Symbol:
Psmd14
Name:
proteasome 26S subunit, non-ATPase 14
RGD ID:
1594532
Description:
Predicted to enable endopeptidase activator activity; metal-dependent deubiquitinase activity; and proteasome binding activity. Involved in response to ethanol. Part of cytosolic proteasome complex. Orthologous to human PSMD14 (proteasome 26S subunit, non-ATPase 14); PARTICIPATES IN ataxia telangiectasia-mutated (ATM) signaling pathway; ubiquitin/proteasome degradation pathway; INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; acrylamide.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
26S proteasome non-ATPase regulatory subunit 14; LOC295644; LOC311078; MGC114474; proteasome (prosome, macropain) 26S subunit, non-ATPase, 14; similar to T-Brain-1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PSMD14 (proteasome 26S subunit, non-ATPase 14)
HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, Panther
Mus musculus (house mouse):
Psmd14 (proteasome (prosome, macropain) 26S subunit, non-ATPase, 14)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Psmd14 (proteasome 26S subunit, non-ATPase 14)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PSMD14 (proteasome 26S subunit, non-ATPase 14)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PSMD14 (proteasome 26S subunit, non-ATPase 14)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Psmd14 (proteasome 26S subunit, non-ATPase 14)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PSMD14 (proteasome 26S subunit, non-ATPase 14)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PSMD14 (proteasome 26S subunit, non-ATPase 14)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Psmd14 (proteasome 26S subunit, non-ATPase 14)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
PSMD14 (proteasome 26S subunit, non-ATPase 14)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Psmd14 (proteasome (prosome, macropain) 26S subunit, non-ATPase, 14)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
psmd14 (proteasome 26S subunit, non-ATPase 14)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
RPN11
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
rpn-11
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Rpn11
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
psmd14
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 66,662,933 - 66,755,666 (+) NCBI GRCr8 mRatBN7.2 3 46,254,338 - 46,347,076 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 46,254,330 - 46,347,076 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 49,600,021 - 49,692,757 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 58,183,542 - 58,276,273 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 55,966,122 - 56,058,875 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 47,578,449 - 47,673,330 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 47,578,384 - 47,673,338 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 54,249,938 - 54,344,886 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 43,660,136 - 43,699,412 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 3 45,922,238 - 46,014,721 (+) NCBI Celera Cytogenetic Map 3 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Psmd14 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of PSMD14 mRNA] CTD PMID:31150632 Psmd14 Rat (1->4)-beta-D-glucan multiple interactions ISO Psmd14 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PSMD14 mRNA CTD PMID:36331819 Psmd14 Rat 1,2-dimethylhydrazine multiple interactions ISO Psmd14 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of PSMD14 mRNA CTD PMID:22206623 Psmd14 Rat 17alpha-ethynylestradiol multiple interactions ISO Psmd14 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PSMD14 mRNA CTD PMID:17942748 Psmd14 Rat 17beta-estradiol increases expression ISO PSMD14 (Homo sapiens) 6480464 Estradiol results in increased expression of PSMD14 mRNA CTD PMID:16514628 Psmd14 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of PSMD14 mRNA CTD PMID:32145629 Psmd14 Rat 17beta-estradiol affects expression ISO Psmd14 (Mus musculus) 6480464 Estradiol affects the expression of PSMD14 mRNA CTD PMID:15598610 Psmd14 Rat 1H-pyrazole increases expression ISO Psmd14 (Mus musculus) 6480464 pyrazole results in increased expression of PSMD14 mRNA CTD PMID:17945193 Psmd14 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Psmd14 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Psmd14 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Psmd14 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PSMD14 mRNA CTD PMID:17942748 Psmd14 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Psmd14 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PSMD14 mRNA CTD PMID:21570461 Psmd14 Rat 2,6-dimethoxyphenol multiple interactions ISO PSMD14 (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Psmd14 Rat 2-bromohexadecanoic acid multiple interactions ISO PSMD14 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of PSMD14 protein] CTD PMID:38195004 Psmd14 Rat 2-hydroxypropanoic acid decreases expression ISO PSMD14 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of PSMD14 mRNA CTD PMID:30851411 Psmd14 Rat 2-methylcholine affects expression ISO PSMD14 (Homo sapiens) 6480464 beta-methylcholine affects the expression of PSMD14 mRNA CTD PMID:21179406 Psmd14 Rat 3H-1,2-dithiole-3-thione increases expression ISO Psmd14 (Mus musculus) 6480464 1 and 2-dithiol-3-thione results in increased expression of PSMD14 mRNA CTD PMID:15375163 Psmd14 Rat 4,4'-sulfonyldiphenol increases expression ISO Psmd14 (Mus musculus) 6480464 bisphenol S results in increased expression of PSMD14 mRNA CTD PMID:39298647 Psmd14 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of PSMD14 mRNA CTD PMID:28959563 Psmd14 Rat acrylamide increases expression ISO PSMD14 (Homo sapiens) 6480464 Acrylamide results in increased expression of PSMD14 mRNA CTD PMID:32763439 Psmd14 Rat afimoxifene decreases expression ISO PSMD14 (Homo sapiens) 6480464 afimoxifene results in decreased expression of PSMD14 mRNA CTD PMID:16514628 Psmd14 Rat aflatoxin B1 decreases methylation ISO PSMD14 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of PSMD14 gene and Aflatoxin B1 results in decreased methylation of PSMD14 intron CTD PMID:27153756 and PMID:30157460 Psmd14 Rat aflatoxin B1 decreases expression EXP 6480464 Aflatoxin B1 results in decreased expression of PSMD14 mRNA CTD PMID:33354967 Psmd14 Rat all-trans-retinoic acid decreases expression ISO PSMD14 (Homo sapiens) 6480464 Tretinoin results in decreased expression of PSMD14 mRNA CTD PMID:33167477 Psmd14 Rat aristolochic acid A decreases expression ISO PSMD14 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of PSMD14 mRNA CTD PMID:33212167 Psmd14 Rat Aroclor 1254 decreases expression ISO Psmd14 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of PSMD14 mRNA CTD PMID:23650126 Psmd14 Rat arsane affects expression ISO PSMD14 (Homo sapiens) 6480464 Arsenic affects the expression of PSMD14 mRNA CTD PMID:18414638 Psmd14 Rat arsane multiple interactions ISO PSMD14 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of PSMD14 mRNA more ... CTD PMID:35809665 and PMID:39836092 Psmd14 Rat arsenic atom affects expression ISO PSMD14 (Homo sapiens) 6480464 Arsenic affects the expression of PSMD14 mRNA CTD PMID:18414638 Psmd14 Rat arsenic atom multiple interactions ISO PSMD14 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of PSMD14 mRNA more ... CTD PMID:35809665 and PMID:39836092 Psmd14 Rat arsenic trichloride multiple interactions ISO PSMD14 (Homo sapiens) 6480464 [arsenic trichloride results in increased abundance of Arsenic] which results in decreased expression of PSMD14 mRNA CTD PMID:35809665 Psmd14 Rat benzo[a]pyrene increases expression ISO Psmd14 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of PSMD14 mRNA CTD PMID:22228805 Psmd14 Rat benzo[a]pyrene affects methylation ISO PSMD14 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of PSMD14 promoter CTD PMID:27901495 Psmd14 Rat beta-lapachone increases expression ISO PSMD14 (Homo sapiens) 6480464 beta-lapachone results in increased expression of PSMD14 mRNA CTD PMID:38218311 Psmd14 Rat bis(2-ethylhexyl) phthalate increases expression ISO Psmd14 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of PSMD14 mRNA CTD PMID:19850644 Psmd14 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Psmd14 (Mus musculus) 6480464 PPARA protein promotes the reaction [Diethylhexyl Phthalate results in increased expression of PSMD14 mRNA] CTD PMID:19850644 Psmd14 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PSMD14 mRNA CTD PMID:25181051 and PMID:30816183 Psmd14 Rat bisphenol A multiple interactions ISO PSMD14 (Homo sapiens) 6480464 [[ginger extract results in increased abundance of Oils and Volatile] which co-treated with bisphenol A] affects the expression of PSMD14 protein CTD PMID:33376534 Psmd14 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PSMD14 mRNA CTD PMID:32145629 and PMID:33296240 Psmd14 Rat bisphenol A decreases expression ISO PSMD14 (Homo sapiens) 6480464 bisphenol A results in decreased expression of PSMD14 mRNA and bisphenol A results in decreased expression of PSMD14 protein CTD PMID:29275510 and PMID:34186270 Psmd14 Rat bisphenol A affects expression ISO PSMD14 (Homo sapiens) 6480464 bisphenol A affects the expression of PSMD14 mRNA CTD PMID:30903817 Psmd14 Rat bisphenol AF increases expression ISO PSMD14 (Homo sapiens) 6480464 bisphenol AF results in increased expression of PSMD14 protein CTD PMID:34186270 Psmd14 Rat Bisphenol B increases expression ISO PSMD14 (Homo sapiens) 6480464 bisphenol B results in increased expression of PSMD14 protein CTD PMID:34186270 Psmd14 Rat bisphenol F increases expression ISO PSMD14 (Homo sapiens) 6480464 bisphenol F results in increased expression of PSMD14 protein CTD PMID:34186270 Psmd14 Rat cadmium atom multiple interactions ISO PSMD14 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of PSMD14 protein] more ... CTD PMID:35301059 and PMID:38195004 Psmd14 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of PSMD14 mRNA CTD PMID:21297351 Psmd14 Rat cadmium dichloride multiple interactions ISO PSMD14 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of PSMD14 protein] more ... CTD PMID:35301059 and PMID:38195004 Psmd14 Rat cadmium dichloride increases expression ISO PSMD14 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of PSMD14 mRNA CTD PMID:38568856 Psmd14 Rat captan increases expression ISO Psmd14 (Mus musculus) 6480464 Captan results in increased expression of PSMD14 mRNA CTD PMID:31558096 Psmd14 Rat carbon nanotube increases expression ISO Psmd14 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Psmd14 Rat chloropicrin increases expression ISO PSMD14 (Homo sapiens) 6480464 chloropicrin results in increased expression of PSMD14 mRNA CTD PMID:26352163 Psmd14 Rat chlorpyrifos decreases methylation EXP 6480464 Chlorpyrifos results in decreased methylation of PSMD14 gene CTD PMID:32905263 Psmd14 Rat cisplatin multiple interactions ISO PSMD14 (Homo sapiens) 6480464 [Cisplatin results in decreased susceptibility to Cisplatin] which results in increased expression of PSMD14 mRNA CTD PMID:30871063 Psmd14 Rat clofibrate increases expression ISO Psmd14 (Mus musculus) 6480464 Clofibrate results in increased expression of PSMD14 mRNA CTD PMID:23811191 Psmd14 Rat clozapine increases expression ISO PSMD14 (Homo sapiens) 6480464 Clozapine results in increased expression of PSMD14 protein CTD PMID:34122009 Psmd14 Rat cobalt dichloride increases expression ISO PSMD14 (Homo sapiens) 6480464 cobaltous chloride results in increased expression of PSMD14 mRNA CTD PMID:19376846 Psmd14 Rat cobalt dichloride increases expression EXP 6480464 cobaltous chloride results in increased expression of PSMD14 mRNA CTD PMID:24386269 Psmd14 Rat copper(II) chloride increases expression ISO PSMD14 (Homo sapiens) 6480464 cupric chloride results in increased expression of PSMD14 mRNA CTD PMID:17211630 Psmd14 Rat copper(II) sulfate increases expression ISO PSMD14 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of PSMD14 mRNA CTD PMID:19549813 Psmd14 Rat cyclosporin A increases expression ISO PSMD14 (Homo sapiens) 6480464 Cyclosporine results in increased expression of PSMD14 mRNA CTD PMID:20106945 more ... Psmd14 Rat cyclosporin A increases methylation ISO PSMD14 (Homo sapiens) 6480464 Cyclosporine results in increased methylation of PSMD14 promoter CTD PMID:27989131 Psmd14 Rat dibenzo[a,l]pyrene decreases expression ISO Psmd14 (Mus musculus) 6480464 dibenzo(a and l)pyrene results in decreased expression of PSMD14 mRNA CTD PMID:25908611 Psmd14 Rat Dibutyl phosphate affects expression ISO PSMD14 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of PSMD14 mRNA CTD PMID:37042841 Psmd14 Rat dicrotophos decreases expression ISO PSMD14 (Homo sapiens) 6480464 dicrotophos results in decreased expression of PSMD14 mRNA CTD PMID:28302478 Psmd14 Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of PSMD14 protein CTD PMID:19609968 Psmd14 Rat ethanol increases expression ISO Psmd14 (Mus musculus) 6480464 Ethanol results in increased expression of PSMD14 mRNA CTD PMID:30319688 Psmd14 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of PSMD14 mRNA CTD PMID:24136188 Psmd14 Rat fluorescein 5-isothiocyanate affects binding ISO PSMD14 (Homo sapiens) 6480464 Fluorescein-5-isothiocyanate binds to PSMD14 protein CTD PMID:27129696 Psmd14 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of PSMD14 mRNA CTD PMID:24136188 Psmd14 Rat folic acid multiple interactions ISO Psmd14 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of PSMD14 mRNA CTD PMID:22206623 Psmd14 Rat folpet increases expression ISO Psmd14 (Mus musculus) 6480464 folpet results in increased expression of PSMD14 mRNA CTD PMID:31558096 Psmd14 Rat fulvestrant decreases expression ISO PSMD14 (Homo sapiens) 6480464 fulvestrant results in decreased expression of PSMD14 mRNA CTD PMID:16514628 Psmd14 Rat furan increases methylation EXP 6480464 furan results in increased methylation of PSMD14 gene CTD PMID:22079235 Psmd14 Rat furfural multiple interactions ISO PSMD14 (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Psmd14 Rat glafenine increases expression EXP 6480464 Glafenine results in increased expression of PSMD14 mRNA CTD PMID:24136188 Psmd14 Rat gold atom decreases expression ISO PSMD14 (Homo sapiens) 6480464 Gold results in decreased expression of PSMD14 mRNA CTD PMID:25523186 Psmd14 Rat gold(0) decreases expression ISO PSMD14 (Homo sapiens) 6480464 Gold results in decreased expression of PSMD14 mRNA CTD PMID:25523186 Psmd14 Rat inulin multiple interactions ISO Psmd14 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of PSMD14 mRNA CTD PMID:36331819 Psmd14 Rat ivermectin decreases expression ISO PSMD14 (Homo sapiens) 6480464 Ivermectin results in decreased expression of PSMD14 protein CTD PMID:32959892 Psmd14 Rat leflunomide increases expression EXP 6480464 leflunomide results in increased expression of PSMD14 mRNA CTD PMID:24136188 Psmd14 Rat manganese atom multiple interactions ISO PSMD14 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of PSMD14 mRNA CTD PMID:39836092 Psmd14 Rat manganese(0) multiple interactions ISO PSMD14 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of PSMD14 mRNA CTD PMID:39836092 Psmd14 Rat manganese(II) chloride multiple interactions ISO PSMD14 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of PSMD14 mRNA CTD PMID:39836092 Psmd14 Rat monosodium L-glutamate multiple interactions ISO Psmd14 (Mus musculus) 6480464 [Trans Fatty Acids co-treated with Sodium Glutamate] results in increased expression of PSMD14 mRNA CTD PMID:22078008 Psmd14 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal increases expression ISO PSMD14 (Homo sapiens) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased expression of PSMD14 mRNA CTD PMID:31806706 Psmd14 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of PSMD14 mRNA CTD PMID:24136188 Psmd14 Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of PSMD14 mRNA CTD PMID:24136188 Psmd14 Rat nitrates multiple interactions ISO Psmd14 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of PSMD14 mRNA CTD PMID:35964746 Psmd14 Rat okadaic acid increases expression ISO PSMD14 (Homo sapiens) 6480464 Okadaic Acid results in increased expression of PSMD14 mRNA CTD PMID:38832940 Psmd14 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of PSMD14 mRNA CTD PMID:25729387 Psmd14 Rat ozone multiple interactions ISO Psmd14 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of Ozone] which results in increased expression of PSMD14 mRNA CTD PMID:34911549 Psmd14 Rat paracetamol affects expression ISO Psmd14 (Mus musculus) 6480464 Acetaminophen affects the expression of PSMD14 mRNA CTD PMID:17562736 Psmd14 Rat perfluorohexanesulfonic acid increases expression ISO Psmd14 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of PSMD14 mRNA CTD PMID:37995155 Psmd14 Rat perfluorooctane-1-sulfonic acid affects expression ISO Psmd14 (Mus musculus) 6480464 perfluorooctane sulfonic acid affects the expression of PSMD14 mRNA CTD PMID:19429403 Psmd14 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Psmd14 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PSMD14 mRNA and [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of PSMD14 mRNA CTD PMID:36331819 Psmd14 Rat perfluorooctane-1-sulfonic acid increases expression ISO Psmd14 (Mus musculus) 6480464 perfluorooctane sulfonic acid results in increased expression of PSMD14 mRNA CTD PMID:20936131 Psmd14 Rat perfluorooctanoic acid affects expression ISO Psmd14 (Mus musculus) 6480464 perfluorooctanoic acid affects the expression of PSMD14 mRNA CTD PMID:19429403 Psmd14 Rat perfluorooctanoic acid multiple interactions ISO Psmd14 (Mus musculus) 6480464 PPARA protein affects the reaction [perfluorooctanoic acid results in increased expression of PSMD14 mRNA] CTD PMID:21318169 Psmd14 Rat perfluorooctanoic acid increases expression ISO Psmd14 (Mus musculus) 6480464 perfluorooctanoic acid results in increased expression of PSMD14 mRNA CTD PMID:21318169 Psmd14 Rat phenobarbital affects expression ISO PSMD14 (Homo sapiens) 6480464 Phenobarbital affects the expression of PSMD14 mRNA CTD PMID:19159669 Psmd14 Rat phlorizin decreases expression ISO Psmd14 (Mus musculus) 6480464 Phlorhizin results in decreased expression of PSMD14 mRNA CTD PMID:22538082 Psmd14 Rat pirinixic acid multiple interactions ISO Psmd14 (Mus musculus) 6480464 PPARA protein affects the reaction [pirinixic acid results in increased expression of PSMD14 mRNA] and PPARA protein promotes the reaction [pirinixic acid results in increased expression of PSMD14 mRNA] CTD PMID:20059764 and PMID:21318169 Psmd14 Rat pirinixic acid increases expression ISO Psmd14 (Mus musculus) 6480464 pirinixic acid results in increased expression of PSMD14 mRNA CTD PMID:15375163 more ... Psmd14 Rat propiconazole increases expression ISO Psmd14 (Mus musculus) 6480464 propiconazole results in increased expression of PSMD14 mRNA CTD PMID:21278054 Psmd14 Rat rac-lactic acid decreases expression ISO PSMD14 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of PSMD14 mRNA CTD PMID:30851411 Psmd14 Rat raloxifene decreases expression ISO PSMD14 (Homo sapiens) 6480464 Raloxifene Hydrochloride results in decreased expression of PSMD14 mRNA CTD PMID:16514628 Psmd14 Rat resveratrol increases expression ISO Psmd14 (Mus musculus) 6480464 resveratrol results in increased expression of PSMD14 protein CTD PMID:25505154 Psmd14 Rat rotenone increases expression ISO PSMD14 (Homo sapiens) 6480464 Rotenone results in increased expression of PSMD14 mRNA CTD PMID:33512557 Psmd14 Rat sodium arsenite increases expression ISO PSMD14 (Homo sapiens) 6480464 sodium arsenite results in increased expression of PSMD14 mRNA CTD PMID:38568856 Psmd14 Rat sodium arsenite multiple interactions ISO PSMD14 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of PSMD14 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of PSMD14 mRNA CTD PMID:39836092 Psmd14 Rat sodium chloride multiple interactions ISO PSMD14 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of PSMD14 protein more ... CTD PMID:38598786 Psmd14 Rat sunitinib decreases expression ISO PSMD14 (Homo sapiens) 6480464 Sunitinib results in decreased expression of PSMD14 mRNA CTD PMID:31533062 Psmd14 Rat tetrachloromethane increases expression ISO Psmd14 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of PSMD14 mRNA CTD PMID:27339419 and PMID:31919559 Psmd14 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of PSMD14 mRNA] CTD PMID:31150632 Psmd14 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of PSMD14 mRNA CTD PMID:31150632 Psmd14 Rat thiram increases expression ISO PSMD14 (Homo sapiens) 6480464 Thiram results in increased expression of PSMD14 mRNA CTD PMID:38568856 Psmd14 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of PSMD14 mRNA CTD PMID:25729387 Psmd14 Rat trichloroethene affects expression ISO Psmd14 (Mus musculus) 6480464 Trichloroethylene affects the expression of PSMD14 mRNA CTD PMID:21135412 Psmd14 Rat trimellitic anhydride increases expression ISO Psmd14 (Mus musculus) 6480464 trimellitic anhydride results in increased expression of PSMD14 mRNA CTD PMID:19042947 Psmd14 Rat triphenyl phosphate affects expression ISO PSMD14 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of PSMD14 mRNA CTD PMID:37042841 Psmd14 Rat triptonide increases expression ISO Psmd14 (Mus musculus) 6480464 triptonide results in increased expression of PSMD14 mRNA CTD PMID:33045310 Psmd14 Rat valdecoxib increases expression EXP 6480464 valdecoxib results in increased expression of PSMD14 mRNA CTD PMID:24136188 Psmd14 Rat valproic acid increases expression ISO PSMD14 (Homo sapiens) 6480464 Valproic Acid results in increased expression of PSMD14 mRNA CTD PMID:23179753 Psmd14 Rat valproic acid affects expression ISO PSMD14 (Homo sapiens) 6480464 Valproic Acid affects the expression of PSMD14 mRNA CTD PMID:25979313
Imported Annotations - KEGG (archival)
(+)-schisandrin B (EXP) (1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 1H-pyrazole (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,6-dimethoxyphenol (ISO) 2-bromohexadecanoic acid (ISO) 2-hydroxypropanoic acid (ISO) 2-methylcholine (ISO) 3H-1,2-dithiole-3-thione (ISO) 4,4'-sulfonyldiphenol (ISO) acrylamide (EXP,ISO) afimoxifene (ISO) aflatoxin B1 (EXP,ISO) all-trans-retinoic acid (ISO) aristolochic acid A (ISO) Aroclor 1254 (ISO) arsane (ISO) arsenic atom (ISO) arsenic trichloride (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) captan (ISO) carbon nanotube (ISO) chloropicrin (ISO) chlorpyrifos (EXP) cisplatin (ISO) clofibrate (ISO) clozapine (ISO) cobalt dichloride (EXP,ISO) copper(II) chloride (ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) dibenzo[a,l]pyrene (ISO) Dibutyl phosphate (ISO) dicrotophos (ISO) ethanol (EXP,ISO) finasteride (EXP) fluorescein 5-isothiocyanate (ISO) flutamide (EXP) folic acid (ISO) folpet (ISO) fulvestrant (ISO) furan (EXP) furfural (ISO) glafenine (EXP) gold atom (ISO) gold(0) (ISO) inulin (ISO) ivermectin (ISO) leflunomide (EXP) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) monosodium L-glutamate (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) nefazodone (EXP) nimesulide (EXP) nitrates (ISO) okadaic acid (ISO) oxaliplatin (EXP) ozone (ISO) paracetamol (ISO) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenobarbital (ISO) phlorizin (ISO) pirinixic acid (ISO) propiconazole (ISO) rac-lactic acid (ISO) raloxifene (ISO) resveratrol (ISO) rotenone (ISO) sodium arsenite (ISO) sodium chloride (ISO) sunitinib (ISO) tetrachloromethane (EXP,ISO) thiram (ISO) topotecan (EXP) trichloroethene (ISO) trimellitic anhydride (ISO) triphenyl phosphate (ISO) triptonide (ISO) valdecoxib (EXP) valproic acid (ISO)
Psmd14 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 66,662,933 - 66,755,666 (+) NCBI GRCr8 mRatBN7.2 3 46,254,338 - 46,347,076 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 46,254,330 - 46,347,076 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 49,600,021 - 49,692,757 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 58,183,542 - 58,276,273 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 55,966,122 - 56,058,875 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 47,578,449 - 47,673,330 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 47,578,384 - 47,673,338 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 54,249,938 - 54,344,886 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 43,660,136 - 43,699,412 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 3 45,922,238 - 46,014,721 (+) NCBI Celera Cytogenetic Map 3 q21 NCBI
PSMD14 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 161,308,425 - 161,411,717 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 161,308,425 - 161,411,717 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 162,164,936 - 162,268,228 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 161,873,186 - 161,976,172 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 161,990,446 - 162,093,433 NCBI Celera 2 155,776,557 - 155,880,315 (+) NCBI Celera Cytogenetic Map 2 q24.2 NCBI HuRef 2 154,049,213 - 154,152,684 (+) NCBI HuRef CHM1_1 2 162,170,938 - 162,274,393 (+) NCBI CHM1_1 T2T-CHM13v2.0 2 161,766,719 - 161,870,044 (+) NCBI T2T-CHM13v2.0
Psmd14 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 61,542,038 - 61,630,720 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 61,542,038 - 61,630,720 (+) Ensembl GRCm39 Ensembl GRCm38 2 61,711,694 - 61,800,376 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 61,711,694 - 61,800,376 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 61,549,751 - 61,638,433 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 61,512,608 - 61,601,215 (+) NCBI MGSCv36 mm8 Celera 2 63,413,313 - 63,502,325 (+) NCBI Celera Cytogenetic Map 2 C1.3 NCBI cM Map 2 35.56 NCBI
Psmd14 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955449 12,306,026 - 12,400,908 (-) NCBI ChiLan1.0 ChiLan1.0
PSMD14 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 13 63,997,127 - 64,103,767 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2B 64,014,080 - 64,118,739 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2B 48,602,395 - 48,705,229 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2B 165,972,229 - 166,074,879 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2B 165,972,229 - 166,074,879 (+) Ensembl panpan1.1 panPan2
PSMD14 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 36 6,883,612 - 6,985,291 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 36 6,889,622 - 6,984,974 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 36 7,019,712 - 7,122,412 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 36 7,006,841 - 7,109,577 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 36 7,006,840 - 7,117,492 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 36 7,023,304 - 7,125,998 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 36 7,067,598 - 7,170,265 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 36 7,175,451 - 7,278,173 (+) NCBI UU_Cfam_GSD_1.0
Psmd14 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405303 124,016,680 - 124,123,583 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936469 17,494,134 - 17,601,045 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936469 17,494,137 - 17,601,045 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PSMD14 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 15 68,162,532 - 68,208,883 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 15 68,107,379 - 68,208,884 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 15 75,585,422 - 75,707,658 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PSMD14 (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 10 46,703,876 - 46,814,938 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 10 46,704,098 - 46,815,132 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666040 152,727,806 - 152,837,708 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Psmd14 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 34 Count of miRNA genes: 28 Interacting mature miRNAs: 33 Transcripts: ENSRNOT00000006605 Prediction methods: Miranda, Targetscan Result types: miRGate_prediction
10401810 Kidm53 Kidney mass QTL 53 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 8227194 47233430 Rat 2298542 Neuinf11 Neuroinflammation QTL 11 3.9 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 3 15005422 76927699 Rat 1358362 Srcrt2 Stress Responsive Cort QTL 2 2.78 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 3 38192233 133483320 Rat 737818 Hcar12 Hepatocarcinoma resistance QTL 12 2.6 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 3 29463235 118376539 Rat 9590286 Uminl1 Urine mineral level QTL 1 3.5 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 3 28249687 73249687 Rat 10450816 Scl75 Serum cholesterol level QTL 75 4.4 0.001 blood LDL cholesterol amount (VT:0000181) blood low density lipoprotein cholesterol level (CMO:0000053) 3 38192233 50749747 Rat 2313093 Bmd77 Bone mineral density QTL 77 2.2 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 3 27494621 50302886 Rat 1581503 Cm58 Cardiac mass QTL 58 2.7 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 43827364 121056321 Rat 12879852 Cm93 Cardiac mass QTL 93 0.001 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 3 18311454 47233430 Rat 12879853 Am5 Aortic mass QTL 5 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 3 18311454 47233430 Rat 12879854 Kidm63 Kidney mass QTL 63 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 18311454 47233430 Rat 61356 Bp37 Blood pressure QTL 37 3 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 3 30684642 75684642 Rat 1358905 Hrtrt17 Heart rate QTL 17 5.9 0.000014 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 3 10861912 89878372 Rat 12879849 Bw180 Body weight QTL 180 0.037 body mass (VT:0001259) body weight (CMO:0000012) 3 18311454 47233430 Rat 70191 BpQTLcluster4 Blood pressure QTL cluster 4 3 arterial blood pressure trait (VT:2000000) absolute change in systolic blood pressure (CMO:0000607) 3 10778704 50302886 Rat 12879850 Cm91 Cardiac mass QTL 91 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 3 18311454 47233430 Rat 2313101 Bmd76 Bone mineral density QTL 76 3.6 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 3 27494621 50302886 Rat 731172 Bp151 Blood pressure QTL 151 0.04 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 18311454 47233430 Rat 12879851 Cm92 Cardiac mass QTL 92 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 18311454 47233430 Rat 8694196 Abfw2 Abdominal fat weight QTL 2 16.58 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 3 28249687 73249687 Rat 2301971 Cm71 Cardiac mass QTL 71 4.63 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 3 41874578 155617519 Rat 1358885 Bp251 Blood pressure QTL 251 3.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 2301970 Bw81 Body weight QTL 81 5.19 body mass (VT:0001259) body weight (CMO:0000012) 3 41874578 155617519 Rat 2290452 Scl56 Serum cholesterol level QTL 56 2.26 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 3 1 91609953 Rat 12879868 Am6 Aortic mass QTL 6 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 3 31426403 70668733 Rat 11565451 Bw177 Body weight QTL 177 0.002 body mass (VT:0001259) body weight (CMO:0000012) 3 31426403 70668733 Rat 10450852 Stl33 Serum triglyceride level QTL 33 3.4 0.05 blood LDL triglyceride amount (VT:0010699) blood lipoprotein triglyceride level (CMO:0002685) 3 38192233 50749747 Rat 1358888 Bp264 Blood pressure QTL 264 4.43 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 11565452 Kidm57 Kidney mass QTL 57 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 31426403 70668733 Rat 4889975 Bmd81 Bone mineral density QTL 81 4.3 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 3 38710365 50302886 Rat 12879866 Cm94 Cardiac mass QTL 94 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 31426403 70668733 Rat 12879867 Cm95 Cardiac mass QTL 95 0.047 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 3 31426403 70668733 Rat 1300178 Hrtrt4 Heart rate QTL 4 3.74 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 3 43827364 90905114 Rat 2302055 Pia30 Pristane induced arthritis QTL 30 3.5 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111) 3 27936919 72936919 Rat 634317 Bw117 Body weight QTL 117 3.58 abdominal fat pad mass (VT:1000711) abdominal fat pad weight to body weight ratio (CMO:0000095) 3 39454637 53296578 Rat 1331795 Rf30 Renal function QTL 30 3.708 urine potassium amount (VT:0010539) urine potassium level (CMO:0000128) 3 39454637 89115240 Rat 70216 Cm14 Cardiac mass QTL 14 2.1 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 31172320 163586636 Rat 1354589 Bw31 Body weight QTL 31 3.3 body mass (VT:0001259) body weight (CMO:0000012) 3 33703347 78196190 Rat 2303593 Gluco46 Glucose level QTL 46 3 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 28468571 73468571 Rat 1354590 Despr11 Despair related QTL 11 0.000031 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 3 28468571 73468571 Rat 2313079 Bss73 Bone structure and strength QTL 73 1.5 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 3 27494621 50302886 Rat 1331777 Bw24 Body weight QTL 24 3.503 body mass (VT:0001259) body weight (CMO:0000012) 3 39454637 89115240 Rat 631647 Bp122 Blood pressure QTL 122 6.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 30684642 75684642 Rat 2313076 Bss74 Bone structure and strength QTL 74 2 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 3 27494621 50302886 Rat 1300169 Bp177 Blood pressure QTL 177 2.96 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 3 33703347 61017857 Rat 10450813 Scl74 Serum cholesterol level QTL 74 5.8 0.001 blood LDL cholesterol amount (VT:0000181) blood low density lipoprotein cholesterol level (CMO:0000053) 3 38192233 50749747 Rat 1559282 Emca5 Estrogen-induced mammary cancer QTL 5 3.9 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 3 43827364 169034231 Rat 2302276 Bw82 Body weight QTL 82 4.32 body mass (VT:0001259) body weight (CMO:0000012) 3 39454637 62951183 Rat 738019 Anxrr10 Anxiety related response QTL 10 3.9 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 3 38517803 83517803 Rat 9590136 Scort3 Serum corticosterone level QTL 3 23.37 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 3 28249687 73249687 Rat 10450804 Scl70 Serum cholesterol level QTL 70 4.7 0.001 blood LDL cholesterol amount (VT:0000181) blood low density lipoprotein cholesterol level (CMO:0000053) 3 20714090 65714090 Rat 61419 Cia11 Collagen induced arthritis QTL 11 5.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 3 30356773 98535386 Rat 1354597 Kidm13 Kidney mass QTL 13 2.9 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 3 41874578 104104347 Rat 8552950 Pigfal12 Plasma insulin-like growth factor 1 level QTL 12 7.3 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 3 28249687 73249687 Rat 631676 Cm8 Cardiac mass QTL 8 7.03 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 3 16954708 61954708 Rat 10450794 Scl69 Serum cholesterol level QTL 69 6.3 0.001 blood LDL cholesterol amount (VT:0000181) blood low density lipoprotein cholesterol level (CMO:0000053) 3 20714090 65714090 Rat 8694386 Bw159 Body weight QTL 159 4.52 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 3 28249687 73249687 Rat 1354604 Bw36 Body weight QTL 36 2.9 body mass (VT:0001259) body weight (CMO:0000012) 3 33703347 104104347 Rat 2313049 Bss72 Bone structure and strength QTL 72 2.6 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 3 27494621 50302886 Rat 2301400 Cm68 Cardiac mass QTL 68 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 3 31426403 70668733 Rat
D3Chm12
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 46,273,698 - 46,273,849 (+) MAPPER mRatBN7.2 Rnor_6.0 3 47,600,592 - 47,600,742 NCBI Rnor6.0 Rnor_5.0 3 54,272,023 - 54,272,173 UniSTS Rnor5.0 RGSC_v3.4 3 43,733,914 - 43,734,065 RGD RGSC3.4 RGSC_v3.4 3 43,733,915 - 43,734,065 UniSTS RGSC3.4 Celera 3 45,941,287 - 45,941,437 UniSTS Cytogenetic Map 3 q21 UniSTS
RH143528
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 46,346,812 - 46,346,912 (+) MAPPER mRatBN7.2 Rnor_6.0 3 47,673,067 - 47,673,166 NCBI Rnor6.0 Rnor_5.0 3 54,344,623 - 54,344,722 UniSTS Rnor5.0 RGSC_v3.4 3 43,660,300 - 43,660,399 UniSTS RGSC3.4 Celera 3 46,014,458 - 46,014,557 UniSTS Cytogenetic Map 3 q21 UniSTS
AU048604
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 3 66,680,376 - 66,680,598 (+) Marker Load Pipeline mRatBN7.2 3 46,271,783 - 46,272,005 (+) MAPPER mRatBN7.2 Rnor_6.0 3 47,596,977 - 47,597,198 NCBI Rnor6.0 Rnor_6.0 3 47,598,676 - 47,598,898 NCBI Rnor6.0 Rnor_5.0 3 54,270,107 - 54,270,329 UniSTS Rnor5.0 Rnor_5.0 3 54,268,408 - 54,268,629 UniSTS Rnor5.0 RGSC_v3.4 3 43,735,759 - 43,735,981 UniSTS RGSC3.4 Celera 3 45,939,372 - 45,939,593 UniSTS Cytogenetic Map 3 q21 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000082769 ⟹ ENSRNOP00000071068
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 46,254,330 - 46,347,075 (+) Ensembl Rnor_6.0 Ensembl 3 47,578,384 - 47,673,338 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000096319 ⟹ ENSRNOP00000092641
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 46,254,377 - 46,347,076 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000118197 ⟹ ENSRNOP00000087431
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 46,254,368 - 46,347,072 (+) Ensembl
RefSeq Acc Id:
NM_001025689 ⟹ NP_001020860
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 66,662,933 - 66,755,666 (+) NCBI mRatBN7.2 3 46,254,338 - 46,347,076 (+) NCBI Rnor_6.0 3 47,578,449 - 47,673,330 (+) NCBI Rnor_5.0 3 54,249,938 - 54,344,886 (+) NCBI RGSC_v3.4 3 43,660,136 - 43,699,412 (-) RGD Celera 3 45,922,238 - 46,014,721 (+) RGD
Sequence:
GTCGGGAACCCGGAAGTACTTCTCAGCAGAGGCCTGGGCGACTCTTTTGAATGGAATCGGGCTGATTCATCGCTGTGTCTCCGAGCCAGGTCCTTGTTGATTGTGAGGCGCTGCCCTCGCCGCCGCGT CGCCACTAGGCCAGGGAGAGAGAGAGAAAAAAAAAACTGCTTGTGGAAAATTGTATCTGCCAGAATTAGCAAGAATTGGAGTTAATAAGAAATTTGTCAAATTCAACAAATTGAAGCTTAACTCCATA AGAATTGCAGTTACTGAACAGAAATATGGACAGACTTCTTAGACTTGGAGGAGGTATGCCTGGACTGGGCCAGGGTCCACCTACAGATGCCCCTGCCGTAGACACAGCAGAACAAGTTTACATCTCCT CCTTGGCGTTGCTAAAGATGTTAAAACATGGCCGTGCTGGGGTTCCTATGGAAGTTATGGGTCTAATGCTTGGCGAATTTGTTGATGATTACACCGTCAGAGTGATTGATGTGTTTGCTATGCCACAA TCAGGAACTGGTGTCAGTGTAGAAGCAGTTGATCCAGTGTTCCAAGCCAAAATGTTGGATATGCTGAAACAAACAGGAAGGCCCGAGATGGTTGTTGGTTGGTATCACAGTCACCCTGGCTTTGGCTG TTGGCTTTCTGGTGTGGACATCAACACTCAGCAGAGCTTTGAAGCCTTGTCGGAGAGAGCTGTGGCAGTGGTTGTGGATCCCATTCAGAGTGTGAAAGGAAAGGTTGTTATTGATGCCTTCAGACTGA TCAATGCTAATATGATGGTCTTAGGACATGAACCGAGACAAACGACTTCCAATCTGGGCCACTTAAACAAGCCATCTATCCAGGCATTAATTCACGGATTAAACAGACATTACTACTCCATCACTATT AATTATCGGAAAAATGAACTGGAACAGAAGATGCTGTTAAATTTGCATAAGAAGAGTTGGATGGAAGGATTGACACTTCAGGACTACAGTGAACATTGTAAACACAATGAATCGGTGGTAAAAGAGAT GTTGGAATTAGCCAAGAATTATAATAAGGCTGTAGAAGAGGAAGATAAGATGACGCCTGAACAGCTGGCAATAAAGAATGTGGGCAAGCAGGATCCCAAACGTCATTTGGAAGAGCATGTGGATGTGC TTATGACTTCAAATATTGTCCAGTGTTTGGCAGCAATGTTGGATACCGTTGTATTTAAATAAAGCGGAGTAGAGAGCTGTCGGCGACACTCAGTGCATCGTCCTTCCTTGTTCCCAATGCTCATAGTC ACGGGAACTCTGAAGGTGATCTGGTGACATGAGACGCCTGTGCCACCTCCCATCTCACTTGTGCAGTTACTTCTGTTTATTTTGTCAGGATTTTGCAGATTCCAAAGTTGTTCAGGAATACATCAAAG TGAACAAATTTTGTTAAGATCCCATTTACTATTTGAAAAAAATCAGTAGCACAAATATATTTTGATTGTTGCTTACAAAATAAAATACATTTACAATCCAAAAAAAAAAAAAAAAAAAAAAAAAAAA
hide sequence
RefSeq Acc Id:
NP_001020860 ⟸ NM_001025689
- UniProtKB:
Q4V8E2 (UniProtKB/TrEMBL), F1LMW6 (UniProtKB/TrEMBL), A6HLU7 (UniProtKB/TrEMBL), A0A0G2JZJ1 (UniProtKB/TrEMBL), A0A8I6A8J5 (UniProtKB/TrEMBL)
- Sequence:
MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDIN TQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSNLGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYN KAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFK
hide sequence
Ensembl Acc Id:
ENSRNOP00000071068 ⟸ ENSRNOT00000082769
Ensembl Acc Id:
ENSRNOP00000087431 ⟸ ENSRNOT00000118197
Ensembl Acc Id:
ENSRNOP00000092641 ⟸ ENSRNOT00000096319
RGD ID: 13692098
Promoter ID: EPDNEW_R2622
Type: initiation region
Name: Psmd14_1
Description: proteasome 26S subunit, non-ATPase 14
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 3 47,578,473 - 47,578,533 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-08-19
Psmd14
proteasome 26S subunit, non-ATPase 14
Psmd14
proteasome (prosome, macropain) 26S subunit, non-ATPase, 14
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2009-06-15
Psmd14
proteasome (prosome, macropain) 26S subunit, non-ATPase, 14
Psmd14_predicted
proteasome (prosome, macropain) 26S subunit, non-ATPase, 14 (predicted)
Data merged from RGD:1306417
1643240
APPROVED
2008-03-05
Psmd14
proteasome (prosome, macropain) 26S subunit, non-ATPase, 14
LOC311078
similar to T-Brain-1
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2006-11-20
LOC311078
similar to T-Brain-1
Symbol and Name status set to provisional
70820
PROVISIONAL
2005-01-12
Psmd14_predicted
proteasome (prosome, macropain) 26S subunit, non-ATPase, 14 (predicted)
Symbol and Name status set to approved
70820
APPROVED