Symbol:
Elk1
Name:
ETS transcription factor ELK1
RGD ID:
1598663
Description:
Enables RNA polymerase II cis-regulatory region sequence-specific DNA binding activity and chromatin binding activity. Involved in several processes, including cellular response to gamma radiation; cellular response to testosterone stimulus; and hippocampal neuron apoptotic process. Acts upstream of or within positive regulation of transcription by RNA polymerase II. Located in several cellular components, including axon terminus; mitochondrial membrane; and neuronal cell body. Biomarker of anxiety disorder and transient cerebral ischemia. Orthologous to human ELK1 (ETS transcription factor ELK1); PARTICIPATES IN adenosine signaling pathway; hypoxia inducible factor pathway; platelet-derived growth factor signaling pathway; INTERACTS WITH (R)-noradrenaline; (S)-amphetamine; (S)-nicotine.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
ELK1, ETS transcription factor; ELK1, member of ETS oncogene family; ETS domain-containing protein Elk-1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ELK1 (ETS transcription factor ELK1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Elk1 (ELK1, member of ETS oncogene family) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Elk1 (ETS transcription factor ELK1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ELK1 (ETS transcription factor ELK1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ELK1 (ETS transcription factor ELK1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Elk1 (ETS transcription factor ELK1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ELK1 (ETS transcription factor ELK1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
LOC103231899 (ETS transcription factor ELK1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Elk1 (ETS transcription factor ELK1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Elk1 (ELK1, member of ETS oncogene family)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
ELK1 (ETS transcription factor ELK1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
elk1 (ETS transcription factor ELK1)
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
elk-2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid)
Caenorhabditis elegans (roundworm):
lin-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoInspector|PANTHER)
Xenopus tropicalis (tropical clawed frog):
elk1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 3,692,367 - 3,709,252 (+) NCBI GRCr8 mRatBN7.2 X 1,138,826 - 1,155,713 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 1,139,756 - 1,155,713 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 1,167,915 - 1,183,790 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 4,643,607 - 4,659,482 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 964,852 - 980,733 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 1,287,875 - 1,304,822 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 1,297,099 - 1,304,822 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 2,102,893 - 2,119,843 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 12,597,863 - 12,604,248 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera X 1,708,719 - 1,724,604 (+) NCBI Celera Cytogenetic Map X q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Elk1 Rat (+)-catechin multiple interactions ISO ELK1 (Homo sapiens) 6480464 [Catechin co-treated with Grape Seed Proanthocyanidins] results in increased expression of ELK1 mRNA CTD PMID:24763279 Elk1 Rat (-)-anisomycin increases phosphorylation ISO ELK1 (Homo sapiens) 6480464 Anisomycin results in increased phosphorylation of ELK1 protein CTD PMID:12660819 Elk1 Rat (-)-anisomycin multiple interactions ISO ELK1 (Homo sapiens) 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [Anisomycin results in increased phosphorylation of ELK1 protein] and pyrazolanthrone inhibits the reaction [Anisomycin results in increased phosphorylation of ELK1 protein] CTD PMID:12660819 Elk1 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO ELK1 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of ELK1 mRNA CTD PMID:22079256 Elk1 Rat (R)-noradrenaline multiple interactions EXP 6480464 [Norepinephrine co-treated with Propranolol] results in increased phosphorylation of ELK1 protein more ... CTD PMID:11880281 Elk1 Rat (S)-amphetamine multiple interactions EXP 6480464 6-methyl-2-(phenylethynyl)pyridine inhibits the reaction [Dextroamphetamine results in increased phosphorylation of ELK1 protein] and N-phenyl-7-(hydroxyimino)cyclopropa(b)chromen-1a-carboxamide inhibits the reaction [Dextroamphetamine results in increased phosphorylation of ELK1 protein] CTD PMID:12377393 Elk1 Rat (S)-amphetamine increases phosphorylation EXP 6480464 Dextroamphetamine results in increased phosphorylation of ELK1 protein CTD PMID:12377393 Elk1 Rat (S)-nicotine increases phosphorylation EXP 6480464 Nicotine results in increased phosphorylation of ELK1 protein CTD PMID:29486207 Elk1 Rat (S)-nicotine increases phosphorylation ISO ELK1 (Homo sapiens) 6480464 Nicotine results in increased phosphorylation of ELK1 protein CTD PMID:29486207 Elk1 Rat (S)-nicotine multiple interactions ISO ELK1 (Homo sapiens) 6480464 Vecuronium Bromide inhibits the reaction [Nicotine results in increased phosphorylation of ELK1 protein] CTD PMID:29486207 Elk1 Rat 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane increases activity ISO ELK1 (Homo sapiens) 6480464 o and p'-DDT results in increased activity of ELK1 protein CTD PMID:18791200 Elk1 Rat 1,2-dichloroethane decreases expression ISO Elk1 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of ELK1 mRNA CTD PMID:28960355 Elk1 Rat 17alpha-ethynylestradiol multiple interactions ISO Elk1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of ELK1 mRNA CTD PMID:17942748 Elk1 Rat 17beta-estradiol multiple interactions ISO ELK1 (Homo sapiens) 6480464 Estradiol results in increased phosphorylation of and results in increased activity of ELK1 protein and GPER1 protein affects the reaction [Estradiol results in increased phosphorylation of ELK1 protein] CTD PMID:16024245 and PMID:22453024 Elk1 Rat 17beta-estradiol increases phosphorylation ISO ELK1 (Homo sapiens) 6480464 Estradiol results in increased phosphorylation of ELK1 protein CTD PMID:22453024 Elk1 Rat 17beta-estradiol increases expression ISO ELK1 (Homo sapiens) 6480464 Estradiol results in increased expression of ELK1 mRNA CTD PMID:23094148 Elk1 Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO ELK1 (Homo sapiens) 6480464 Dihydrotestosterone results in increased expression of ELK1 mRNA CTD PMID:38122923 Elk1 Rat 17beta-hydroxy-5alpha-androstan-3-one multiple interactions ISO ELK1 (Homo sapiens) 6480464 apalutamide inhibits the reaction [Dihydrotestosterone results in increased expression of ELK1 mRNA] CTD PMID:38122923 Elk1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Elk1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of ELK1 mRNA CTD PMID:19684285 and PMID:24058054 Elk1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of ELK1 mRNA CTD PMID:33387578 Elk1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of ELK1 mRNA CTD PMID:15897893 Elk1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Elk1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of ELK1 mRNA CTD PMID:17942748 Elk1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO ELK1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of ELK1 mRNA CTD PMID:19684285 Elk1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO ELK1 (Homo sapiens) 6480464 [Tetrachlorodibenzodioxin co-treated with Cycloheximide] results in increased expression of ELK1 mRNA CTD PMID:19684285 Elk1 Rat 2-methyl-6-(phenylethynyl)pyridine multiple interactions EXP 6480464 6-methyl-2-(phenylethynyl)pyridine inhibits the reaction [Dextroamphetamine results in increased phosphorylation of ELK1 protein] CTD PMID:12377393 Elk1 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Elk1 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of ELK1 mRNA CTD PMID:26251327 Elk1 Rat 4,4'-sulfonyldiphenol decreases expression ISO Elk1 (Mus musculus) 6480464 bisphenol S results in decreased expression of ELK1 mRNA CTD PMID:39298647 Elk1 Rat 4-hydroxynon-2-enal decreases expression ISO ELK1 (Homo sapiens) 6480464 4-hydroxy-2-nonenal results in decreased expression of ELK1 mRNA CTD PMID:12419474 Elk1 Rat 4-hydroxyphenyl retinamide multiple interactions ISO ELK1 (Homo sapiens) 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [Fenretinide results in increased phosphorylation of ELK1 protein] CTD PMID:16407847 Elk1 Rat aflatoxin B1 decreases methylation ISO ELK1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of ELK1 gene CTD PMID:27153756 Elk1 Rat amphetamine multiple interactions EXP 6480464 KN 62 inhibits the reaction [Amphetamine results in increased phosphorylation of ELK1 protein] CTD PMID:12060798 Elk1 Rat amphetamine increases phosphorylation EXP 6480464 Amphetamine results in increased phosphorylation of ELK1 protein CTD PMID:12060798 Elk1 Rat androstane-3,17-dione increases expression ISO ELK1 (Homo sapiens) 6480464 androstane-3 and 17-dione results in increased expression of ELK1 mRNA CTD PMID:38122923 Elk1 Rat androstane-3,17-dione multiple interactions ISO ELK1 (Homo sapiens) 6480464 apalutamide inhibits the reaction [androstane-3 and 17-dione results in increased expression of ELK1 mRNA] CTD PMID:38122923 Elk1 Rat anthra[1,9-cd]pyrazol-6(2H)-one multiple interactions ISO ELK1 (Homo sapiens) 6480464 pyrazolanthrone inhibits the reaction [Anisomycin results in increased phosphorylation of ELK1 protein] more ... CTD PMID:12660819 more ... Elk1 Rat arsenic acid increases activity EXP 6480464 arsenic acid results in increased activity of ELK1 protein CTD PMID:10445758 Elk1 Rat arsenite(3-) multiple interactions ISO ELK1 (Homo sapiens) 6480464 arsenite promotes the reaction [ELK1 protein binds to DDIT4 promoter] CTD PMID:16008523 Elk1 Rat arsenite(3-) increases activity EXP 6480464 arsenite results in increased activity of ELK1 protein CTD PMID:10445758 Elk1 Rat arsenite(3-) increases activity ISO ELK1 (Homo sapiens) 6480464 arsenite results in increased activity of ELK1 protein CTD PMID:16008523 Elk1 Rat arsenous acid increases phosphorylation ISO ELK1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased phosphorylation of ELK1 protein CTD PMID:32683294 Elk1 Rat arsenous acid increases phosphorylation ISO Elk1 (Mus musculus) 6480464 Arsenic Trioxide results in increased phosphorylation of ELK1 protein CTD PMID:32683294 Elk1 Rat arsenous acid multiple interactions ISO ELK1 (Homo sapiens) 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [Arsenic Trioxide results in increased phosphorylation of ELK1 protein] CTD PMID:32683294 Elk1 Rat baicalein multiple interactions ISO ELK1 (Homo sapiens) 6480464 baicalein inhibits the reaction [EGF protein results in increased phosphorylation of ELK1 protein] CTD PMID:25625231 Elk1 Rat baicalin multiple interactions ISO ELK1 (Homo sapiens) 6480464 baicalin inhibits the reaction [EGF protein results in increased phosphorylation of ELK1 protein] CTD PMID:25625231 Elk1 Rat benzene decreases expression ISO ELK1 (Homo sapiens) 6480464 Benzene results in decreased expression of ELK1 mRNA CTD PMID:21843810 and PMID:33064461 Elk1 Rat benzo[a]pyrene increases mutagenesis ISO ELK1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased mutagenesis of ELK1 gene CTD PMID:25435355 Elk1 Rat benzo[a]pyrene decreases methylation ISO ELK1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of ELK1 3' UTR CTD PMID:27901495 Elk1 Rat benzo[a]pyrene increases methylation ISO ELK1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of ELK1 promoter CTD PMID:27901495 Elk1 Rat benzo[a]pyrene affects methylation ISO ELK1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of ELK1 5' UTR and Benzo(a)pyrene affects the methylation of ELK1 exon CTD PMID:27901495 and PMID:30157460 Elk1 Rat bis(2-ethylhexyl) phthalate decreases phosphorylation EXP 6480464 Diethylhexyl Phthalate results in decreased phosphorylation of ELK1 protein CTD PMID:35841924 Elk1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ELK1 mRNA CTD PMID:30816183 and PMID:32528016 Elk1 Rat bisphenol A affects methylation ISO Elk1 (Mus musculus) 6480464 bisphenol A affects the methylation of ELK1 promoter CTD PMID:27334623 Elk1 Rat bisphenol AF increases expression ISO ELK1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of ELK1 mRNA CTD PMID:36190352 Elk1 Rat butyric acid increases activity ISO ELK1 (Homo sapiens) 6480464 Butyric Acid results in increased activity of ELK1 protein CTD PMID:15103026 Elk1 Rat butyric acid multiple interactions ISO ELK1 (Homo sapiens) 6480464 U 0126 inhibits the reaction [Butyric Acid results in increased activity of ELK1 protein] CTD PMID:15103026 Elk1 Rat cadmium atom multiple interactions ISO ELK1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of ELK1 mRNA CTD PMID:35301059 Elk1 Rat cadmium dichloride increases expression ISO ELK1 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of ELK1 mRNA CTD PMID:33129824 Elk1 Rat cadmium dichloride multiple interactions ISO ELK1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of ELK1 mRNA CTD PMID:35301059 Elk1 Rat cadmium sulfate multiple interactions ISO ELK1 (Homo sapiens) 6480464 [cadmium sulfate co-treated with cobaltous chloride co-treated with lead chloride] affects the expression of ELK1 mRNA CTD PMID:18654764 Elk1 Rat cannabidiol decreases expression ISO ELK1 (Homo sapiens) 6480464 Cannabidiol results in decreased expression of ELK1 mRNA CTD PMID:32992648 Elk1 Rat cannabidiol multiple interactions ISO ELK1 (Homo sapiens) 6480464 [Oxygen co-treated with Ozone co-treated with Cannabidiol] results in decreased expression of ELK1 mRNA CTD PMID:32992648 Elk1 Rat carbon nanotube decreases expression ISO Elk1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Elk1 Rat CGP 52608 multiple interactions ISO ELK1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to ELK1 gene] CTD PMID:28238834 Elk1 Rat chromium(6+) increases phosphorylation ISO Elk1 (Mus musculus) 6480464 chromium hexavalent ion results in increased phosphorylation of ELK1 protein CTD PMID:19654923 Elk1 Rat chrysin multiple interactions ISO ELK1 (Homo sapiens) 6480464 chrysin inhibits the reaction [EGF protein results in increased phosphorylation of ELK1 protein] CTD PMID:25625231 Elk1 Rat cisplatin multiple interactions ISO ELK1 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of ELK1 mRNA CTD PMID:27392435 Elk1 Rat clozapine decreases phosphorylation ISO Elk1 (Mus musculus) 6480464 Clozapine results in decreased phosphorylation of ELK1 protein CTD PMID:12871586 Elk1 Rat cobalt dichloride multiple interactions ISO ELK1 (Homo sapiens) 6480464 [cadmium sulfate co-treated with cobaltous chloride co-treated with lead chloride] affects the expression of ELK1 mRNA CTD PMID:18654764 Elk1 Rat copper atom multiple interactions ISO ELK1 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in decreased expression of ELK1 mRNA CTD PMID:30911355 Elk1 Rat copper(0) multiple interactions ISO ELK1 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in decreased expression of ELK1 mRNA CTD PMID:30911355 Elk1 Rat copper(II) sulfate increases activity ISO ELK1 (Homo sapiens) 6480464 Copper Sulfate results in increased activity of ELK1 protein CTD PMID:10564177 Elk1 Rat copper(II) sulfate multiple interactions ISO ELK1 (Homo sapiens) 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [Copper Sulfate results in increased activity of ELK1 protein] CTD PMID:10564177 Elk1 Rat coumestrol multiple interactions ISO ELK1 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of ELK1 mRNA CTD PMID:19167446 Elk1 Rat crocidolite asbestos increases phosphorylation EXP 6480464 [Asbestos more ... CTD PMID:12495932 Elk1 Rat curcumin multiple interactions ISO ELK1 (Homo sapiens) 6480464 Curcumin inhibits the reaction [Oxygen deficiency results in increased expression of ELK1 mRNA] more ... CTD PMID:18316600 and PMID:23452621 Elk1 Rat curcumin increases phosphorylation ISO ELK1 (Homo sapiens) 6480464 Curcumin results in increased phosphorylation of ELK1 protein CTD PMID:18316600 Elk1 Rat cycloheximide increases expression ISO ELK1 (Homo sapiens) 6480464 Cycloheximide results in increased expression of ELK1 mRNA CTD PMID:19684285 Elk1 Rat cycloheximide multiple interactions ISO ELK1 (Homo sapiens) 6480464 [Tetrachlorodibenzodioxin co-treated with Cycloheximide] results in increased expression of ELK1 mRNA CTD PMID:19684285 Elk1 Rat daidzein multiple interactions EXP 6480464 daidzein results in increased phosphorylation of and results in increased activity of ELK1 protein CTD PMID:16972265 Elk1 Rat DDT increases activity ISO ELK1 (Homo sapiens) 6480464 DDT results in increased activity of ELK1 protein CTD PMID:18791200 Elk1 Rat deoxynivalenol increases expression ISO ELK1 (Homo sapiens) 6480464 deoxynivalenol results in increased expression of ELK1 protein CTD PMID:33890134 Elk1 Rat diarsenic trioxide multiple interactions ISO ELK1 (Homo sapiens) 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [Arsenic Trioxide results in increased phosphorylation of ELK1 protein] CTD PMID:32683294 Elk1 Rat diarsenic trioxide increases phosphorylation ISO Elk1 (Mus musculus) 6480464 Arsenic Trioxide results in increased phosphorylation of ELK1 protein CTD PMID:32683294 Elk1 Rat diarsenic trioxide increases phosphorylation ISO ELK1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased phosphorylation of ELK1 protein CTD PMID:32683294 Elk1 Rat dibromoacetic acid increases expression ISO Elk1 (Mus musculus) 6480464 dibromoacetic acid results in increased expression of ELK1 mRNA CTD PMID:29155130 Elk1 Rat dicrotophos increases expression ISO ELK1 (Homo sapiens) 6480464 dicrotophos results in increased expression of ELK1 mRNA CTD PMID:28302478 Elk1 Rat dieldrin affects expression EXP 6480464 Dieldrin affects the expression of ELK1 mRNA CTD PMID:22546817 Elk1 Rat dioxygen multiple interactions ISO ELK1 (Homo sapiens) 6480464 3 more ... CTD PMID:23452621 and PMID:32992648 Elk1 Rat dioxygen increases expression ISO ELK1 (Homo sapiens) 6480464 Oxygen deficiency results in increased expression of ELK1 mRNA CTD PMID:23452621 Elk1 Rat Enterolactone multiple interactions ISO ELK1 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of ELK1 mRNA CTD PMID:19167446 Elk1 Rat erlotinib hydrochloride multiple interactions ISO ELK1 (Homo sapiens) 6480464 Erlotinib Hydrochloride inhibits the reaction [EGF protein results in increased activity of ELK1 protein] and Erlotinib Hydrochloride inhibits the reaction [EGF protein results in increased phosphorylation of ELK1 protein] CTD PMID:25625231 and PMID:30364229 Elk1 Rat ethanol multiple interactions EXP 6480464 N-methyl-N-(6-methoxy-1-phenyl-1 more ... CTD PMID:20655511 Elk1 Rat ethanol increases phosphorylation EXP 401938616 ethanol increases phosphorylation of Elk1 protein in amygdala RGD Elk1 Rat ethanol affects splicing ISO Elk1 (Mus musculus) 6480464 Ethanol affects the splicing of ELK1 mRNA CTD PMID:30319688 Elk1 Rat ethanol increases expression EXP 6480464 Ethanol results in increased expression of ELK1 mRNA CTD PMID:20655511 Elk1 Rat eticlopride(1+) increases phosphorylation ISO Elk1 (Mus musculus) 6480464 eticlopride results in increased phosphorylation of ELK1 protein CTD PMID:12871586 Elk1 Rat galangin multiple interactions ISO ELK1 (Homo sapiens) 6480464 galangin inhibits the reaction [EGF protein results in increased phosphorylation of ELK1 protein] CTD PMID:25625231 Elk1 Rat genistein multiple interactions ISO ELK1 (Homo sapiens) 6480464 Genistein inhibits the reaction [Oxygen deficiency results in increased expression of ELK1 mRNA] CTD PMID:23452621 Elk1 Rat haloperidol increases phosphorylation ISO Elk1 (Mus musculus) 6480464 Haloperidol results in increased phosphorylation of ELK1 protein CTD PMID:12871586 Elk1 Rat haloperidol multiple interactions EXP 6480464 Nifedipine affects the reaction [Haloperidol results in increased phosphorylation of ELK1 protein] CTD PMID:17913375 Elk1 Rat haloperidol increases phosphorylation EXP 6480464 Haloperidol results in increased phosphorylation of ELK1 protein CTD PMID:17913375 Elk1 Rat haloperidol multiple interactions ISO Elk1 (Mus musculus) 6480464 SL 327 inhibits the reaction [Haloperidol results in increased phosphorylation of ELK1 protein] CTD PMID:12871586 Elk1 Rat hydrogen cyanide decreases expression ISO Elk1 (Mus musculus) 6480464 Hydrogen Cyanide results in decreased expression of ELK1 mRNA CTD PMID:33914522 Elk1 Rat hydrogen peroxide decreases expression ISO ELK1 (Homo sapiens) 6480464 Hydrogen Peroxide results in decreased expression of ELK1 mRNA CTD PMID:12419474 Elk1 Rat indometacin decreases phosphorylation EXP 6480464 Indomethacin results in decreased phosphorylation of ELK1 protein CTD PMID:32128977 Elk1 Rat lead(II) chloride multiple interactions ISO ELK1 (Homo sapiens) 6480464 [cadmium sulfate co-treated with cobaltous chloride co-treated with lead chloride] affects the expression of ELK1 mRNA CTD PMID:18654764 Elk1 Rat leflunomide multiple interactions ISO ELK1 (Homo sapiens) 6480464 Leflunomide inhibits the reaction [EGF protein results in increased activity of ELK1 protein] CTD PMID:30364229 Elk1 Rat letrozole increases expression ISO Elk1 (Mus musculus) 6480464 letrozole results in increased expression of ELK1 protein CTD PMID:15967659 Elk1 Rat mancozeb increases phosphorylation ISO ELK1 (Homo sapiens) 6480464 mancozeb results in increased phosphorylation of ELK1 protein CTD PMID:21375462 Elk1 Rat maneb multiple interactions ISO Elk1 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of ELK1 mRNA and Melatonin inhibits the reaction [[Maneb co-treated with Paraquat] results in decreased expression of ELK1 mRNA] CTD PMID:23963992 Elk1 Rat melatonin multiple interactions ISO Elk1 (Mus musculus) 6480464 Melatonin inhibits the reaction [[Maneb co-treated with Paraquat] results in decreased expression of ELK1 mRNA] CTD PMID:23963992 Elk1 Rat methoxyacetic acid multiple interactions ISO ELK1 (Homo sapiens) 6480464 methoxyacetic acid promotes the reaction [EGF protein results in increased activity of ELK1 protein] more ... CTD PMID:15103026 Elk1 Rat methoxyacetic acid increases activity ISO ELK1 (Homo sapiens) 6480464 methoxyacetic acid results in increased activity of ELK1 protein CTD PMID:15103026 Elk1 Rat Mitotane increases activity ISO ELK1 (Homo sapiens) 6480464 Mitotane results in increased activity of ELK1 protein CTD PMID:18791200 Elk1 Rat morphine increases activity ISO Elk1 (Mus musculus) 6480464 Morphine results in increased activity of ELK1 protein CTD PMID:22454534 Elk1 Rat morphine multiple interactions ISO Elk1 (Mus musculus) 6480464 [Morphine results in increased activity of ELK1 protein] which results in increased expression of EGR4 mRNA CTD PMID:22454534 Elk1 Rat morphine affects response to substance ISO Elk1 (Mus musculus) 6480464 ELK1 protein affects the susceptibility to Morphine CTD PMID:22454534 Elk1 Rat N-methyl-4-phenylpyridinium multiple interactions ISO ELK1 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in increased phosphorylation of and affects the localization of ELK1 protein more ... CTD PMID:26264181 Elk1 Rat nickel dichloride affects expression EXP 6480464 nickel chloride affects the expression of ELK1 mRNA CTD PMID:22546817 Elk1 Rat nicotine multiple interactions ISO ELK1 (Homo sapiens) 6480464 Vecuronium Bromide inhibits the reaction [Nicotine results in increased phosphorylation of ELK1 protein] CTD PMID:29486207 Elk1 Rat nicotine increases phosphorylation ISO ELK1 (Homo sapiens) 6480464 Nicotine results in increased phosphorylation of ELK1 protein CTD PMID:29486207 Elk1 Rat nicotine increases phosphorylation EXP 6480464 Nicotine results in increased phosphorylation of ELK1 protein CTD PMID:29486207 Elk1 Rat nifedipine multiple interactions EXP 6480464 Nifedipine affects the reaction [Haloperidol results in increased phosphorylation of ELK1 protein] CTD PMID:17913375 Elk1 Rat ochratoxin A increases phosphorylation EXP 6480464 ochratoxin A results in increased phosphorylation of ELK1 protein CTD PMID:17651772 Elk1 Rat ozone multiple interactions ISO ELK1 (Homo sapiens) 6480464 [Oxygen co-treated with Ozone co-treated with Cannabidiol] results in decreased expression of ELK1 mRNA and [Oxygen co-treated with Ozone] results in decreased expression of ELK1 mRNA CTD PMID:32992648 Elk1 Rat p-anisidine decreases expression ISO Elk1 (Mus musculus) 6480464 4-anisidine results in decreased expression of ELK1 mRNA CTD PMID:12929121 Elk1 Rat paclitaxel decreases expression ISO Elk1 (Mus musculus) 6480464 Paclitaxel results in decreased expression of ELK1 mRNA CTD PMID:12929121 Elk1 Rat paraquat multiple interactions ISO Elk1 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of ELK1 mRNA and Melatonin inhibits the reaction [[Maneb co-treated with Paraquat] results in decreased expression of ELK1 mRNA] CTD PMID:23963992 Elk1 Rat phenobarbital multiple interactions ISO ELK1 (Homo sapiens) 6480464 Phenobarbital inhibits the reaction [EGF protein results in increased phosphorylation of ELK1 protein] CTD PMID:25625231 Elk1 Rat phenylephrine multiple interactions EXP 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [Phenylephrine results in increased expression of ELK1 mRNA] more ... CTD PMID:10900171 Elk1 Rat phenylephrine increases phosphorylation EXP 6480464 Phenylephrine results in increased phosphorylation of ELK1 protein CTD PMID:10900171 Elk1 Rat phenylephrine increases expression EXP 6480464 Phenylephrine results in increased expression of ELK1 mRNA CTD PMID:10900171 Elk1 Rat phorbol 13-acetate 12-myristate increases activity ISO ELK1 (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate results in increased activity of ELK1 protein CTD PMID:18791200 Elk1 Rat phorbol 13-acetate 12-myristate increases phosphorylation ISO ELK1 (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate results in increased phosphorylation of ELK1 protein CTD PMID:21375462 Elk1 Rat potassium chromate increases expression ISO ELK1 (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of ELK1 mRNA CTD PMID:22079256 Elk1 Rat potassium chromate multiple interactions ISO ELK1 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of ELK1 mRNA CTD PMID:22079256 Elk1 Rat propranolol multiple interactions EXP 6480464 [Norepinephrine co-treated with Propranolol] results in increased phosphorylation of ELK1 protein more ... CTD PMID:11880281 Elk1 Rat pterostilbene multiple interactions ISO ELK1 (Homo sapiens) 6480464 pterostilbene inhibits the reaction [[TNF protein co-treated with IFNG protein co-treated with lipopolysaccharide and Escherichia coli O111 B4] results in increased expression of ELK1 protein modified form] CTD PMID:19549798 Elk1 Rat quercetin increases expression ISO ELK1 (Homo sapiens) 6480464 Quercetin results in increased expression of ELK1 mRNA CTD PMID:27514524 Elk1 Rat quercetin decreases expression ISO ELK1 (Homo sapiens) 6480464 Quercetin results in decreased expression of ELK1 protein modified form CTD PMID:12653748 Elk1 Rat quercetin decreases phosphorylation ISO ELK1 (Homo sapiens) 6480464 Quercetin results in decreased phosphorylation of ELK1 protein CTD PMID:12888923 Elk1 Rat quercetin multiple interactions ISO ELK1 (Homo sapiens) 6480464 Quercetin inhibits the reaction [EGF protein results in increased phosphorylation of ELK1 protein] and Quercetin inhibits the reaction [TGFA protein results in increased phosphorylation of ELK1 protein] CTD PMID:12888923 Elk1 Rat resveratrol multiple interactions ISO ELK1 (Homo sapiens) 6480464 ELK1 protein affects the reaction [resveratrol results in increased expression of EGR1 protein] and resveratrol inhibits the reaction [Oxygen deficiency results in increased expression of ELK1 mRNA] CTD PMID:23452621 and PMID:25645941 Elk1 Rat resveratrol increases activity ISO ELK1 (Homo sapiens) 6480464 resveratrol results in increased activity of ELK1 protein CTD PMID:25645941 Elk1 Rat rifampicin decreases expression ISO ELK1 (Homo sapiens) 6480464 Rifampin results in decreased expression of ELK1 mRNA CTD PMID:24552687 Elk1 Rat SB 203580 multiple interactions ISO ELK1 (Homo sapiens) 6480464 [SB 203580 co-treated with 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one] inhibits the reaction [sodium arsenite results in increased phosphorylation of ELK1 protein] more ... CTD PMID:10903806 more ... Elk1 Rat SB 203580 affects activity EXP 6480464 SB 203580 affects the activity of ELK1 protein CTD PMID:21084678 Elk1 Rat SCH 23390 multiple interactions ISO Elk1 (Mus musculus) 6480464 SCH 23390 inhibits the reaction [Dronabinol results in increased phosphorylation of and results in increased activity of ELK1 protein] CTD PMID:11553284 Elk1 Rat serpentine asbestos increases phosphorylation EXP 6480464 [Asbestos more ... CTD PMID:12495932 Elk1 Rat SL-327 multiple interactions ISO Elk1 (Mus musculus) 6480464 SL 327 inhibits the reaction [Dronabinol results in increased phosphorylation of and results in increased activity of ELK1 protein] and SL 327 inhibits the reaction [Haloperidol results in increased phosphorylation of ELK1 protein] CTD PMID:11553284 and PMID:12871586 Elk1 Rat sodium arsenite multiple interactions ISO ELK1 (Homo sapiens) 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [sodium arsenite results in increased activity of ELK1 protein] more ... CTD PMID:10564177 more ... Elk1 Rat sodium arsenite increases phosphorylation ISO ELK1 (Homo sapiens) 6480464 sodium arsenite results in increased phosphorylation of ELK1 protein CTD PMID:12660819 and PMID:21642427 Elk1 Rat sodium arsenite increases expression ISO ELK1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of ELK1 mRNA CTD PMID:12016162 Elk1 Rat sodium arsenite increases activity ISO ELK1 (Homo sapiens) 6480464 sodium arsenite results in increased activity of ELK1 protein CTD PMID:10564177 and PMID:15292961 Elk1 Rat sodium arsenite affects expression ISO ELK1 (Homo sapiens) 6480464 sodium arsenite affects the expression of ELK1 protein CTD PMID:17384772 Elk1 Rat sodium arsenite increases response to substance ISO ELK1 (Homo sapiens) 6480464 ELK1 results in increased susceptibility to sodium arsenite CTD PMID:21642427 Elk1 Rat streptozocin increases phosphorylation EXP 6480464 Streptozocin results in increased phosphorylation of ELK1 protein CTD PMID:12642375 Elk1 Rat sulindac sulfide multiple interactions ISO ELK1 (Homo sapiens) 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [sulindac sulfide results in increased phosphorylation of and results in increased activity of ELK1 protein] more ... CTD PMID:17599376 Elk1 Rat Tanshinone I decreases expression ISO ELK1 (Homo sapiens) 6480464 tanshinone results in decreased expression of ELK1 mRNA CTD PMID:30506648 Elk1 Rat Tanshinone I decreases response to substance ISO ELK1 (Homo sapiens) 6480464 ELK1 mRNA results in decreased susceptibility to tanshinone CTD PMID:30506648 Elk1 Rat temozolomide decreases expression ISO ELK1 (Homo sapiens) 6480464 Temozolomide results in decreased expression of ELK1 mRNA CTD PMID:31758290 Elk1 Rat testosterone enanthate affects expression ISO ELK1 (Homo sapiens) 6480464 testosterone enanthate affects the expression of ELK1 mRNA CTD PMID:17440010 Elk1 Rat Tetrachlorobisphenol A increases expression ISO Elk1 (Mus musculus) 6480464 tetrachlorodian results in increased expression of ELK1 mRNA CTD PMID:37992829 Elk1 Rat Tetrachlorobisphenol A increases expression ISO ELK1 (Homo sapiens) 6480464 tetrachlorodian results in increased expression of ELK1 mRNA CTD PMID:33582643 and PMID:36190352 Elk1 Rat Tetrachlorobisphenol A multiple interactions ISO ELK1 (Homo sapiens) 6480464 4-(6-bromo-1 more ... CTD PMID:36190352 Elk1 Rat Tetrachlorobisphenol A increases expression EXP 6480464 tetrachlorodian results in increased expression of ELK1 mRNA CTD PMID:37992829 Elk1 Rat Tetrachlorobisphenol A multiple interactions ISO Elk1 (Mus musculus) 6480464 U 0126 inhibits the reaction [tetrachlorodian results in increased expression of ELK1 mRNA] and Wortmannin inhibits the reaction [tetrachlorodian results in increased expression of ELK1 mRNA] CTD PMID:37992829 Elk1 Rat titanium dioxide decreases methylation ISO ELK1 (Homo sapiens) 6480464 titanium dioxide results in decreased methylation of ELK1 promoter CTD PMID:34973136 Elk1 Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of ELK1 gene CTD PMID:27618143 Elk1 Rat trichostatin A multiple interactions ISO ELK1 (Homo sapiens) 6480464 U 0126 inhibits the reaction [trichostatin A results in increased activity of ELK1 protein] CTD PMID:15103026 Elk1 Rat trichostatin A increases activity ISO ELK1 (Homo sapiens) 6480464 trichostatin A results in increased activity of ELK1 protein CTD PMID:15103026 Elk1 Rat triphenyl phosphate affects expression ISO ELK1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of ELK1 mRNA CTD PMID:37042841 Elk1 Rat troglitazone increases activity ISO ELK1 (Homo sapiens) 6480464 troglitazone results in increased activity of ELK1 protein CTD PMID:11888673 Elk1 Rat urethane increases expression ISO ELK1 (Homo sapiens) 6480464 Urethane results in increased expression of ELK1 mRNA CTD PMID:28818685 Elk1 Rat valproic acid decreases methylation ISO ELK1 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of ELK1 gene CTD PMID:29154799 Elk1 Rat valproic acid multiple interactions ISO ELK1 (Homo sapiens) 6480464 U 0126 inhibits the reaction [Valproic Acid promotes the reaction [EGF protein results in increased activity of ELK1 protein]] more ... CTD PMID:15103026 Elk1 Rat valproic acid increases activity ISO ELK1 (Homo sapiens) 6480464 Valproic Acid results in increased activity of ELK1 protein CTD PMID:15103026 Elk1 Rat vanadyl sulfate increases activity ISO ELK1 (Homo sapiens) 6480464 vanadyl sulfate results in increased activity of ELK1 protein CTD PMID:10564177 Elk1 Rat vanadyl sulfate multiple interactions ISO ELK1 (Homo sapiens) 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [vanadyl sulfate results in increased activity of ELK1 protein] CTD PMID:10564177 Elk1 Rat vecuronium bromide multiple interactions ISO ELK1 (Homo sapiens) 6480464 Vecuronium Bromide inhibits the reaction [Nicotine results in increased phosphorylation of ELK1 protein] CTD PMID:29486207 Elk1 Rat vemurafenib multiple interactions ISO ELK1 (Homo sapiens) 6480464 [KRAS protein mutant form affects the susceptibility to vemurafenib] which results in increased phosphorylation of ELK1 protein and ELK1 protein affects the reaction [[KRAS protein mutant form affects the susceptibility to vemurafenib] which results in increased expression of TNFRSF10B protein] CTD PMID:27222248 Elk1 Rat vitamin E increases phosphorylation ISO ELK1 (Homo sapiens) 6480464 Vitamin E results in increased phosphorylation of ELK1 protein CTD PMID:11522656 Elk1 Rat wortmannin multiple interactions ISO Elk1 (Mus musculus) 6480464 Wortmannin inhibits the reaction [tetrachlorodian results in increased expression of ELK1 mRNA] CTD PMID:37992829 Elk1 Rat wortmannin multiple interactions ISO ELK1 (Homo sapiens) 6480464 Wortmannin inhibits the reaction [tetrachlorodian results in increased expression of ELK1 mRNA] CTD PMID:36190352 Elk1 Rat zinc atom multiple interactions EXP 6480464 Zinc results in increased phosphorylation of and results in increased activity of ELK1 protein CTD PMID:16960431 Elk1 Rat zinc dichloride multiple interactions EXP 6480464 zinc chloride results in increased phosphorylation of and results in increased activity of ELK1 protein CTD PMID:16960431 Elk1 Rat zinc dichloride increases activity EXP 6480464 zinc chloride results in increased activity of ELK1 protein CTD PMID:20412391 Elk1 Rat zinc sulfate multiple interactions ISO ELK1 (Homo sapiens) 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [Zinc Sulfate results in increased activity of ELK1 protein] CTD PMID:10564177 Elk1 Rat zinc sulfate increases activity ISO ELK1 (Homo sapiens) 6480464 Zinc Sulfate results in increased activity of ELK1 protein CTD PMID:10564177 Elk1 Rat zinc(0) multiple interactions EXP 6480464 Zinc results in increased phosphorylation of and results in increased activity of ELK1 protein CTD PMID:16960431 Elk1 Rat zoledronic acid increases expression ISO ELK1 (Homo sapiens) 6480464 zoledronic acid results in increased expression of ELK1 mRNA CTD PMID:20977926
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(+)-catechin (ISO) (-)-anisomycin (ISO) (-)-epigallocatechin 3-gallate (ISO) (R)-noradrenaline (EXP) (S)-amphetamine (EXP) (S)-nicotine (EXP,ISO) 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (ISO) 1,2-dichloroethane (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-methyl-6-(phenylethynyl)pyridine (EXP) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxynon-2-enal (ISO) 4-hydroxyphenyl retinamide (ISO) aflatoxin B1 (ISO) amphetamine (EXP) androstane-3,17-dione (ISO) anthra[1,9-cd]pyrazol-6(2H)-one (ISO) arsenic acid (EXP) arsenite(3-) (EXP,ISO) arsenous acid (ISO) baicalein (ISO) baicalin (ISO) benzene (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) bisphenol AF (ISO) butyric acid (ISO) cadmium atom (ISO) cadmium dichloride (ISO) cadmium sulfate (ISO) cannabidiol (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chromium(6+) (ISO) chrysin (ISO) cisplatin (ISO) clozapine (ISO) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) coumestrol (ISO) crocidolite asbestos (EXP) curcumin (ISO) cycloheximide (ISO) daidzein (EXP) DDT (ISO) deoxynivalenol (ISO) diarsenic trioxide (ISO) dibromoacetic acid (ISO) dicrotophos (ISO) dieldrin (EXP) dioxygen (ISO) Enterolactone (ISO) erlotinib hydrochloride (ISO) ethanol (EXP,ISO) eticlopride(1+) (ISO) galangin (ISO) genistein (ISO) haloperidol (EXP,ISO) hydrogen cyanide (ISO) hydrogen peroxide (ISO) indometacin (EXP) lead(II) chloride (ISO) leflunomide (ISO) letrozole (ISO) mancozeb (ISO) maneb (ISO) melatonin (ISO) methoxyacetic acid (ISO) Mitotane (ISO) morphine (ISO) N-methyl-4-phenylpyridinium (ISO) nickel dichloride (EXP) nicotine (EXP,ISO) nifedipine (EXP) ochratoxin A (EXP) ozone (ISO) p-anisidine (ISO) paclitaxel (ISO) paraquat (ISO) phenobarbital (ISO) phenylephrine (EXP) phorbol 13-acetate 12-myristate (ISO) potassium chromate (ISO) propranolol (EXP) pterostilbene (ISO) quercetin (ISO) resveratrol (ISO) rifampicin (ISO) SB 203580 (EXP,ISO) SCH 23390 (ISO) serpentine asbestos (EXP) SL-327 (ISO) sodium arsenite (ISO) streptozocin (EXP) sulindac sulfide (ISO) Tanshinone I (ISO) temozolomide (ISO) testosterone enanthate (ISO) Tetrachlorobisphenol A (EXP,ISO) titanium dioxide (ISO) trichloroethene (EXP) trichostatin A (ISO) triphenyl phosphate (ISO) troglitazone (ISO) urethane (ISO) valproic acid (ISO) vanadyl sulfate (ISO) vecuronium bromide (ISO) vemurafenib (ISO) vitamin E (ISO) wortmannin (ISO) zinc atom (EXP) zinc dichloride (EXP) zinc sulfate (ISO) zinc(0) (EXP) zoledronic acid (ISO)
Molecular Function
chromatin binding (IDA) DNA binding (IEA) DNA-binding transcription activator activity, RNA polymerase II-specific (IEA,ISO) DNA-binding transcription factor activity (IEA,ISO) DNA-binding transcription factor activity, RNA polymerase II-specific (IBA,IEA,ISO,ISS) double-stranded DNA binding (IDA) mediator complex binding (IEA,ISO) protein binding (ISO) RNA polymerase II cis-regulatory region sequence-specific DNA binding (IDA,IEA,ISO) RNA polymerase II-specific DNA-binding transcription factor binding (IEA,ISO) sequence-specific DNA binding (IEA) sequence-specific double-stranded DNA binding (IEA,ISO) transcription cis-regulatory region binding (IEA,ISO) transcription regulator activator activity (IEA,ISO) transcription regulator inhibitor activity (IEA,ISO)
1.
Elk-1 associates with the mitochondrial permeability transition pore complex in neurons.
Barrett LE, etal., Proc Natl Acad Sci U S A. 2006 Mar 28;103(13):5155-60. Epub 2006 Mar 20.
2.
Functional components of basic fibroblast growth factor signaling that inhibit lung elastin gene expression.
Carreras I, etal., Am J Physiol Lung Cell Mol Physiol 2001 Oct;281(4):L766-75.
3.
Expression of phospho-Elk-1 in rat gut after the whole body gamma irradiation.
Driak D, etal., Physiol Res. 2008;57(5):753-9. Epub 2007 Oct 11.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
MEK1/2 inhibition attenuates vascular ETA and ETB receptor alterations after cerebral ischaemia.
Henriksson M, etal., Exp Brain Res. 2007 Apr;178(4):470-6. Epub 2006 Nov 8.
6.
Changes in trkB-ERK1/2-CREB/Elk-1 pathways in hippocampal mossy fiber organization after traumatic brain injury.
Hu B, etal., J Cereb Blood Flow Metab. 2004 Aug;24(8):934-43.
7.
Rapid phosphorylation of Elk-1 transcription factor and activation of MAP kinase signal transduction pathways in response to visual stimulation.
Kaminska B, etal., Mol Cell Neurosci. 1999 Jun;13(6):405-14.
8.
Increased levels of transcription factors Elk-1, cyclic adenosine monophosphate response element-binding protein, and activating transcription factor 2 in the cerebellar vermis of schizophrenic patients.
Kyosseva SV, etal., Arch Gen Psychiatry. 2000 Jul;57(7):685-91.
9.
Effector immediate-early gene arc in the amygdala plays a critical role in alcoholism.
Pandey SC, etal., J Neurosci. 2008 Mar 5;28(10):2589-600. doi: 10.1523/JNEUROSCI.4752-07.2008.
10.
JNK- and Rac1-dependent induction of immediate early gene pip92 suppresses neuronal differentiation.
Park JB, etal., J Neurochem. 2007 Jan;100(2):555-66. Epub 2006 Nov 29.
11.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
12.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
13.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
14.
Downstream targets of homeobox gene HLX show altered expression in human idiopathic fetal growth restriction.
Rajaraman G, etal., Am J Pathol. 2010 Jan;176(1):278-87. doi: 10.2353/ajpath.2010.090187. Epub 2009 Dec 11.
15.
GOA pipeline
RGD automated data pipeline
16.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
17.
In vivo expression and regulation of Elk-1, a target of the extracellular-regulated kinase signaling pathway, in the adult rat brain.
Sgambato V, etal., J Neurosci. 1998 Jan 1;18(1):214-26.
18.
A neurotoxic phosphoform of Elk-1 associates with inclusions from multiple neurodegenerative diseases.
Sharma A, etal., PLoS One. 2010 Feb 2;5(2):e9002. doi: 10.1371/journal.pone.0009002.
19.
The protein phosphatase 2A regulatory subunits B'beta and B'delta mediate sustained TrkA neurotrophin receptor autophosphorylation and neuronal differentiation.
Van Kanegan MJ and Strack S, Mol Cell Biol. 2009 Feb;29(3):662-74. doi: 10.1128/MCB.01242-08. Epub 2008 Nov 24.
20.
Androgen inhibition of MAP kinase pathway and Elk-1 activation in proliferating osteoblasts.
Wiren KM, etal., J Mol Endocrinol. 2004 Feb;32(1):209-26.
21.
Kruppel-like factor 4, Elk-1, and histone deacetylases cooperatively suppress smooth muscle cell differentiation markers in response to oxidized phospholipids.
Yoshida T, etal., Am J Physiol Cell Physiol. 2008 Nov;295(5):C1175-82. doi: 10.1152/ajpcell.00288.2008. Epub 2008 Sep 3.
Elk1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 3,692,367 - 3,709,252 (+) NCBI GRCr8 mRatBN7.2 X 1,138,826 - 1,155,713 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 1,139,756 - 1,155,713 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 1,167,915 - 1,183,790 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 4,643,607 - 4,659,482 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 964,852 - 980,733 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 1,287,875 - 1,304,822 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 1,297,099 - 1,304,822 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 2,102,893 - 2,119,843 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 12,597,863 - 12,604,248 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera X 1,708,719 - 1,724,604 (+) NCBI Celera Cytogenetic Map X q11 NCBI
ELK1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 X 47,635,520 - 47,650,604 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl X 47,635,520 - 47,650,604 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 X 47,494,919 - 47,510,003 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 X 47,379,864 - 47,394,964 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 X 47,251,173 - 47,266,274 NCBI Celera X 51,690,183 - 51,705,266 (-) NCBI Celera Cytogenetic Map X p11.23 NCBI HuRef X 45,207,767 - 45,222,756 (-) NCBI HuRef CHM1_1 X 47,526,023 - 47,541,139 (-) NCBI CHM1_1 T2T-CHM13v2.0 X 47,045,421 - 47,060,507 (-) NCBI T2T-CHM13v2.0
Elk1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 X 20,799,634 - 20,816,847 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl X 20,799,634 - 20,816,847 (-) Ensembl GRCm39 Ensembl GRCm38 X 20,933,395 - 20,950,608 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl X 20,933,395 - 20,950,608 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 X 20,510,521 - 20,527,726 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 X 20,091,886 - 20,107,552 (-) NCBI MGSCv36 mm8 Celera X 19,067,257 - 19,084,739 (-) NCBI Celera Cytogenetic Map X A1.3 NCBI cM Map X 16.45 NCBI
Elk1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955516 430,775 - 444,871 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955516 431,081 - 444,871 (+) NCBI ChiLan1.0 ChiLan1.0
ELK1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 X 49,261,994 - 49,277,081 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 X 49,265,366 - 49,280,456 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 X 40,071,433 - 40,086,518 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 X 47,967,492 - 47,982,590 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl X 47,967,492 - 47,982,579 (-) Ensembl panpan1.1 panPan2
ELK1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 X 41,256,205 - 41,270,656 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl X 41,257,482 - 41,270,776 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha X 15,630,809 - 15,645,355 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 X 41,390,004 - 41,404,542 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl X 41,390,011 - 41,404,542 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 X 41,377,550 - 41,392,091 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 X 41,365,833 - 41,380,367 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 X 41,458,515 - 41,473,055 (-) NCBI UU_Cfam_GSD_1.0
Elk1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 X 33,561,981 - 33,577,464 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936502 13,402,728 - 13,418,214 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936502 13,402,726 - 13,418,214 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ELK1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl X 42,157,988 - 42,174,951 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 X 42,157,980 - 42,174,964 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 X 47,303,918 - 47,320,907 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
LOC103231899
Elk1
.
Predicted Target Of
Count of predictions: 618 Count of miRNA genes: 284 Interacting mature miRNAs: 373 Transcripts: ENSRNOT00000013522 Prediction methods: Microtar, Miranda, Pita, Pita,Targetscan, Rnahybrid, Targetscan Result types: miRGate_prediction
731181 Uae27 Urinary albumin excretion QTL 27 2.7 0.0059 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) X 1 43491017 Rat
RH142956
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 X 1,141,957 - 1,142,089 (+) MAPPER mRatBN7.2 Rnor_6.0 X 1,291,069 - 1,291,200 NCBI Rnor6.0 Rnor_5.0 X 2,106,090 - 2,106,221 UniSTS Rnor5.0 RGSC_v3.4 X 12,612,753 - 12,612,884 UniSTS RGSC3.4 Celera X 1,710,853 - 1,710,984 UniSTS Cytogenetic Map X q12 UniSTS
RH140607
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 X 1,141,654 - 1,141,860 (+) MAPPER mRatBN7.2 Rnor_6.0 X 1,290,766 - 1,290,971 NCBI Rnor6.0 Rnor_5.0 X 2,105,787 - 2,105,992 UniSTS Rnor5.0 RGSC_v3.4 X 12,612,982 - 12,613,187 UniSTS RGSC3.4 Celera X 1,710,550 - 1,710,755 UniSTS Cytogenetic Map X q12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000013522 ⟹ ENSRNOP00000013522
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 1,139,756 - 1,155,713 (+) Ensembl Rnor_6.0 Ensembl X 1,297,099 - 1,304,822 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000109793 ⟹ ENSRNOP00000085214
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 1,139,878 - 1,155,713 (+) Ensembl
RefSeq Acc Id:
NM_001108059 ⟹ NP_001101529
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 3,693,365 - 3,709,252 (+) NCBI mRatBN7.2 X 1,139,824 - 1,155,713 (+) NCBI Rnor_6.0 X 1,288,935 - 1,304,822 (+) NCBI Rnor_5.0 X 2,102,893 - 2,119,843 (+) NCBI RGSC_v3.4 X 12,597,863 - 12,604,248 (-) RGD Celera X 1,708,719 - 1,724,604 (+) NCBI
Sequence:
GCCTTGGAACCCGGGCCTGGGGGGCGGTGGGGCCTCGTATGGAGCCCCCGCCCCCCGGAGCTGCCGCTGCCACCGCCGCGCCACACGCAGGTACATTGGTGCACACCTACCTTTATTCCCAGTACTCA
hide sequence
RefSeq Acc Id:
XM_006256614 ⟹ XP_006256676
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 3,692,367 - 3,709,252 (+) NCBI mRatBN7.2 X 1,138,826 - 1,155,713 (+) NCBI Rnor_6.0 X 1,287,875 - 1,304,822 (+) NCBI Rnor_5.0 X 2,102,893 - 2,119,843 (+) NCBI
Sequence:
CCTGTGACCAGGTCACTCAAAAGATAGAGGCAGAAGGATTTTTAAGTTTAAGGCAATCCTGGGCTACATGAGACCCTTGAAACAAATTTTTAAGGTTCCAGTTCAAAGTGATTTGTTTCCATGGCCCT
hide sequence
RefSeq Acc Id:
XM_063280007 ⟹ XP_063136077
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 3,692,367 - 3,709,252 (+) NCBI
RefSeq Acc Id:
NP_001101529 ⟸ NM_001108059
- UniProtKB:
A4GTP4 (UniProtKB/TrEMBL), A0A8I6A3K1 (UniProtKB/TrEMBL)
- Sequence:
MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKLSRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSAVAMAPATVHSGPGDNATG
hide sequence
RefSeq Acc Id:
XP_006256676 ⟸ XM_006256614
- Peptide Label:
isoform X1
- UniProtKB:
A4GTP4 (UniProtKB/TrEMBL), A0A8I6A3K1 (UniProtKB/TrEMBL)
- Sequence:
MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKLSRAL
hide sequence
Ensembl Acc Id:
ENSRNOP00000013522 ⟸ ENSRNOT00000013522
Ensembl Acc Id:
ENSRNOP00000085214 ⟸ ENSRNOT00000109793
RefSeq Acc Id:
XP_063136077 ⟸ XM_063280007
- Peptide Label:
isoform X2
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2019-04-10
Elk1
ETS transcription factor ELK1
Elk1
ELK1, ETS transcription factor
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2016-03-01
Elk1
ELK1, ETS transcription factor
Elk1
ELK1, member of ETS oncogene family
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-12-10
Elk1
ELK1, member of ETS oncogene family
Symbol and Name status set to provisional
70820 PROVISIONAL
