Symbol:
Acta1
Name:
actin, alpha 1, skeletal muscle
RGD ID:
2025
Description:
Predicted to enable ATP binding activity; hydrolase activity; and protein kinase binding activity. Involved in several processes, including cellular response to potassium ion; response to steroid hormone; and skeletal muscle fiber adaptation. Predicted to be located in several cellular components, including filopodium; lamellipodium; and sarcomere. Predicted to be part of protein-containing complex. Predicted to be active in actin filament; stress fiber; and striated muscle thin filament. Human ortholog(s) of this gene implicated in congenital myopathy 2B; congenital myopathy 2C; and nemaline myopathy 3. Orthologous to human ACTA1 (actin alpha 1, skeletal muscle); INTERACTS WITH (+)-schisandrin B; (R)-noradrenaline; (S)-nicotine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
actin alpha 1; actin alpha 1 skeletal muscle; actin, alpha skeletal muscle; alpha-actin-1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ACTA1 (actin alpha 1, skeletal muscle) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Acta1 (actin alpha 1, skeletal muscle) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Acta1 (actin alpha 1, skeletal muscle) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ACTA1 (actin alpha 1, skeletal muscle) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ACTA1 (actin alpha 1, skeletal muscle) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Acta1 (actin alpha 1, skeletal muscle) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ACTA1 (actin alpha 1, skeletal muscle) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ACTA1 (actin alpha 1, skeletal muscle) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Acta1 (actin alpha 1, skeletal muscle) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
NUDT18 (nudix hydrolase 18) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
ACTA1 (actin alpha 1, skeletal muscle)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Acta1 (actin alpha 1, skeletal muscle)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
acta1a (actin alpha 1, skeletal muscle a)
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector)
Danio rerio (zebrafish):
acta1b (actin alpha 1, skeletal muscle b)
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder)
Saccharomyces cerevisiae (baker's yeast):
ACT1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
mgc75582
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder)
Xenopus tropicalis (tropical clawed frog):
acta1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 68,781,168 - 68,784,194 (-) NCBI GRCr8 mRatBN7.2 19 51,883,709 - 51,886,735 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 51,883,715 - 51,886,742 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 58,675,301 - 58,678,329 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 59,519,721 - 59,522,747 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 61,601,732 - 61,604,760 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 56,674,072 - 56,677,084 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 56,674,074 - 56,677,084 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 67,389,899 - 67,392,911 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 54,081,496 - 54,084,508 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 19 54,086,370 - 54,089,389 (-) NCBI Celera 19 51,258,256 - 51,261,324 (-) NCBI Celera Cytogenetic Map 19 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Acta1 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of ACTA1 mRNA] CTD PMID:31150632 Acta1 Rat (R)-noradrenaline increases expression EXP 6480464 Norepinephrine results in increased expression of ACTA1 mRNA CTD PMID:17592507 Acta1 Rat (S)-nicotine increases expression ISO Acta1 (Mus musculus) 6480464 Nicotine results in increased expression of ACTA1 mRNA CTD PMID:17997037 Acta1 Rat (S)-nicotine decreases expression EXP 6480464 Nicotine results in decreased expression of ACTA1 mRNA CTD PMID:27782041 Acta1 Rat 1,2-dimethylhydrazine multiple interactions ISO Acta1 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of ACTA1 mRNA] CTD PMID:22206623 Acta1 Rat 1,2-dimethylhydrazine increases expression ISO Acta1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of ACTA1 mRNA CTD PMID:22206623 Acta1 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of ACTA1 mRNA CTD PMID:30723492 Acta1 Rat 17beta-estradiol decreases expression ISO Acta1 (Mus musculus) 6480464 Estradiol results in decreased expression of ACTA1 mRNA CTD PMID:19484750 Acta1 Rat 17beta-estradiol increases expression ISO Acta1 (Mus musculus) 6480464 Estradiol results in increased expression of ACTA1 mRNA CTD PMID:39298647 Acta1 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of ACTA1 mRNA CTD PMID:32145629 Acta1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of ACTA1 mRNA CTD PMID:19692669 and PMID:32109520 Acta1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of ACTA1 mRNA CTD PMID:34747641 Acta1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Acta1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ACTA1 mRNA CTD PMID:26377647 Acta1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO ACTA1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of ACTA1 mRNA CTD PMID:26238291 Acta1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Acta1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of ACTA1 mRNA CTD PMID:15591033 and PMID:19770486 Acta1 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Acta1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Acta1 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Acta1 Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:19692669 Acta1 Rat 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3 more ... CTD PMID:32119087 Acta1 Rat 3-methylcholanthrene decreases expression ISO Acta1 (Mus musculus) 6480464 Methylcholanthrene results in decreased expression of ACTA1 mRNA CTD PMID:29554273 Acta1 Rat 4,4'-sulfonyldiphenol affects expression ISO Acta1 (Mus musculus) 6480464 bisphenol S affects the expression of ACTA1 mRNA CTD PMID:30951980 Acta1 Rat 4,4'-sulfonyldiphenol decreases expression ISO Acta1 (Mus musculus) 6480464 bisphenol S results in decreased expression of ACTA1 mRNA CTD PMID:34850234 Acta1 Rat 4-hydroxynon-2-enal affects binding EXP 6480464 4-hydroxy-2-nonenal binds to ACTA1 protein CTD PMID:15886073 Acta1 Rat 5-aza-2'-deoxycytidine increases expression ISO Acta1 (Mus musculus) 6480464 Decitabine results in increased expression of ACTA1 mRNA CTD PMID:27915011 Acta1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of ACTA1 mRNA CTD PMID:25825206 Acta1 Rat aconitine decreases expression EXP 6480464 Aconitine results in decreased expression of ACTA1 protein CTD PMID:33236894 Acta1 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of ACTA1 mRNA CTD PMID:28606764 Acta1 Rat actinomycin D multiple interactions ISO ACTA1 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of ACTA1 protein CTD PMID:38460933 Acta1 Rat aflatoxin B1 decreases expression ISO Acta1 (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of ACTA1 mRNA CTD PMID:19770486 Acta1 Rat aldehydo-D-glucose multiple interactions ISO Acta1 (Mus musculus) 6480464 [lard co-treated with Cholesterol more ... CTD PMID:33448797 and PMID:37567420 Acta1 Rat aldehydo-D-glucose multiple interactions EXP 6480464 HMOX1 protein affects the reaction [Propofol inhibits the reaction [Glucose results in increased expression of ACTA1 mRNA]] more ... CTD PMID:24810525 Acta1 Rat aldehydo-D-glucose increases expression EXP 6480464 Glucose results in increased expression of ACTA1 mRNA CTD PMID:24810525 Acta1 Rat aldehydo-D-glucose decreases expression ISO Acta1 (Mus musculus) 6480464 Glucose results in decreased expression of ACTA1 mRNA CTD PMID:33448797 Acta1 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of ACTA1 mRNA CTD PMID:35163327 Acta1 Rat alpha-Zearalanol decreases expression EXP 6480464 Zeranol results in decreased expression of ACTA1 mRNA CTD PMID:35163327 Acta1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of ACTA1 mRNA CTD PMID:16483693 Acta1 Rat aristolochic acid A increases expression ISO ACTA1 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of ACTA1 mRNA CTD PMID:33212167 Acta1 Rat arsane decreases expression EXP 6480464 Arsenic results in decreased expression of ACTA1 mRNA CTD PMID:18315880 Acta1 Rat arsane multiple interactions ISO Acta1 (Mus musculus) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of ACTA1 mRNA CTD PMID:33481702 Acta1 Rat arsenic atom decreases expression EXP 6480464 Arsenic results in decreased expression of ACTA1 mRNA CTD PMID:18315880 Acta1 Rat arsenic atom multiple interactions ISO Acta1 (Mus musculus) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of ACTA1 mRNA CTD PMID:33481702 Acta1 Rat arsenite(3-) increases expression ISO Acta1 (Mus musculus) 6480464 arsenite results in increased expression of ACTA1 mRNA CTD PMID:18191166 Acta1 Rat arsenite(3-) decreases expression ISO Acta1 (Mus musculus) 6480464 arsenite results in decreased expression of ACTA1 protein CTD PMID:37955338 Acta1 Rat arsenite(3-) increases methylation ISO ACTA1 (Homo sapiens) 6480464 arsenite results in increased methylation of ACTA1 promoter CTD PMID:23974009 Acta1 Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of ACTA1 gene CTD PMID:35440735 Acta1 Rat benzo[a]pyrene affects expression ISO Acta1 (Mus musculus) 6480464 Benzo(a)pyrene affects the expression of ACTA1 mRNA CTD PMID:20127859 Acta1 Rat benzo[a]pyrene increases methylation ISO ACTA1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of ACTA1 3' UTR and Benzo(a)pyrene results in increased methylation of ACTA1 promoter CTD PMID:27901495 Acta1 Rat benzo[a]pyrene affects methylation ISO ACTA1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of ACTA1 5' UTR CTD PMID:27901495 Acta1 Rat benzo[a]pyrene increases expression ISO ACTA1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of ACTA1 mRNA CTD PMID:26238291 Acta1 Rat benzo[a]pyrene decreases expression ISO ACTA1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of ACTA1 mRNA CTD PMID:21632981 and PMID:22316170 Acta1 Rat Benzo[ghi]perylene decreases expression ISO Acta1 (Mus musculus) 6480464 1 and 12-benzoperylene results in decreased expression of ACTA1 mRNA CTD PMID:26377693 Acta1 Rat bis(2-ethylhexyl) phthalate decreases expression EXP 6480464 Diethylhexyl Phthalate results in decreased expression of ACTA1 mRNA CTD PMID:20920545 Acta1 Rat bis(2-ethylhexyl) phthalate increases expression ISO ACTA1 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of ACTA1 mRNA CTD PMID:31163220 Acta1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ACTA1 mRNA CTD PMID:25181051 and PMID:34947998 Acta1 Rat bisphenol A decreases expression ISO Acta1 (Mus musculus) 6480464 bisphenol A results in decreased expression of ACTA1 mRNA CTD PMID:34850234 and PMID:37105096 Acta1 Rat bisphenol A decreases expression ISO ACTA1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of ACTA1 protein CTD PMID:33376534 Acta1 Rat bisphenol A multiple interactions ISO ACTA1 (Homo sapiens) 6480464 [ginger extract results in increased abundance of Oils and Volatile] inhibits the reaction [bisphenol A results in decreased expression of ACTA1 protein] CTD PMID:33376534 Acta1 Rat bisphenol A increases expression ISO Acta1 (Mus musculus) 6480464 bisphenol A results in increased expression of ACTA1 mRNA CTD PMID:30951980 Acta1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of ACTA1 mRNA CTD PMID:30903817 and PMID:32145629 Acta1 Rat bisphenol F increases expression ISO Acta1 (Mus musculus) 6480464 bisphenol F results in increased expression of ACTA1 mRNA CTD PMID:30951980 and PMID:38685157 Acta1 Rat butanal increases expression ISO ACTA1 (Homo sapiens) 6480464 butyraldehyde results in increased expression of ACTA1 mRNA CTD PMID:26079696 Acta1 Rat cadmium atom decreases expression EXP 6480464 Cadmium results in decreased expression of ACTA1 mRNA CTD PMID:17327700 Acta1 Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of ACTA1 mRNA CTD PMID:17327700 Acta1 Rat calcitriol multiple interactions ISO ACTA1 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of ACTA1 mRNA CTD PMID:21592394 Acta1 Rat calcitriol increases expression ISO ACTA1 (Homo sapiens) 6480464 Calcitriol results in increased expression of ACTA1 mRNA CTD PMID:21592394 Acta1 Rat cantharidin decreases expression ISO Acta1 (Mus musculus) 6480464 Cantharidin results in decreased expression of ACTA1 mRNA CTD PMID:36907384 Acta1 Rat carbamazepine affects expression ISO ACTA1 (Homo sapiens) 6480464 Carbamazepine affects the expression of ACTA1 mRNA CTD PMID:24752500 and PMID:25979313 Acta1 Rat carbon nanotube increases expression ISO Acta1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Acta1 Rat carbon nanotube affects expression ISO Acta1 (Mus musculus) 6480464 Nanotubes and Carbon analog affects the expression of ACTA1 mRNA CTD PMID:25620056 Acta1 Rat choline multiple interactions ISO Acta1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of ACTA1 mRNA CTD PMID:20938992 Acta1 Rat chrysene increases expression ISO Acta1 (Mus musculus) 6480464 chrysene results in increased expression of ACTA1 mRNA CTD PMID:26377693 Acta1 Rat copper(II) sulfate increases expression ISO ACTA1 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of ACTA1 mRNA CTD PMID:19549813 Acta1 Rat corticosterone increases expression EXP 6480464 Corticosterone results in increased expression of ACTA1 mRNA CTD PMID:15755911 Acta1 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of ACTA1 mRNA CTD PMID:26577399 and PMID:27523638 Acta1 Rat cyclosporin A increases expression ISO ACTA1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of ACTA1 mRNA CTD PMID:21632981 and PMID:25562108 Acta1 Rat cyclosporin A decreases expression ISO ACTA1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of ACTA1 mRNA CTD PMID:27989131 Acta1 Rat cylindrospermopsin decreases expression ISO ACTA1 (Homo sapiens) 6480464 cylindrospermopsin results in decreased expression of ACTA1 protein CTD PMID:27494769 Acta1 Rat cytarabine increases expression ISO ACTA1 (Homo sapiens) 6480464 Cytarabine results in increased expression of ACTA1 mRNA CTD PMID:21198554 Acta1 Rat D-glucose multiple interactions ISO Acta1 (Mus musculus) 6480464 [lard co-treated with Cholesterol more ... CTD PMID:33448797 and PMID:37567420 Acta1 Rat D-glucose increases expression EXP 6480464 Glucose results in increased expression of ACTA1 mRNA CTD PMID:24810525 Acta1 Rat D-glucose multiple interactions EXP 6480464 HMOX1 protein affects the reaction [Propofol inhibits the reaction [Glucose results in increased expression of ACTA1 mRNA]] more ... CTD PMID:24810525 Acta1 Rat D-glucose decreases expression ISO Acta1 (Mus musculus) 6480464 Glucose results in decreased expression of ACTA1 mRNA CTD PMID:33448797 Acta1 Rat daunorubicin decreases expression ISO ACTA1 (Homo sapiens) 6480464 Daunorubicin results in decreased expression of ACTA1 mRNA CTD PMID:26537877 and PMID:28940058 Acta1 Rat deoxynivalenol affects phosphorylation ISO Acta1 (Mus musculus) 6480464 deoxynivalenol affects the phosphorylation of ACTA1 protein CTD PMID:23811945 Acta1 Rat diclofenac affects expression ISO ACTA1 (Homo sapiens) 6480464 Diclofenac affects the expression of ACTA1 mRNA CTD PMID:24752500 Acta1 Rat dicrotophos increases expression ISO ACTA1 (Homo sapiens) 6480464 dicrotophos results in increased expression of ACTA1 mRNA CTD PMID:28302478 Acta1 Rat diethylstilbestrol decreases expression ISO Acta1 (Mus musculus) 6480464 Diethylstilbestrol results in decreased expression of ACTA1 mRNA CTD PMID:16636312 and PMID:17394237 Acta1 Rat diisononyl phthalate increases expression ISO Acta1 (Mus musculus) 6480464 diisononyl phthalate results in increased expression of ACTA1 mRNA CTD PMID:33391822 Acta1 Rat dioxygen multiple interactions ISO Acta1 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of ACTA1 mRNA CTD PMID:30529165 Acta1 Rat dioxygen multiple interactions EXP 6480464 [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in increased expression of ACTA1 mRNA CTD PMID:33729688 Acta1 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of ACTA1 mRNA CTD PMID:25152437 Acta1 Rat dorsomorphin multiple interactions ISO ACTA1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Acta1 Rat doxorubicin multiple interactions ISO Acta1 (Mus musculus) 6480464 DMD protein affects the reaction [Doxorubicin results in decreased expression of ACTA1 mRNA] CTD PMID:17888722 Acta1 Rat doxorubicin affects expression ISO ACTA1 (Homo sapiens) 6480464 Doxorubicin affects the expression of ACTA1 protein CTD PMID:29385562 Acta1 Rat doxorubicin decreases expression ISO ACTA1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of ACTA1 mRNA CTD PMID:26537877 more ... Acta1 Rat doxorubicin decreases expression ISO Acta1 (Mus musculus) 6480464 Doxorubicin results in decreased expression of ACTA1 mRNA CTD PMID:17888722 and PMID:28608983 Acta1 Rat emodin decreases expression ISO ACTA1 (Homo sapiens) 6480464 Emodin results in decreased expression of ACTA1 mRNA CTD PMID:16045814 Acta1 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of ACTA1 mRNA CTD PMID:29391264 Acta1 Rat entinostat multiple interactions ISO ACTA1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of ACTA1 mRNA CTD PMID:27188386 Acta1 Rat entinostat decreases expression ISO ACTA1 (Homo sapiens) 6480464 entinostat results in decreased expression of ACTA1 mRNA CTD PMID:26272509 Acta1 Rat ethanol affects expression ISO Acta1 (Mus musculus) 6480464 Ethanol affects the expression of ACTA1 mRNA CTD PMID:30319688 Acta1 Rat etoposide decreases expression ISO ACTA1 (Homo sapiens) 6480464 Etoposide results in decreased expression of ACTA1 mRNA CTD PMID:29397400 Acta1 Rat fenthion increases expression ISO Acta1 (Mus musculus) 6480464 Fenthion results in increased expression of ACTA1 mRNA CTD PMID:34813904 Acta1 Rat flurbiprofen decreases expression ISO Acta1 (Mus musculus) 6480464 Flurbiprofen results in decreased expression of ACTA1 mRNA CTD PMID:16949054 Acta1 Rat folic acid multiple interactions ISO Acta1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of ACTA1 mRNA more ... CTD PMID:20938992 and PMID:22206623 Acta1 Rat folic acid decreases expression ISO ACTA1 (Homo sapiens) 6480464 Folic Acid results in decreased expression of ACTA1 mRNA CTD PMID:21867686 Acta1 Rat fructose multiple interactions ISO Acta1 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in increased expression of ACTA1 mRNA CTD PMID:37567420 Acta1 Rat fucoxanthin multiple interactions ISO Acta1 (Mus musculus) 6480464 fucoxanthin inhibits the reaction [Glucose results in decreased expression of ACTA1 mRNA] CTD PMID:33448797 Acta1 Rat fulvestrant increases methylation ISO ACTA1 (Homo sapiens) 6480464 Fulvestrant results in increased methylation of ACTA1 gene CTD PMID:31601247 Acta1 Rat furan increases expression EXP 6480464 furan results in increased expression of ACTA1 mRNA CTD PMID:27387713 Acta1 Rat genistein decreases expression ISO Acta1 (Mus musculus) 6480464 Genistein results in decreased expression of ACTA1 mRNA CTD PMID:32186404 Acta1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of ACTA1 mRNA CTD PMID:33387578 Acta1 Rat glucose decreases expression ISO Acta1 (Mus musculus) 6480464 Glucose results in decreased expression of ACTA1 mRNA CTD PMID:33448797 Acta1 Rat glucose multiple interactions EXP 6480464 HMOX1 protein affects the reaction [Propofol inhibits the reaction [Glucose results in increased expression of ACTA1 mRNA]] more ... CTD PMID:24810525 Acta1 Rat glucose increases expression EXP 6480464 Glucose results in increased expression of ACTA1 mRNA CTD PMID:24810525 Acta1 Rat glucose multiple interactions ISO Acta1 (Mus musculus) 6480464 [lard co-treated with Cholesterol more ... CTD PMID:33448797 and PMID:37567420 Acta1 Rat graphite increases expression ISO Acta1 (Mus musculus) 6480464 Graphite results in increased expression of ACTA1 mRNA CTD PMID:27440207 Acta1 Rat GSK2181236A decreases expression EXP 25824851 GSK2181236A decreases expression of Acta1 mRNA in rat myocardium RGD Acta1 Rat hydralazine multiple interactions EXP 6480464 Hydralazine inhibits the reaction [Nitric Oxide deficiency results in increased expression of ACTA1 mRNA] CTD PMID:16326922 Acta1 Rat hydrochlorothiazide multiple interactions EXP 6480464 Hydrochlorothiazide inhibits the reaction [Nitric Oxide deficiency results in increased expression of ACTA1 mRNA] CTD PMID:16326922 Acta1 Rat hydrogen peroxide affects expression ISO ACTA1 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of ACTA1 mRNA CTD PMID:20044591 Acta1 Rat inulin multiple interactions ISO Acta1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of ACTA1 mRNA CTD PMID:36331819 Acta1 Rat isoprenaline multiple interactions ISO Acta1 (Mus musculus) 6480464 [Phenylephrine co-treated with Isoproterenol] results in increased expression of ACTA1 mRNA and EGR1 protein affects the reaction [[Phenylephrine co-treated with Isoproterenol] results in increased expression of ACTA1 mRNA] CTD PMID:10710348 Acta1 Rat ivermectin decreases expression ISO ACTA1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of ACTA1 protein CTD PMID:32959892 Acta1 Rat L-methionine multiple interactions ISO Acta1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of ACTA1 mRNA CTD PMID:20938992 Acta1 Rat lead nitrate increases expression ISO Acta1 (Mus musculus) 6480464 lead nitrate results in increased expression of ACTA1 protein CTD PMID:20435106 Acta1 Rat leflunomide increases expression ISO ACTA1 (Homo sapiens) 6480464 leflunomide results in increased expression of ACTA1 mRNA CTD PMID:28988120 Acta1 Rat Licochalcone B increases expression ISO ACTA1 (Homo sapiens) 6480464 licochalcone B results in increased expression of ACTA1 mRNA CTD PMID:33647349 Acta1 Rat manganese atom decreases expression EXP 6480464 Manganese results in decreased expression of ACTA1 mRNA CTD PMID:26745496 Acta1 Rat manganese(0) decreases expression EXP 6480464 Manganese results in decreased expression of ACTA1 mRNA CTD PMID:26745496 Acta1 Rat manganese(II) chloride decreases expression EXP 6480464 manganese chloride results in decreased expression of ACTA1 mRNA CTD PMID:26745496 Acta1 Rat metformin increases expression EXP 6480464 Metformin results in increased expression of ACTA1 mRNA CTD PMID:31324951 Acta1 Rat mitoxantrone decreases expression ISO ACTA1 (Homo sapiens) 6480464 Mitoxantrone results in decreased expression of ACTA1 mRNA CTD PMID:26537877 and PMID:28940058 Acta1 Rat Monobutylphthalate increases expression ISO Acta1 (Mus musculus) 6480464 monobutyl phthalate results in increased expression of ACTA1 protein CTD PMID:20553848 Acta1 Rat Monobutylphthalate decreases expression ISO Acta1 (Mus musculus) 6480464 monobutyl phthalate results in decreased expression of ACTA1 mRNA CTD PMID:35278568 Acta1 Rat naphthalene affects binding ISO Acta1 (Mus musculus) 6480464 naphthalene metabolite binds to ACTA1 protein CTD PMID:15892573 and PMID:16206326 Acta1 Rat nickel sulfate increases expression ISO Acta1 (Mus musculus) 6480464 nickel sulfate results in increased expression of ACTA1 mRNA CTD PMID:16166746 Acta1 Rat nicotine increases expression ISO Acta1 (Mus musculus) 6480464 Nicotine results in increased expression of ACTA1 mRNA CTD PMID:17997037 Acta1 Rat nicotine decreases expression EXP 6480464 Nicotine results in decreased expression of ACTA1 mRNA CTD PMID:27782041 Acta1 Rat nitric oxide multiple interactions EXP 6480464 Hydralazine inhibits the reaction [Nitric Oxide deficiency results in increased expression of ACTA1 mRNA] and Hydrochlorothiazide inhibits the reaction [Nitric Oxide deficiency results in increased expression of ACTA1 mRNA] CTD PMID:16326922 Acta1 Rat nitric oxide increases expression EXP 6480464 Nitric Oxide deficiency results in increased expression of ACTA1 mRNA CTD PMID:10397678 and PMID:16326922 Acta1 Rat Nutlin-3 multiple interactions ISO ACTA1 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of ACTA1 protein CTD PMID:38460933 Acta1 Rat ozone decreases expression ISO Acta1 (Mus musculus) 6480464 Ozone results in decreased expression of ACTA1 mRNA CTD PMID:12763052 Acta1 Rat p-anisidine decreases expression ISO ACTA1 (Homo sapiens) 6480464 4-anisidine results in decreased expression of ACTA1 mRNA CTD PMID:22623647 Acta1 Rat p-chloromercuribenzoic acid increases expression ISO ACTA1 (Homo sapiens) 6480464 p-Chloromercuribenzoic Acid results in increased expression of ACTA1 mRNA CTD PMID:26272509 Acta1 Rat p-chloromercuribenzoic acid multiple interactions ISO ACTA1 (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ACTA1 mRNA CTD PMID:27188386 Acta1 Rat paracetamol affects expression ISO Acta1 (Mus musculus) 6480464 Acetaminophen affects the expression of ACTA1 mRNA CTD PMID:17562736 Acta1 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of ACTA1 mRNA CTD PMID:32680482 Acta1 Rat perfluorooctane-1-sulfonic acid decreases expression ISO Acta1 (Mus musculus) 6480464 perfluorooctane sulfonic acid results in decreased expression of ACTA1 protein CTD PMID:26178269 Acta1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Acta1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of ACTA1 mRNA CTD PMID:36331819 Acta1 Rat perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of ACTA1 mRNA CTD PMID:35163327 Acta1 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of ACTA1 mRNA CTD PMID:35163327 Acta1 Rat phenobarbital affects expression ISO Acta1 (Mus musculus) 6480464 Phenobarbital affects the expression of ACTA1 mRNA CTD PMID:23091169 Acta1 Rat phenylephrine multiple interactions ISO Acta1 (Mus musculus) 6480464 [Phenylephrine co-treated with ADRA1B protein] results in increased expression of ACTA1 protein more ... CTD PMID:10710348 more ... Acta1 Rat phenylephrine increases expression EXP 6480464 Phenylephrine results in increased expression of ACTA1 mRNA CTD PMID:10642269 more ... Acta1 Rat phenylephrine multiple interactions EXP 6480464 MAPK8IP1 protein inhibits the reaction [Phenylephrine results in increased expression of ACTA1 mRNA] more ... CTD PMID:11513749 more ... Acta1 Rat phenylephrine increases expression ISO Acta1 (Mus musculus) 6480464 Phenylephrine results in increased expression of ACTA1 mRNA CTD PMID:18502941 Acta1 Rat phenylmercury acetate increases expression ISO ACTA1 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of ACTA1 mRNA CTD PMID:26272509 Acta1 Rat phenylmercury acetate multiple interactions ISO ACTA1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ACTA1 mRNA CTD PMID:27188386 Acta1 Rat PhIP decreases expression EXP 6480464 2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in decreased expression of ACTA1 mRNA CTD PMID:29877212 Acta1 Rat pioglitazone multiple interactions ISO Acta1 (Mus musculus) 6480464 [N-nitroso-tris-chloroethylurea co-treated with pioglitazone] results in decreased expression of ACTA1 mRNA CTD PMID:27935865 Acta1 Rat pirinixic acid multiple interactions ISO Acta1 (Mus musculus) 6480464 PPARA protein promotes the reaction [pirinixic acid results in decreased expression of ACTA1 mRNA] CTD PMID:20059764 Acta1 Rat pirinixic acid decreases expression ISO Acta1 (Mus musculus) 6480464 pirinixic acid results in decreased expression of ACTA1 mRNA CTD PMID:17426115 and PMID:20059764 Acta1 Rat pravastatin decreases expression EXP 6480464 Pravastatin results in decreased expression of ACTA1 mRNA CTD PMID:27225895 Acta1 Rat pravastatin decreases expression ISO Acta1 (Mus musculus) 6480464 Pravastatin results in decreased expression of ACTA1 mRNA CTD PMID:27225895 Acta1 Rat prazosin multiple interactions EXP 6480464 Prazosin inhibits the reaction [Phenylephrine results in increased expression of ACTA1 mRNA] CTD PMID:17592507 Acta1 Rat progesterone increases expression EXP 6480464 Progesterone results in increased expression of ACTA1 mRNA CTD PMID:20726854 Acta1 Rat progesterone increases expression ISO Acta1 (Mus musculus) 6480464 Progesterone results in increased expression of ACTA1 mRNA CTD PMID:22238285 Acta1 Rat propanal increases expression ISO ACTA1 (Homo sapiens) 6480464 propionaldehyde results in increased expression of ACTA1 mRNA CTD PMID:26079696 Acta1 Rat propofol multiple interactions EXP 6480464 HMOX1 protein affects the reaction [Propofol inhibits the reaction [Glucose results in increased expression of ACTA1 mRNA]] more ... CTD PMID:24810525 Acta1 Rat prostaglandin E2 multiple interactions EXP 6480464 4-(4-cyano-2-(2-(4-fluoronaphthalen-1-yl)propionylamino)phenyl)butyric acid inhibits the reaction [Dinoprostone results in decreased expression of ACTA1 mRNA] CTD PMID:18030065 Acta1 Rat prostaglandin E2 decreases expression EXP 6480464 Dinoprostone results in decreased expression of ACTA1 mRNA CTD PMID:18030065 Acta1 Rat quercetin increases expression ISO ACTA1 (Homo sapiens) 6480464 Quercetin results in increased expression of ACTA1 mRNA CTD PMID:21632981 Acta1 Rat resveratrol decreases expression ISO Acta1 (Mus musculus) 6480464 resveratrol results in decreased expression of ACTA1 mRNA CTD PMID:25394648 Acta1 Rat resveratrol increases expression EXP 6480464 resveratrol results in increased expression of ACTA1 mRNA CTD PMID:25905778 Acta1 Rat rotenone increases expression ISO ACTA1 (Homo sapiens) 6480464 Rotenone results in increased expression of ACTA1 mRNA CTD PMID:29955902 Acta1 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of ACTA1 mRNA CTD PMID:28374803 Acta1 Rat SB 431542 multiple interactions ISO ACTA1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Acta1 Rat silicon dioxide increases expression ISO ACTA1 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of ACTA1 mRNA CTD PMID:25895662 Acta1 Rat silver atom increases expression ISO ACTA1 (Homo sapiens) 6480464 Silver results in increased expression of ACTA1 mRNA CTD PMID:26014281 and PMID:28959546 Acta1 Rat silver(0) increases expression ISO ACTA1 (Homo sapiens) 6480464 Silver results in increased expression of ACTA1 mRNA CTD PMID:26014281 and PMID:28959546 Acta1 Rat sodium arsenite multiple interactions ISO Acta1 (Mus musculus) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of ACTA1 mRNA CTD PMID:33481702 Acta1 Rat sodium arsenite decreases expression ISO Acta1 (Mus musculus) 6480464 sodium arsenite results in decreased expression of ACTA1 mRNA CTD PMID:26674514 and PMID:37682722 Acta1 Rat sodium fluoride decreases expression ISO Acta1 (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of ACTA1 protein CTD PMID:27548804 Acta1 Rat sunitinib decreases expression ISO ACTA1 (Homo sapiens) 6480464 Sunitinib results in decreased expression of ACTA1 mRNA CTD PMID:31533062 Acta1 Rat testosterone multiple interactions ISO ACTA1 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of ACTA1 mRNA CTD PMID:21592394 Acta1 Rat testosterone decreases expression ISO Acta1 (Mus musculus) 6480464 Testosterone deficiency results in decreased expression of ACTA1 mRNA CTD PMID:33848595 Acta1 Rat testosterone multiple interactions ISO Acta1 (Mus musculus) 6480464 1 more ... CTD PMID:33848595 Acta1 Rat testosterone increases expression ISO ACTA1 (Homo sapiens) 6480464 Testosterone results in increased expression of ACTA1 mRNA CTD PMID:21592394 Acta1 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of ACTA1 mRNA] CTD PMID:31150632 Acta1 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of ACTA1 mRNA CTD PMID:31150632 Acta1 Rat titanium dioxide affects methylation ISO Acta1 (Mus musculus) 6480464 titanium dioxide affects the methylation of ACTA1 gene CTD PMID:35295148 Acta1 Rat triazines multiple interactions ISO Acta1 (Mus musculus) 6480464 Triazines inhibits the reaction [IDH2 protein mutant form results in increased expression of ACTA1 mRNA] CTD PMID:27469509 Acta1 Rat Tributyltin oxide increases phosphorylation ISO Acta1 (Mus musculus) 6480464 bis(tri-n-butyltin)oxide results in increased phosphorylation of ACTA1 protein CTD PMID:22174045 Acta1 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of ACTA1 mRNA CTD PMID:33387578 Acta1 Rat triclosan decreases expression ISO ACTA1 (Homo sapiens) 6480464 Triclosan results in decreased expression of ACTA1 mRNA CTD PMID:30510588 Acta1 Rat triptonide increases expression ISO Acta1 (Mus musculus) 6480464 triptonide results in increased expression of ACTA1 mRNA CTD PMID:33045310 Acta1 Rat tris(2-butoxyethyl) phosphate affects expression ISO ACTA1 (Homo sapiens) 6480464 tris(2-butoxyethyl) phosphate affects the expression of ACTA1 mRNA CTD PMID:29024780 Acta1 Rat triticonazole increases expression EXP 6480464 triticonazole results in increased expression of ACTA1 mRNA CTD PMID:36084822 Acta1 Rat urethane decreases expression ISO ACTA1 (Homo sapiens) 6480464 Urethane results in decreased expression of ACTA1 mRNA CTD PMID:28818685 Acta1 Rat valproic acid increases expression ISO ACTA1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of ACTA1 mRNA CTD PMID:23179753 Acta1 Rat valproic acid decreases expression ISO ACTA1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of ACTA1 mRNA CTD PMID:28001369 Acta1 Rat valproic acid increases methylation ISO ACTA1 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of ACTA1 gene CTD PMID:29154799 Acta1 Rat vorinostat multiple interactions ISO ACTA1 (Homo sapiens) 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ACTA1 mRNA CTD PMID:27188386 Acta1 Rat vorinostat increases expression ISO ACTA1 (Homo sapiens) 6480464 vorinostat results in increased expression of ACTA1 mRNA CTD PMID:26272509 Acta1 Rat zaragozic acid A decreases expression ISO Acta1 (Mus musculus) 6480464 squalestatin 1 results in decreased expression of ACTA1 mRNA CTD PMID:27225895 Acta1 Rat zaragozic acid A increases expression EXP 6480464 squalestatin 1 results in increased expression of ACTA1 mRNA CTD PMID:27225895
(+)-schisandrin B (EXP) (R)-noradrenaline (EXP) (S)-nicotine (EXP,ISO) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (EXP) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3-methylcholanthrene (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxynon-2-enal (EXP) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) aconitine (EXP) acrylamide (EXP) actinomycin D (ISO) aflatoxin B1 (ISO) aldehydo-D-glucose (EXP,ISO) alpha-Zearalanol (EXP) ammonium chloride (EXP) aristolochic acid A (ISO) arsane (EXP,ISO) arsenic atom (EXP,ISO) arsenite(3-) (ISO) atrazine (EXP) benzo[a]pyrene (ISO) Benzo[ghi]perylene (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) butanal (ISO) cadmium atom (EXP) cadmium dichloride (EXP) calcitriol (ISO) cantharidin (ISO) carbamazepine (ISO) carbon nanotube (ISO) choline (ISO) chrysene (ISO) copper(II) sulfate (ISO) corticosterone (EXP) Cuprizon (EXP) cyclosporin A (ISO) cylindrospermopsin (ISO) cytarabine (ISO) D-glucose (EXP,ISO) daunorubicin (ISO) deoxynivalenol (ISO) diclofenac (ISO) dicrotophos (ISO) diethylstilbestrol (ISO) diisononyl phthalate (ISO) dioxygen (EXP,ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) emodin (ISO) endosulfan (EXP) entinostat (ISO) ethanol (ISO) etoposide (ISO) fenthion (ISO) flurbiprofen (ISO) folic acid (ISO) fructose (ISO) fucoxanthin (ISO) fulvestrant (ISO) furan (EXP) genistein (ISO) gentamycin (EXP) glucose (EXP,ISO) graphite (ISO) GSK2181236A (EXP) hydralazine (EXP) hydrochlorothiazide (EXP) hydrogen peroxide (ISO) inulin (ISO) isoprenaline (ISO) ivermectin (ISO) L-methionine (ISO) lead nitrate (ISO) leflunomide (ISO) Licochalcone B (ISO) manganese atom (EXP) manganese(0) (EXP) manganese(II) chloride (EXP) metformin (EXP) mitoxantrone (ISO) Monobutylphthalate (ISO) naphthalene (ISO) nickel sulfate (ISO) nicotine (EXP,ISO) nitric oxide (EXP) Nutlin-3 (ISO) ozone (ISO) p-anisidine (ISO) p-chloromercuribenzoic acid (ISO) paracetamol (ISO) paraquat (EXP) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP) phenobarbital (ISO) phenylephrine (EXP,ISO) phenylmercury acetate (ISO) PhIP (EXP) pioglitazone (ISO) pirinixic acid (ISO) pravastatin (EXP,ISO) prazosin (EXP) progesterone (EXP,ISO) propanal (ISO) propofol (EXP) prostaglandin E2 (EXP) quercetin (ISO) resveratrol (EXP,ISO) rotenone (EXP,ISO) SB 431542 (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) sodium fluoride (ISO) sunitinib (ISO) testosterone (ISO) tetrachloromethane (EXP) titanium dioxide (ISO) triazines (ISO) Tributyltin oxide (ISO) trichloroethene (EXP) triclosan (ISO) triptonide (ISO) tris(2-butoxyethyl) phosphate (ISO) triticonazole (EXP) urethane (ISO) valproic acid (ISO) vorinostat (ISO) zaragozic acid A (EXP,ISO)
1.
Upregulation of adrenomedullin and its receptor components during cardiomyocyte hypertrophy induced by chronic inhibition of nitric oxide synthesis in rats.
Bell D, etal., Am J Physiol Heart Circ Physiol. 2006 Feb;290(2):H904-14. Epub 2005 Jul 22.
2.
[Mucosal relief of the cardia in cases of carcinoma (author's transl)]
Bielecki M, etal., Pol Przegl Radiol Med Nukl 1978 Mar-Apr;42(2):91-7.
3.
Prevalence of chronic skin and musculoskeletal conditions. United States-1976.
Bonham GS Vital Health Stat 10 1978 Nov;(124):i-iv, 1-57.
4.
Comparison of soluble guanylate cyclase stimulators and activators in models of cardiovascular disease associated with oxidative stress.
Costell MH, etal., Front Pharmacol. 2012 Jul 5;3:128. doi: 10.3389/fphar.2012.00128. eCollection 2012.
5.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.
Differential gene expression in skeletal muscle cells after membrane depolarization.
Juretic N, etal., J Cell Physiol. 2006 Dec 4;.
7.
Myogenic signaling by lithium in cardiomyoblasts is Akt independent but requires activation of the beta-catenin-Tcf/Lef pathway.
Kashour T, etal., J Mol Cell Cardiol. 2003 Aug;35(8):937-51.
8.
Blockade of cysteine-rich protein 61 attenuates renal inflammation and fibrosis after ischemic kidney injury.
Lai CF, etal., Am J Physiol Renal Physiol. 2014 Sep 1;307(5):F581-92. doi: 10.1152/ajprenal.00670.2013. Epub 2014 Jun 11.
9.
P38 MAPK Signaling Pathway Mediates Angiotensin II-Induced miR143/145 Gene Cluster Downregulation during Aortic Dissection Formation.
Li B, etal., Ann Vasc Surg. 2017 Apr;40:262-273. doi: 10.1016/j.avsg.2016.09.016. Epub 2017 Feb 4.
10.
Expression of the genes coding for the skeletal muscle and cardiac actions in the heart.
Mayer Y, etal., Nucleic Acids Res 1984 Jan 25;12(2):1087-100.
11.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
12.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
13.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
14.
GATA-4 is a nuclear mediator of mechanical stretch-activated hypertrophic program.
Pikkarainen S, etal., J Biol Chem. 2003 Jun 27;278(26):23807-16. Epub 2003 Apr 17.
15.
GOA pipeline
RGD automated data pipeline
16.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
17.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
18.
Comprehensive gene review and curation
RGD comprehensive gene curation
19.
A proteomic assessment of muscle contractile alterations during unloading and reloading.
Seo Y, etal., J Biochem (Tokyo). 2006 Jan;139(1):71-80.
20.
Muscle disease caused by mutations in the skeletal muscle alpha-actin gene (ACTA1).
Sparrow JC, etal., Neuromuscul Disord. 2003 Sep;13(7-8):519-31.
21.
Correlation of alpha-skeletal actin expression, ventricular fibrosis and heart function with the degree of pressure overload cardiac hypertrophy in rats.
Stilli D, etal., Exp Physiol. 2006 May;91(3):571-80. Epub 2006 Feb 1.
22.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
23.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
24.
Aldosterone, through novel signaling proteins, is a fundamental molecular bridge between the genetic defect and the cardiac phenotype of hypertrophic cardiomyopathy.
Tsybouleva N, etal., Circulation. 2004 Mar 16;109(10):1284-91. Epub 2004 Mar 1.
25.
Myosin light chain isoforms modify force-generating ability of cardiac myosin by changing the kinetics of actin-myosin interaction.
Yamashita H, etal., Cardiovasc Res. 2003 Dec 1;60(3):580-8.
26.
Nucleotide sequence of the rat skeletal muscle actin gene.
Zakut R, etal., Nature 1982 Aug 26;298(5877):857-9.
Acta1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 68,781,168 - 68,784,194 (-) NCBI GRCr8 mRatBN7.2 19 51,883,709 - 51,886,735 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 51,883,715 - 51,886,742 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 58,675,301 - 58,678,329 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 59,519,721 - 59,522,747 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 61,601,732 - 61,604,760 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 56,674,072 - 56,677,084 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 56,674,074 - 56,677,084 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 67,389,899 - 67,392,911 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 54,081,496 - 54,084,508 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 19 54,086,370 - 54,089,389 (-) NCBI Celera 19 51,258,256 - 51,261,324 (-) NCBI Celera Cytogenetic Map 19 q12 NCBI
ACTA1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 229,431,245 - 229,434,094 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 229,430,365 - 229,434,104 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 229,566,992 - 229,569,841 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 227,633,615 - 227,636,466 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 225,873,729 - 225,876,578 NCBI Celera 1 202,835,304 - 202,838,155 (-) NCBI Celera Cytogenetic Map 1 q42.13 NCBI HuRef 1 200,057,954 - 200,060,804 (-) NCBI HuRef CHM1_1 1 230,839,339 - 230,842,183 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 228,809,946 - 228,812,800 (-) NCBI T2T-CHM13v2.0
Acta1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 124,618,497 - 124,621,514 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 124,618,508 - 124,621,490 (-) Ensembl GRCm39 Ensembl GRCm38 8 123,891,758 - 123,894,775 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 123,891,769 - 123,894,751 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 126,415,667 - 126,418,636 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 126,777,857 - 126,780,826 (-) NCBI MGSCv36 mm8 Celera 8 128,158,816 - 128,161,785 (-) NCBI Celera Cytogenetic Map 8 E2 NCBI cM Map 8 72.26 NCBI
Acta1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955492 8,644,146 - 8,647,523 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955492 8,644,696 - 8,647,412 (+) NCBI ChiLan1.0 ChiLan1.0
ACTA1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 19,778,035 - 19,780,912 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 19,970,319 - 19,973,196 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 204,975,646 - 204,978,523 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 210,007,622 - 210,010,459 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 210,007,622 - 210,010,469 (-) Ensembl panpan1.1 panPan2
ACTA1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 4 9,811,726 - 9,814,533 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 4 9,811,801 - 9,814,530 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 4 9,802,887 - 9,805,701 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 4 9,842,369 - 9,845,196 (+) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 4 9,846,012 - 9,848,831 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 4 9,960,597 - 9,963,412 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 4 10,212,935 - 10,215,761 (+) NCBI UU_Cfam_GSD_1.0
Acta1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 44,071,243 - 44,074,156 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936484 20,236,320 - 20,239,430 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936484 20,236,320 - 20,239,385 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ACTA1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 60,412,812 - 60,415,674 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 60,412,651 - 60,415,687 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 65,236,192 - 65,239,197 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ACTA1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 25 66,700,448 - 66,703,325 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 25 66,700,369 - 66,714,891 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666055 68,553,718 - 68,559,732 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Acta1
.
Predicted Target Of
Count of predictions: 173 Count of miRNA genes: 127 Interacting mature miRNAs: 138 Transcripts: ENSRNOT00000024084 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2313395 Anxrr26 Anxiety related response QTL 26 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 19 49976481 53225766 Rat 1578764 Stresp19 Stress response QTL 19 3.6 0.001 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 19 15630201 57337602 Rat 61350 Bp32 Blood pressure QTL 32 0.012 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 19 20483575 57337602 Rat 5135224 Leukc1 Leukocyte quantity QTL 1 eosinophil quantity (VT:0002602) blood eosinophil count (CMO:0000033) 19 44340214 55283277 Rat 724546 Kidm3 Kidney mass QTL 3 3.1 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 19 29322490 57337602 Rat 7411549 Bw130 Body weight QTL 130 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 19 15455860 57337602 Rat 1358200 Insglur2 Insulin/glucose ratio QTL 2 4.1 blood glucose amount (VT:0000188) serum glucose level (CMO:0000543) 19 33838214 55283146 Rat 724566 Uae12 Urinary albumin excretion QTL 12 5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 19 2187927 56457239 Rat 1331737 Uae29 Urinary albumin excretion QTL 29 5.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 19 4096155 55283277 Rat 2298478 Eau8 Experimental allergic uveoretinitis QTL 8 0.0163 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 19 17154433 57337602 Rat
PMC109669P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,665,199 - 11,666,019 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,717,931 - 13,718,750 NCBI Rnor6.0 Rnor_5.0 12 15,747,944 - 15,748,763 UniSTS Rnor5.0 RGSC_v3.4 12 12,049,158 - 12,049,977 UniSTS RGSC3.4 Celera 12 13,454,531 - 13,455,350 UniSTS Cytogenetic Map 12 p11 UniSTS Cytogenetic Map 19 q12 UniSTS
PMC156330P1
Rat Assembly Chr Position (strand) Source JBrowse Celera 19 51,258,498 - 51,259,502 UniSTS Celera 12 13,454,501 - 13,455,354 UniSTS Cytogenetic Map 12 p11 UniSTS Cytogenetic Map 18 p12 UniSTS Cytogenetic Map 19 q12 UniSTS Cytogenetic Map 10 q32.3 UniSTS
PMC201106P1
Rat Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 12 p11 UniSTS Cytogenetic Map 10 q32.3 UniSTS Cytogenetic Map 19 q12 UniSTS Cytogenetic Map 18 p12 UniSTS
AA959943
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 51,883,726 - 51,883,919 (+) MAPPER mRatBN7.2 Rnor_6.0 19 56,674,086 - 56,674,278 NCBI Rnor6.0 Rnor_5.0 19 67,389,913 - 67,390,105 UniSTS Rnor5.0 RGSC_v3.4 19 54,081,510 - 54,081,702 UniSTS RGSC3.4 Celera 19 51,258,270 - 51,258,462 UniSTS Cytogenetic Map 19 q12 UniSTS
AI704778
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 51,883,725 - 51,883,943 (+) MAPPER mRatBN7.2 Rnor_6.0 19 56,674,085 - 56,674,302 NCBI Rnor6.0 Rnor_5.0 19 67,389,912 - 67,390,129 UniSTS Rnor5.0 RGSC_v3.4 19 54,081,509 - 54,081,726 UniSTS RGSC3.4 Celera 19 51,258,269 - 51,258,486 UniSTS RH 3.4 Map 19 733.8 UniSTS Cytogenetic Map 19 q12 UniSTS
PMC133768P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,665,205 - 11,665,364 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,717,937 - 13,718,095 NCBI Rnor6.0 Rnor_5.0 12 15,747,950 - 15,748,108 UniSTS Rnor5.0 RGSC_v3.4 12 12,049,164 - 12,049,322 UniSTS RGSC3.4 Celera 12 13,454,537 - 13,454,695 UniSTS Cytogenetic Map 12 p11 UniSTS Cytogenetic Map 19 q12 UniSTS
PMC151529P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 51,884,919 - 51,885,405 (+) MAPPER mRatBN7.2 Rnor_6.0 19 56,675,279 - 56,675,764 NCBI Rnor6.0 Rnor_5.0 19 67,391,106 - 67,391,591 UniSTS Rnor5.0 RGSC_v3.4 19 54,082,703 - 54,083,188 UniSTS RGSC3.4 Celera 19 51,259,519 - 51,260,004 UniSTS Cytogenetic Map 19 q12 UniSTS
PMC156124P2
Rat Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 12 p11 UniSTS Cytogenetic Map 10 q32.3 UniSTS Cytogenetic Map 19 q12 UniSTS Cytogenetic Map 18 p12 UniSTS
PMC133998P8
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,664,403 - 11,665,406 (+) MAPPER mRatBN7.2 mRatBN7.2 19 51,884,568 - 51,885,392 (+) MAPPER mRatBN7.2 Rnor_6.0 19 56,674,928 - 56,675,751 NCBI Rnor6.0 Rnor_6.0 12 13,717,135 - 13,718,137 NCBI Rnor6.0 Rnor_5.0 19 67,390,755 - 67,391,578 UniSTS Rnor5.0 Rnor_5.0 12 15,747,148 - 15,748,150 UniSTS Rnor5.0 RGSC_v3.4 19 54,082,352 - 54,083,175 UniSTS RGSC3.4 RGSC_v3.4 12 12,048,362 - 12,049,364 UniSTS RGSC3.4 Celera 12 13,453,735 - 13,454,737 UniSTS Celera 19 51,259,168 - 51,259,991 UniSTS Cytogenetic Map 12 p11 UniSTS Cytogenetic Map 19 q12 UniSTS
LOC345651
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,664,470 - 11,665,066 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,717,202 - 13,717,797 NCBI Rnor6.0 Rnor_5.0 12 15,747,215 - 15,747,810 UniSTS Rnor5.0 RGSC_v3.4 12 12,048,429 - 12,049,024 UniSTS RGSC3.4 Celera 12 13,453,802 - 13,454,397 UniSTS Cytogenetic Map 12 p11 UniSTS Cytogenetic Map 19 q12 UniSTS Cytogenetic Map 3 q35 UniSTS
PMC209527P1
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 12 16,777,911 - 16,778,877 (+) Marker Load Pipeline mRatBN7.2 12 11,664,359 - 11,665,325 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,717,091 - 13,718,056 NCBI Rnor6.0 Rnor_5.0 12 15,747,104 - 15,748,069 UniSTS Rnor5.0 RGSC_v3.4 12 12,048,318 - 12,049,283 UniSTS RGSC3.4 Celera 12 13,453,691 - 13,454,656 UniSTS Cytogenetic Map 12 p11 UniSTS Cytogenetic Map 19 q12 UniSTS
PMC87052P1
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 12 16,778,931 - 16,779,578 (+) Marker Load Pipeline mRatBN7.2 12 11,665,379 - 11,666,026 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,718,111 - 13,718,757 NCBI Rnor6.0 Rnor_5.0 12 15,748,124 - 15,748,770 UniSTS Rnor5.0 RGSC_v3.4 12 12,049,338 - 12,049,984 UniSTS RGSC3.4 Celera 12 13,454,711 - 13,455,357 UniSTS Cytogenetic Map 12 p11 UniSTS Cytogenetic Map 19 q12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
88
87
56
25
56
6
215
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000024084 ⟹ ENSRNOP00000024084
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 51,883,715 - 51,886,742 (-) Ensembl Rnor_6.0 Ensembl 19 56,674,074 - 56,677,084 (-) Ensembl
RefSeq Acc Id:
NM_019212 ⟹ NP_062085
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 68,781,168 - 68,784,194 (-) NCBI mRatBN7.2 19 51,883,709 - 51,886,735 (-) NCBI Rnor_6.0 19 56,674,072 - 56,677,084 (-) NCBI Rnor_5.0 19 67,389,899 - 67,392,911 (-) NCBI RGSC_v3.4 19 54,081,496 - 54,084,508 (-) RGD Celera 19 51,258,256 - 51,261,324 (-) RGD
Sequence:
TGAAGCCTCACTTCCTACCCTCGGCACCCAGGGCCAGAGTCAGAGCAGCAGAAACTAGACACCATGTGTGACGAGGACGAGACCACCGCTCTTGTGTGTGACAACGGCTCTGGCCTGGTGAAAGCTGG
hide sequence
RefSeq Acc Id:
NP_062085 ⟸ NM_019212
- UniProtKB:
P68136 (UniProtKB/Swiss-Prot), A0A0G2K4M6 (UniProtKB/TrEMBL)
- Sequence:
MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFET
hide sequence
Ensembl Acc Id:
ENSRNOP00000024084 ⟸ ENSRNOT00000024084
RGD ID: 13701230 Promoter ID: EPDNEW_R11754 Type: multiple initiation site Name: Acta1_1 Description: actin, alpha 1, skeletal muscle SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 19 56,677,093 - 56,677,153 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Acta1
actin, alpha 1, skeletal muscle
actin alpha 1
Name updated
1299863 APPROVED
2002-06-10
Acta1
actin alpha 1
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_expression
expressed in skeletal muscle
69736
gene_expression
expressed in newborn cardiac muscle
69737
gene_homology
gene displays a highly conserved location of intron boundaries to specific amino acid sequences from echinoderms to vertebrates
69736
gene_product
member of the actin family
69736
