CTD PMID:26717081 Actc1 Rat toluene increases methylation ISO ACTC1 (Homo sapiens) 6480464 Toluene results in increased methylation of ACTC1 gene CTD PMID:26717081 Actc1 Rat trichloroethene decreases expression ISO Actc1 (Mus musculus) 6480464 Trichloroethylene results in decreased expression of ACTC1 mRNA CTD PMID:19448997 Actc1 Rat trichostatin A decreases expression ISO ACTC1 (Homo sapiens) 6480464 trichostatin A results in decreased expression of ACTC1 mRNA CTD PMID:24935251 Actc1 Rat triclosan decreases expression ISO ACTC1 (Homo sapiens) 6480464 Triclosan results in decreased expression of ACTC1 mRNA CTD PMID:30510588 Actc1 Rat urethane increases expression ISO ACTC1 (Homo sapiens) 6480464 Urethane results in increased expression of ACTC1 mRNA CTD PMID:28818685 Actc1 Rat valproic acid increases expression ISO ACTC1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of ACTC1 mRNA CTD PMID:23179753 Actc1 Rat valproic acid multiple interactions ISO ACTC1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of ACTC1 mRNA CTD PMID:27188386 Actc1 Rat valproic acid decreases expression ISO ACTC1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of ACTC1 mRNA CTD PMID:23179753 more ... Actc1 Rat valproic acid increases expression ISO Actc1 (Mus musculus) 6480464 Valproic Acid results in increased expression of ACTC1 mRNA CTD PMID:24896083 Actc1 Rat valproic acid affects expression ISO ACTC1 (Homo sapiens) 6480464 Valproic Acid affects the expression of ACTC1 mRNA CTD PMID:25979313 Actc1 Rat zinc atom decreases expression EXP 6480464 Zinc results in decreased expression of ACTC1 mRNA CTD PMID:17074742 Actc1 Rat zinc sulfate decreases expression EXP 6480464 Zinc Sulfate results in decreased expression of ACTC1 mRNA CTD PMID:17074742 Actc1 Rat zinc(0) decreases expression EXP 6480464 Zinc results in decreased expression of ACTC1 mRNA CTD PMID:17074742
Imported Annotations - KEGG (archival)
(1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,2,2-tetramine (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) acetic acid (ISO) acrolein (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) amphetamine (EXP) benzo[a]pyrene (ISO) bexarotene (EXP) bisphenol A (EXP,ISO) bisphenol F (ISO) cadmium dichloride (ISO) cantharidin (ISO) carbamazepine (ISO) carbon nanotube (ISO) carmustine (ISO) choline (ISO) chromium(6+) (ISO) clofibrate (ISO) cobalt atom (ISO) copper(II) sulfate (ISO) Cuprizon (EXP) cytarabine (ISO) decabromodiphenyl ether (EXP) dexamethasone (ISO) diethyl malate (ISO) dimethyl sulfoxide (ISO) dioxygen (ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP) entinostat (ISO) enzyme inhibitor (ISO) estriol (ISO) folic acid (ISO) formaldehyde (ISO) furan (EXP) graphite (EXP) hyaluronic acid (EXP) hydrogen peroxide (EXP) L-methionine (ISO) methamphetamine (ISO) methylmercury chloride (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) nickel subsulfide (EXP) nickel sulfate (ISO) nitrofen (EXP) ozone (EXP,ISO) p-chloromercuribenzoic acid (ISO) paracetamol (ISO) paraquat (EXP) PCB138 (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP) phenobarbital (EXP) pioglitazone (ISO) pirinixic acid (ISO) progesterone (ISO) propiconazole (ISO) quercetin (EXP) SB 431542 (ISO) silicon dioxide (EXP) sodium arsenate (ISO) sodium arsenite (ISO) sodium fluoride (ISO) sodium nitrate (ISO) streptozocin (EXP) succimer (ISO) sulforaphane (ISO) sunitinib (ISO) tamoxifen (ISO) titanium dioxide (ISO) toluene (ISO) trichloroethene (ISO) trichostatin A (ISO) triclosan (ISO) urethane (ISO) valproic acid (ISO) zinc atom (EXP) zinc sulfate (EXP) zinc(0) (EXP)
Biological Process
actin filament organization (IBA) actin filament-based movement (IEA,ISO) actin-mediated cell contraction (IEA) actin-myosin filament sliding (IBA,IEA,ISO) actomyosin structure organization (IEA,ISO) cardiac muscle contraction (IDA) cardiac muscle tissue morphogenesis (IEA,ISO) cardiac myofibril assembly (IEA,ISO) cytoplasmic actin-based contraction involved in cell motility (ISO) glomerular mesangial cell development (IEA) heart contraction (IBA,IEA,ISO) mesenchyme migration (ISS) negative regulation of apoptotic process (IEA,ISO) positive regulation of gene expression (ISS) regulation of blood pressure (IEA) response to ethanol (IEP) response to virus (IEA) response to xenobiotic stimulus (IEP) skeletal muscle fiber development (IEA) skeletal muscle thin filament assembly (IEA,ISO) vascular associated smooth muscle contraction (IEA)
Cellular Component
actin cytoskeleton (IBA,IEA) actin filament (IBA,IEA,ISO) cell body (ISS) cytoplasm (IEA,ISO,ISS) cytoskeleton (IEA) filopodium (ISS) glutamatergic synapse (IEA,ISO) I band (IEA,ISO) lamellipodium (ISS) motile cilium (IEA) protein-containing complex (IEA) sarcomere (IBA,IEA,ISO) smooth muscle contractile fiber (IEA) stress fiber (IEA) striated muscle thin filament (IEA) synapse (IEA,ISO)
1.
[Analysis of written enunciations of a patient as the basis for diagnosing schizophrenia]
Falicki Z, etal., Pol Tyg Lek 1978 Aug 7;33(32):1259-60.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Current estimates from the Health Interview Survey: United States--1977.
Howie LJ and Drury TF, Vital Health Stat 10 1978 Sep;(126):1-98.
4.
Expression of the genes coding for the skeletal muscle and cardiac actions in the heart.
Mayer Y, etal., Nucleic Acids Res 1984 Jan 25;12(2):1087-100.
5.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
6.
alpha-cardiac actin (ACTC) binds to the band 3 (AE1) cardiac isoform.
Moura Lima PR, etal., J Cell Biochem. 2003 Aug 15;89(6):1215-21.
7.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.
Actin mutations in dilated cardiomyopathy, a heritable form of heart failure.
Olson TM, etal., Science. 1998 May 1;280(5364):750-2.
9.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
10.
Endotoxin and cytokines alter contractile protein expression in cardiac myocytes in vivo.
Patten M, etal., Pflugers Arch. 2001 Sep;442(6):920-7.
11.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
12.
Medium perfusion enables engineering of compact and contractile cardiac tissue.
Radisic M, etal., Am J Physiol Heart Circ Physiol. 2004 Feb;286(2):H507-16. Epub 2003 Oct 9.
13.
GOA pipeline
RGD automated data pipeline
14.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
15.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
16.
Comprehensive gene review and curation
RGD comprehensive gene curation
17.
Age-related changes of cardiac gene expression following myocardial ischemia/reperfusion.
Simkhovich BZ, etal., Arch Biochem Biophys. 2003 Dec 15;420(2):268-78.
18.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
19.
Long-term alcohol administration inhibits synthesis of both myofibrillar and sarcoplasmic proteins in heart.
Vary TC and Deiter G, Metabolism. 2005 Feb;54(2):212-9.
20.
Nifedipine represses ion channels, transporters and Ca(2+)-binding proteins in hearts of spontaneously hypertensive rats.
Zwadlo C and Borlak J, Toxicol Appl Pharmacol. 2006 Jun 15;213(3):224-34. Epub 2005 Dec 15.
Actc1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 121,266,291 - 121,271,827 (-) NCBI GRCr8 mRatBN7.2 3 100,811,987 - 100,817,523 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 100,811,987 - 100,817,523 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 104,444,093 - 104,449,627 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 113,043,134 - 113,048,668 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 110,726,488 - 110,732,015 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 105,507,403 - 105,512,939 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 105,507,403 - 105,512,939 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 112,080,853 - 112,086,389 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 99,901,022 - 99,906,558 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 99,797,449 - 99,798,402 (-) NCBI Celera 3 99,781,510 - 99,787,044 (-) NCBI Celera Cytogenetic Map 3 q35 NCBI
ACTC1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 15 34,790,230 - 34,795,549 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 15 34,790,107 - 34,795,589 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 15 35,082,431 - 35,087,750 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 15 32,867,589 - 32,875,219 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 15 32,869,723 - 32,875,153 NCBI Celera 15 11,839,644 - 11,847,274 (-) NCBI Celera Cytogenetic Map 15 q14 ENTREZGENE HuRef 15 11,925,790 - 11,933,402 (-) NCBI HuRef CHM1_1 15 35,198,283 - 35,205,917 (-) NCBI CHM1_1 T2T-CHM13v2.0 15 32,595,427 - 32,600,746 (-) NCBI T2T-CHM13v2.0
Actc1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 113,877,763 - 113,883,356 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 113,877,763 - 113,884,029 (-) Ensembl GRCm39 Ensembl GRCm38 2 114,047,282 - 114,052,875 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 114,047,282 - 114,053,548 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 113,873,025 - 113,878,547 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 113,738,730 - 113,744,252 (-) NCBI MGSCv36 mm8 Celera 2 115,178,495 - 115,181,826 (-) NCBI Celera Cytogenetic Map 2 E4 NCBI cM Map 2 57.55 NCBI
Actc1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955416 2,137,101 - 2,145,416 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955416 2,139,541 - 2,144,678 (-) NCBI ChiLan1.0 ChiLan1.0
LOC100987752 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 16 24,005,887 - 24,013,787 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 15 28,151,250 - 28,162,184 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 15 13,707,475 - 13,712,905 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 15 31,966,278 - 31,971,782 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 15 31,966,278 - 31,971,782 (-) Ensembl panpan1.1 panPan2
ACTC1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 30 2,514,825 - 2,519,398 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 30 2,514,824 - 2,519,382 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 30 2,565,508 - 2,570,605 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 30 2,629,472 - 2,634,566 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 30 2,629,472 - 2,634,456 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 30 2,564,616 - 2,569,707 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 30 2,663,927 - 2,669,017 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 30 2,792,736 - 2,797,835 (-) NCBI UU_Cfam_GSD_1.0
Actc1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 81,053,582 - 81,059,040 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936673 1,092,717 - 1,100,331 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936673 1,092,700 - 1,098,256 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ACTC1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 136,281,167 - 136,286,547 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 136,281,119 - 136,286,551 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 152,412,178 - 152,417,610 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ACTC1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 26 48,105,271 - 48,110,670 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 26 48,105,216 - 48,110,896 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666048 92,799,132 - 92,804,294 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Actc1
.
Predicted Target Of
Count of predictions: 119 Count of miRNA genes: 95 Interacting mature miRNAs: 99 Transcripts: ENSRNOT00000011773 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2312673 Scl63 Serum cholesterol level QTL 63 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 3 98535255 168026850 Rat 2301414 Kidm37 Kidney mass QTL 37 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 70653097 121056321 Rat 1582238 Bw68 Body weight QTL 68 3.2 0.0064 body mass (VT:0001259) body weight (CMO:0000012) 3 53184593 115665732 Rat 2302373 Gluco39 Glucose level QTL 39 5.01 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 3 98535386 161695835 Rat 1582239 Epfw1 Epididymal fat weight QTL 1 4.5 0.0006 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 3 53184593 115665732 Rat 70216 Cm14 Cardiac mass QTL 14 2.1 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 31172320 163586636 Rat 2292591 Esta4 Estrogen-induced thymic atrophy QTL 4 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 3 47233211 147415807 Rat 1358362 Srcrt2 Stress Responsive Cort QTL 2 2.78 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 3 38192233 133483320 Rat 737818 Hcar12 Hepatocarcinoma resistance QTL 12 2.6 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 3 29463235 118376539 Rat 1582218 Bw74 Body weight QTL 74 3.9 0.0021 body mass (VT:0001259) body weight (CMO:0000012) 3 53184593 115665732 Rat 1582219 Bw63 Body weight QTL 63 3.8 0.001 body mass (VT:0001259) body weight (CMO:0000012) 3 96127817 115665732 Rat 1582221 Kidm30 Kidney mass QTL 30 3.5 0.0008 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 3 64655305 115665732 Rat 1581568 Rf53 Renal function QTL 53 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 3 56395968 161299569 Rat 1582210 Bw71 Body weight QTL 71 3.3 0.0012 body mass (VT:0001259) body weight (CMO:0000012) 3 64655305 115665732 Rat 7387306 Bw124 Body weight QTL 124 3.2 0.0003 body mass (VT:0001259) body weight (CMO:0000012) 3 84091273 129091273 Rat 1300111 Rf12 Renal function QTL 12 3.78 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 3 61017749 121056321 Rat 724523 Tsu1 Thymus enlargement suppressive QTL 1 3.84 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 3 50437504 115638231 Rat 1600376 Arunc5 Aerobic running capacity QTL 5 0.21 exercise endurance trait (VT:0002332) maximum distance run on treadmill (CMO:0001406) 3 73376539 118376539 Rat 8694437 Bw167 Body weight QTL 167 22.46 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 3 91797474 136797474 Rat 2302273 Gluco35 Glucose level QTL 35 5.3 0.001 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 80800231 114297550 Rat 8662816 Vetf4 Vascular elastic tissue fragility QTL 4 4 renal artery integrity trait (VT:0010642) number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563) 3 59242096 157323038 Rat 1559282 Emca5 Estrogen-induced mammary cancer QTL 5 3.9 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 3 43827364 169034231 Rat 1581503 Cm58 Cardiac mass QTL 58 2.7 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 43827364 121056321 Rat 2292613 Ept16 Estrogen-induced pituitary tumorigenesis QTL 16 8.3 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 3 47233430 110362260 Rat 1354611 Despr2 Despair related QTL 2 3.03 0.0028 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 3 97084464 142084464 Rat 631649 Bp123 Blood pressure QTL 123 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 89772419 134772419 Rat 631841 Niddm39 Non-insulin dependent diabetes mellitus QTL 39 3.36 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 94856903 159898684 Rat 12879848 Bw181 Body weght QTL 181 0.015 body mass (VT:0001259) body weight (CMO:0000012) 3 70348525 121056321 Rat 2301971 Cm71 Cardiac mass QTL 71 4.63 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 3 41874578 155617519 Rat 2312659 Slep7 Serum leptin concentration QTL 7 0.001 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 3 98535255 168026850 Rat 1358885 Bp251 Blood pressure QTL 251 3.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 1354597 Kidm13 Kidney mass QTL 13 2.9 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 3 41874578 104104347 Rat 2301970 Bw81 Body weight QTL 81 5.19 body mass (VT:0001259) body weight (CMO:0000012) 3 41874578 155617519 Rat 1581546 Pur13 Proteinuria QTL 13 2.93 0.0335 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 3 78196190 146592722 Rat 1582252 Sual1 Serum uric acid level QTL 1 3.4 0.0123 blood uric acid amount (VT:0010302) blood uric acid level (CMO:0000501) 3 96127817 102200699 Rat 1354604 Bw36 Body weight QTL 36 2.9 body mass (VT:0001259) body weight (CMO:0000012) 3 33703347 104104347 Rat 631665 Bw8 Body weight QTL 8 5.5 body mass (VT:0001259) body weight (CMO:0000012) 3 50437042 119183768 Rat 1358888 Bp264 Blood pressure QTL 264 4.43 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 2293087 Iddm27 Insulin dependent diabetes mellitus QTL 27 2.68 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 97551417 147415807 Rat 2312670 Bw94 Body weight QTL 94 0.01 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 3 98535255 168026850 Rat 1358186 Ept2 Estrogen-induced pituitary tumorigenesis QTL 2 8.3 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 3 47233430 110362260 Rat 724532 Cm17 Cardiac mass QTL 17 2 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 3 95735366 140735366 Rat
BG373920
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 100,811,733 - 100,811,903 (+) MAPPER mRatBN7.2 Rnor_6.0 3 105,507,150 - 105,507,319 NCBI Rnor6.0 Rnor_5.0 3 112,080,600 - 112,080,769 UniSTS Rnor5.0 RGSC_v3.4 3 99,900,769 - 99,900,938 UniSTS RGSC3.4 Celera 3 99,781,257 - 99,781,426 UniSTS RH 3.4 Map 3 815.2 UniSTS Cytogenetic Map 3 q35 UniSTS
LOC345651
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,664,470 - 11,665,066 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,717,202 - 13,717,797 NCBI Rnor6.0 Rnor_5.0 12 15,747,215 - 15,747,810 UniSTS Rnor5.0 RGSC_v3.4 12 12,048,429 - 12,049,024 UniSTS RGSC3.4 Celera 12 13,453,802 - 13,454,397 UniSTS Cytogenetic Map 12 p11 UniSTS Cytogenetic Map 19 q12 UniSTS Cytogenetic Map 3 q35 UniSTS
STS_ADH2
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 100,812,851 - 100,813,988 (+) MAPPER mRatBN7.2 mRatBN7.2 4 37,621,193 - 37,621,465 (+) MAPPER mRatBN7.2 Rnor_6.0 4 35,593,637 - 35,593,908 NCBI Rnor6.0 Rnor_6.0 3 105,508,268 - 105,509,404 NCBI Rnor6.0 Rnor_5.0 4 35,451,038 - 35,451,309 UniSTS Rnor5.0 Rnor_5.0 3 112,081,718 - 112,082,854 UniSTS Rnor5.0 RGSC_v3.4 3 99,901,887 - 99,903,023 UniSTS RGSC3.4 RGSC_v3.4 4 34,652,200 - 34,652,471 UniSTS RGSC3.4 Celera 4 33,105,107 - 33,105,378 UniSTS Celera 3 99,782,375 - 99,783,511 UniSTS Cytogenetic Map 3 q35 UniSTS Cytogenetic Map 4 q21 UniSTS Cytogenetic Map 4 q34 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
8
11
49
100
68
68
37
24
37
6
190
95
81
42
56
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000011773 ⟹ ENSRNOP00000011773
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 100,811,987 - 100,817,523 (-) Ensembl Rnor_6.0 Ensembl 3 105,507,403 - 105,512,939 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000116592 ⟹ ENSRNOP00000082679
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 100,811,987 - 100,817,523 (-) Ensembl
RefSeq Acc Id:
NM_019183 ⟹ NP_062056
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 121,266,291 - 121,271,827 (-) NCBI mRatBN7.2 3 100,811,987 - 100,817,523 (-) NCBI Rnor_6.0 3 105,507,403 - 105,512,939 (-) NCBI Rnor_5.0 3 112,080,853 - 112,086,389 (-) NCBI RGSC_v3.4 3 99,901,022 - 99,906,558 (-) RGD Celera 3 99,781,510 - 99,787,044 (-) RGD
Sequence:
GACCAAATAAGGCAAGGTGGCAGCTCAGGGGCCCTCCACCCCTGCCCCCGGCTGCTCCAACTGACCCCGTCCATCAGCGCGCTATAAAGCCGCGCTCCAGGCGACTGTCACCTAGTGCCTGCCACCAG
hide sequence
RefSeq Acc Id:
NP_062056 ⟸ NM_019183
- UniProtKB:
A0JPJ4 (UniProtKB/Swiss-Prot), P68035 (UniProtKB/Swiss-Prot), A6HP76 (UniProtKB/TrEMBL), A0A0G2K4M6 (UniProtKB/TrEMBL), A0A8I5ZVP6 (UniProtKB/TrEMBL)
- Sequence:
MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFET
hide sequence
Ensembl Acc Id:
ENSRNOP00000011773 ⟸ ENSRNOT00000011773
Ensembl Acc Id:
ENSRNOP00000082679 ⟸ ENSRNOT00000116592
RGD ID: 13692298 Promoter ID: EPDNEW_R2822 Type: single initiation site Name: Actc1_1 Description: actin, alpha, cardiac muscle 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 3 105,512,826 - 105,512,886 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-05-15
Actc1
actin, alpha, cardiac muscle 1
Actc1
actin, alpha, cardiac 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-03-12
Actc1
actin, alpha, cardiac 1
Actc1
actin alpha cardiac 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Actc1
actin alpha cardiac 1
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_expression
expressed in cardiac muscle
69737
gene_homology
gene has high similarity to the skeletal muscle actin Acta1 except for high divergence in the 3' untranslated sequence
69737
gene_homology
has high similarity over 3'untranslated sequence with human cardiac muscle actin
69737
gene_product
member of the actin family
69737
