Symbol:
Brcc3
Name:
BRCA1/BRCA2-containing complex subunit 3
RGD ID:
1588543
Description:
Predicted to enable deubiquitinase activity; enzyme regulator activity; and polyubiquitin modification-dependent protein binding activity. Predicted to be involved in several processes, including DNA repair-dependent chromatin remodeling; mitotic G2 DNA damage checkpoint signaling; and positive regulation of NLRP3 inflammasome complex assembly. Predicted to act upstream of or within response to X-ray. Predicted to be located in cytoplasm and nucleoplasm. Predicted to be part of BRCA1-A complex; BRISC complex; and nuclear ubiquitin ligase complex. Orthologous to human BRCC3 (BRCA1/BRCA2-containing complex subunit 3); PARTICIPATES IN ataxia telangiectasia-mutated (ATM) signaling pathway; histone modification pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3H-1,2-dithiole-3-thione; acetamide.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
BRCA1-A complex subunit BRCC36; BRCA1/BRCA2-containing complex subunit 36; BRCA1/BRCA2-containing complex, subunit 3; BRCA1/BRCA2-containing complex, subunit 3 like 1; Brcc3l1; BRISC complex subunit BRCC36; LOC316794; lys-63-specific deubiquitinase BRCC36; similar to BRCA1/BRCA2-containing complex subunit 36 isoform 2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
BRCC3 (BRCA1/BRCA2-containing complex subunit 3)
HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):
Brcc3 (BRCA1/BRCA2-containing complex, subunit 3)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Brcc3 (BRCA1/BRCA2-containing complex subunit 3)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
BRCC3 (BRCA1/BRCA2-containing complex subunit 3)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
BRCC3 (BRCA1/BRCA2-containing complex subunit 3)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Brcc3 (BRCA1/BRCA2-containing complex subunit 3)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
BRCC3 (BRCA1/BRCA2-containing complex subunit 3)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
BRCC3 (BRCA1/BRCA2-containing complex subunit 3)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Brcc3 (BRCA1/BRCA2-containing complex subunit 3)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
BRCC3 (BRCA1/BRCA2-containing complex subunit 3)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Brcc3 (BRCA1/BRCA2-containing complex, subunit 3)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Mus musculus (house mouse):
Brcc3dc (BRCA1/BRCA2-containing complex, subunit 3, domain containing)
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
brcc3 (BRCA1/BRCA2-containing complex, subunit 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
brcc3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Related Pseudogenes:
Brcc3-ps7
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 2,073,927 - 2,076,469 (+) NCBI GRCr8 mRatBN7.2 9 1,986,942 - 1,989,484 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 1,986,575 - 1,991,080 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 2,421,214 - 2,423,760 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 7,770,588 - 7,773,134 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 6,726,439 - 6,728,985 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 9,863,380 - 9,865,920 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 9,863,404 - 9,865,920 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 8,864,902 - 8,867,442 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Celera 9 6,530,917 - 6,533,459 (-) NCBI Celera Cytogenetic Map 9 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Brcc3 Rat (+)-catechin decreases expression ISO BRCC3 (Homo sapiens) 6480464 Catechin results in decreased expression of BRCC3 mRNA CTD PMID:15465739 Brcc3 Rat 1,2-dimethylhydrazine multiple interactions ISO Brcc3 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in decreased expression of BRCC3 mRNA] CTD PMID:22206623 Brcc3 Rat 1,2-dimethylhydrazine decreases expression ISO Brcc3 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of BRCC3 mRNA CTD PMID:22206623 Brcc3 Rat 17alpha-ethynylestradiol affects expression ISO Brcc3 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of BRCC3 mRNA CTD PMID:17555576 Brcc3 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO BRCC3 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Brcc3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Brcc3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of BRCC3 mRNA CTD PMID:19465110 Brcc3 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of BRCC3 mRNA CTD PMID:33387578 Brcc3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Brcc3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of BRCC3 mRNA CTD PMID:21570461 Brcc3 Rat 2,4,6-tribromophenol increases expression ISO BRCC3 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Brcc3 Rat 3,3',4,4'-tetrachlorobiphenyl multiple interactions ISO Brcc3 (Mus musculus) 6480464 3 more ... CTD PMID:19467301 Brcc3 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO BRCC3 (Homo sapiens) 6480464 tetrabromobisphenol A results in decreased expression of BRCC3 protein CTD PMID:31675489 Brcc3 Rat 3H-1,2-dithiole-3-thione decreases expression EXP 6480464 1 and 2-dithiol-3-thione results in decreased expression of BRCC3 mRNA CTD PMID:19162173 Brcc3 Rat 4,4'-sulfonyldiphenol increases expression ISO Brcc3 (Mus musculus) 6480464 bisphenol S results in increased expression of BRCC3 mRNA CTD PMID:39298647 Brcc3 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of BRCC3 mRNA CTD PMID:31881176 Brcc3 Rat aflatoxin B1 increases expression ISO Brcc3 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of BRCC3 mRNA CTD PMID:19770486 Brcc3 Rat aflatoxin B1 decreases methylation ISO BRCC3 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of BRCC3 gene CTD PMID:27153756 Brcc3 Rat amiodarone increases expression ISO BRCC3 (Homo sapiens) 6480464 Amiodarone results in increased expression of BRCC3 mRNA CTD PMID:19774075 Brcc3 Rat benzo[a]pyrene decreases expression ISO Brcc3 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of BRCC3 mRNA CTD PMID:19770486 Brcc3 Rat benzo[a]pyrene increases methylation ISO BRCC3 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of BRCC3 exon CTD PMID:27901495 Brcc3 Rat benzo[a]pyrene affects methylation ISO BRCC3 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of BRCC3 5' UTR and Benzo(a)pyrene affects the methylation of BRCC3 promoter CTD PMID:27901495 Brcc3 Rat benzo[a]pyrene increases expression ISO Brcc3 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of BRCC3 mRNA CTD PMID:22228805 Brcc3 Rat benzo[a]pyrene diol epoxide I increases expression ISO BRCC3 (Homo sapiens) 6480464 7 more ... CTD PMID:26238291 Brcc3 Rat biphenyl-4-amine decreases expression ISO BRCC3 (Homo sapiens) 6480464 4-biphenylamine results in decreased expression of BRCC3 mRNA CTD PMID:32905825 Brcc3 Rat biphenyl-4-amine multiple interactions ISO BRCC3 (Homo sapiens) 6480464 TP53 protein inhibits the reaction [4-biphenylamine results in decreased expression of BRCC3 mRNA] CTD PMID:32905825 Brcc3 Rat bisphenol A increases expression ISO BRCC3 (Homo sapiens) 6480464 bisphenol A results in increased expression of BRCC3 mRNA CTD PMID:22576693 Brcc3 Rat bisphenol A decreases expression ISO BRCC3 (Homo sapiens) 6480464 bisphenol A results in decreased expression of BRCC3 protein CTD PMID:31675489 Brcc3 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of BRCC3 mRNA CTD PMID:32145629 Brcc3 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of BRCC3 mRNA CTD PMID:30816183 more ... Brcc3 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of BRCC3 mRNA CTD PMID:25181051 Brcc3 Rat bortezomib decreases expression ISO BRCC3 (Homo sapiens) 6480464 Bortezomib results in decreased expression of BRCC3 mRNA CTD PMID:20977926 Brcc3 Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of BRCC3 mRNA CTD PMID:19167457 Brcc3 Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of BRCC3 mRNA CTD PMID:33453195 Brcc3 Rat cannabidiol decreases expression ISO BRCC3 (Homo sapiens) 6480464 Cannabidiol results in decreased expression of BRCC3 mRNA CTD PMID:27932991 Brcc3 Rat CGP 52608 multiple interactions ISO BRCC3 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to BRCC3 gene] CTD PMID:28238834 Brcc3 Rat copper(II) sulfate decreases expression ISO BRCC3 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of BRCC3 mRNA CTD PMID:19549813 Brcc3 Rat cyclosporin A decreases expression ISO BRCC3 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of BRCC3 mRNA CTD PMID:25562108 Brcc3 Rat dibutyl phthalate decreases expression ISO Brcc3 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of BRCC3 mRNA CTD PMID:17361019 and PMID:21266533 Brcc3 Rat diuron decreases expression ISO BRCC3 (Homo sapiens) 6480464 Diuron results in decreased expression of BRCC3 mRNA CTD PMID:35967413 Brcc3 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of BRCC3 mRNA CTD PMID:29391264 Brcc3 Rat ethanol affects splicing ISO Brcc3 (Mus musculus) 6480464 Ethanol affects the splicing of BRCC3 mRNA CTD PMID:30319688 Brcc3 Rat fenofibrate increases expression ISO Brcc3 (Mus musculus) 6480464 Fenofibrate results in increased expression of BRCC3 mRNA CTD PMID:21318169 Brcc3 Rat fenofibrate multiple interactions ISO Brcc3 (Mus musculus) 6480464 [PPARA protein affects the susceptibility to Fenofibrate] which affects the expression of BRCC3 mRNA CTD PMID:21318169 Brcc3 Rat flavonoids decreases expression ISO BRCC3 (Homo sapiens) 6480464 Flavonoids results in decreased expression of BRCC3 mRNA CTD PMID:15465739 Brcc3 Rat folic acid multiple interactions ISO Brcc3 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in decreased expression of BRCC3 mRNA] CTD PMID:22206623 Brcc3 Rat formaldehyde decreases expression ISO BRCC3 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of BRCC3 mRNA CTD PMID:23649840 Brcc3 Rat gallic acid decreases expression ISO BRCC3 (Homo sapiens) 6480464 Gallic Acid results in decreased expression of BRCC3 mRNA CTD PMID:34408198 Brcc3 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of BRCC3 mRNA CTD PMID:33387578 Brcc3 Rat ivermectin decreases expression ISO BRCC3 (Homo sapiens) 6480464 Ivermectin results in decreased expression of BRCC3 protein CTD PMID:32959892 Brcc3 Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of BRCC3 mRNA CTD PMID:30467583 Brcc3 Rat methylmercury chloride decreases expression ISO BRCC3 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of BRCC3 mRNA CTD PMID:28001369 Brcc3 Rat nickel sulfate decreases expression ISO BRCC3 (Homo sapiens) 6480464 nickel sulfate results in decreased expression of BRCC3 mRNA CTD PMID:22714537 Brcc3 Rat O-methyleugenol affects expression EXP 6480464 methyleugenol affects the expression of BRCC3 mRNA CTD PMID:26011634 Brcc3 Rat ochratoxin A decreases expression EXP 6480464 ochratoxin A results in decreased expression of BRCC3 mRNA CTD PMID:23358140 Brcc3 Rat paracetamol affects expression ISO Brcc3 (Mus musculus) 6480464 Acetaminophen affects the expression of BRCC3 mRNA CTD PMID:17562736 Brcc3 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of BRCC3 mRNA CTD PMID:33387578 Brcc3 Rat pentachlorophenol increases expression ISO Brcc3 (Mus musculus) 6480464 Pentachlorophenol results in increased expression of BRCC3 mRNA CTD PMID:23892564 Brcc3 Rat perfluorohexanesulfonic acid increases expression ISO Brcc3 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of BRCC3 mRNA CTD PMID:37995155 Brcc3 Rat phenobarbital affects expression ISO Brcc3 (Mus musculus) 6480464 Phenobarbital affects the expression of BRCC3 mRNA CTD PMID:23091169 Brcc3 Rat piroxicam decreases expression ISO BRCC3 (Homo sapiens) 6480464 Piroxicam results in decreased expression of BRCC3 mRNA CTD PMID:21858171 Brcc3 Rat potassium chromate decreases expression ISO BRCC3 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of BRCC3 mRNA CTD PMID:22714537 Brcc3 Rat pregnenolone 16alpha-carbonitrile decreases expression EXP 6480464 Pregnenolone Carbonitrile results in decreased expression of BRCC3 mRNA CTD PMID:19162173 Brcc3 Rat promethazine decreases expression EXP 6480464 Promethazine results in decreased expression of BRCC3 mRNA CTD PMID:26011634 Brcc3 Rat resveratrol decreases expression EXP 6480464 resveratrol results in decreased expression of BRCC3 mRNA CTD PMID:25905778 Brcc3 Rat resveratrol multiple interactions ISO BRCC3 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of BRCC3 mRNA CTD PMID:23557933 Brcc3 Rat SB 431542 multiple interactions ISO BRCC3 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of BRCC3 protein CTD PMID:37664457 Brcc3 Rat silicon dioxide decreases expression ISO BRCC3 (Homo sapiens) 6480464 Silicon Dioxide results in decreased expression of BRCC3 mRNA CTD PMID:34973136 Brcc3 Rat sodium arsenite decreases expression ISO BRCC3 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of BRCC3 mRNA CTD PMID:38568856 Brcc3 Rat sodium dichromate increases expression ISO Brcc3 (Mus musculus) 6480464 sodium bichromate results in increased expression of BRCC3 mRNA CTD PMID:22155349 Brcc3 Rat sunitinib decreases expression ISO BRCC3 (Homo sapiens) 6480464 Sunitinib results in decreased expression of BRCC3 mRNA CTD PMID:31533062 Brcc3 Rat tamoxifen affects expression ISO Brcc3 (Mus musculus) 6480464 Tamoxifen affects the expression of BRCC3 mRNA CTD PMID:17555576 Brcc3 Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of BRCC3 mRNA CTD PMID:26011634 Brcc3 Rat thiram decreases expression ISO BRCC3 (Homo sapiens) 6480464 Thiram results in decreased expression of BRCC3 mRNA CTD PMID:38568856 Brcc3 Rat titanium dioxide increases expression ISO BRCC3 (Homo sapiens) 6480464 titanium dioxide results in increased expression of BRCC3 mRNA CTD PMID:34973136 Brcc3 Rat torcetrapib increases expression ISO BRCC3 (Homo sapiens) 6480464 torcetrapib results in increased expression of BRCC3 mRNA CTD PMID:23228038 Brcc3 Rat triphenyl phosphate affects expression ISO BRCC3 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of BRCC3 mRNA CTD PMID:37042841 Brcc3 Rat urethane decreases expression ISO BRCC3 (Homo sapiens) 6480464 Urethane results in decreased expression of BRCC3 mRNA CTD PMID:28818685
(+)-catechin (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 3,3',4,4'-tetrachlorobiphenyl (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3H-1,2-dithiole-3-thione (EXP) 4,4'-sulfonyldiphenol (ISO) acetamide (EXP) aflatoxin B1 (ISO) amiodarone (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) biphenyl-4-amine (ISO) bisphenol A (EXP,ISO) bortezomib (ISO) C60 fullerene (EXP) cadmium dichloride (EXP) cannabidiol (ISO) CGP 52608 (ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) dibutyl phthalate (ISO) diuron (ISO) endosulfan (EXP) ethanol (ISO) fenofibrate (ISO) flavonoids (ISO) folic acid (ISO) formaldehyde (ISO) gallic acid (ISO) gentamycin (EXP) ivermectin (ISO) methapyrilene (EXP) methylmercury chloride (ISO) nickel sulfate (ISO) O-methyleugenol (EXP) ochratoxin A (EXP) paracetamol (EXP,ISO) pentachlorophenol (ISO) perfluorohexanesulfonic acid (ISO) phenobarbital (ISO) piroxicam (ISO) potassium chromate (ISO) pregnenolone 16alpha-carbonitrile (EXP) promethazine (EXP) resveratrol (EXP,ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sodium dichromate (ISO) sunitinib (ISO) tamoxifen (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) torcetrapib (ISO) triphenyl phosphate (ISO) urethane (ISO)
Biological Process
cell division (IEA) cellular response to ionizing radiation (ISO) chromatin organization (IEA) chromatin remodeling (ISO,ISS) DNA damage response (IEA) DNA repair (IEA) DNA repair-dependent chromatin remodeling (ISO,ISS) double-strand break repair (IBA,ISO,ISS) mitotic G2 DNA damage checkpoint signaling (ISO,ISS) positive regulation of DNA repair (ISO,ISS) positive regulation of NLRP3 inflammasome complex assembly (ISO,ISS) protein K63-linked deubiquitination (IEA,ISO,ISS) proteolysis (IEA) response to ionizing radiation (ISO,ISS) response to X-ray (ISO)
Brcc3 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 2,073,927 - 2,076,469 (+) NCBI GRCr8 mRatBN7.2 9 1,986,942 - 1,989,484 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 1,986,575 - 1,991,080 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 2,421,214 - 2,423,760 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 7,770,588 - 7,773,134 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 6,726,439 - 6,728,985 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 9,863,380 - 9,865,920 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 9,863,404 - 9,865,920 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 8,864,902 - 8,867,442 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Celera 9 6,530,917 - 6,533,459 (-) NCBI Celera Cytogenetic Map 9 q11 NCBI
BRCC3 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 X 155,071,508 - 155,123,077 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl X 155,071,420 - 155,123,077 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 X 154,299,783 - 154,351,352 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 X 153,952,904 - 154,004,543 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 X 153,863,504 - 153,915,052 NCBI Celera X 154,458,427 - 154,510,104 (+) NCBI Celera Cytogenetic Map X q28 NCBI HuRef X 142,845,949 - 142,896,583 (+) NCBI HuRef CHM1_1 X 154,211,322 - 154,263,032 (+) NCBI CHM1_1 T2T-CHM13v2.0 X 153,307,916 - 153,359,479 (+) NCBI T2T-CHM13v2.0
Brcc3 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 X 74,460,234 - 74,499,307 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl X 74,460,234 - 74,497,607 (+) Ensembl GRCm39 Ensembl GRCm38 X 75,416,628 - 75,455,702 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl X 75,416,628 - 75,454,001 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 X 72,661,967 - 72,701,040 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 X 71,669,420 - 71,706,717 (+) NCBI MGSCv36 mm8 Celera X 66,818,616 - 66,858,058 (+) NCBI Celera Cytogenetic Map X A7.3 NCBI cM Map X 38.22 NCBI
Brcc3 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955594 554,081 - 613,661 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955594 551,407 - 613,772 (-) NCBI ChiLan1.0 ChiLan1.0
BRCC3 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 X 155,049,262 - 155,097,994 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 X 155,052,870 - 155,104,458 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 X 144,550,320 - 144,592,795 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 X 154,389,179 - 154,431,616 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl X 154,389,283 - 154,428,669 (+) Ensembl panpan1.1 panPan2
BRCC3 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 X 123,081,262 - 123,143,509 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl X 123,081,050 - 123,140,133 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha X 108,074,648 - 108,136,853 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 X 126,208,828 - 126,271,057 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl X 126,173,490 - 126,271,057 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 X 121,956,711 - 122,018,913 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 X 124,479,132 - 124,541,327 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 X 124,199,851 - 124,262,068 (+) NCBI UU_Cfam_GSD_1.0
Brcc3 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
BRCC3 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl X 125,383,414 - 125,439,082 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 X 125,383,392 - 125,439,082 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 X 142,991,891 - 143,046,729 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
BRCC3 (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 X 129,358,759 - 129,406,293 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl X 129,358,862 - 129,403,352 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666065 67,336,845 - 67,385,677 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Brcc3 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 34 Count of miRNA genes: 34 Interacting mature miRNAs: 34 Transcripts: ENSRNOT00000071068 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
70226 Eae4 Experimental allergic encephalomyelitis QTL 4 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 9 1 25661317 Rat 10054141 Gmadr4 Adrenal mass QTL 4 2.45 0.0074 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 9 1 14209783 Rat 9589158 Gluco65 Glucose level QTL 65 6.82 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 9 1 37999212 Rat 10054125 Srcrt7 Stress Responsive Cort QTL 7 3.33 0.0011 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 9 1 87073594 Rat 2303559 Gluco54 Glucose level QTL 54 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 9 1254084 46254084 Rat 7411592 Foco8 Food consumption QTL 8 7.4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 9 1 37999212 Rat 1331757 Cdexp1 CD45RC expression in CD8 T cells QTL 1 4.3 CD8-positive T cell quantity (VT:0008077) blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990) 9 1024537 67509080 Rat 1298088 Edpm11 Estrogen-dependent pituitary mass QTL 11 2.5 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 9 1 43718459 Rat 9589055 Scfw5 Subcutaneous fat weight QTL 5 5.55 0.001 subcutaneous adipose mass (VT:1000472) abdominal subcutaneous fat pad weight (CMO:0002069) 9 1 37999212 Rat 1641911 Alcrsp13 Alcohol response QTL 13 response to alcohol trait (VT:0010489) brain neurotensin receptor 1 density (CMO:0002068) 9 1 43718459 Rat 1354650 Despr5 Despair related QTL 5 4.01 0.0017 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 9 1254084 46254084 Rat 1300124 Cm4 Cardiac mass QTL 4 3.55 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 9 1 40594091 Rat
RH130212
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 98,815,978 - 98,816,168 (+) MAPPER mRatBN7.2 mRatBN7.2 9 1,988,828 - 1,989,019 (-) MAPPER mRatBN7.2 Rnor_6.0 9 9,863,845 - 9,864,033 NCBI Rnor6.0 Rnor_6.0 3 103,410,730 - 103,410,919 NCBI Rnor6.0 Rnor_5.0 9 8,865,367 - 8,865,555 UniSTS Rnor5.0 Rnor_5.0 3 110,004,103 - 110,004,292 UniSTS Rnor5.0 RGSC_v3.4 3 97,842,396 - 97,842,585 UniSTS RGSC3.4 Celera 9 6,531,382 - 6,531,572 UniSTS Celera 3 97,813,856 - 97,814,045 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000071068 ⟹ ENSRNOP00000066438
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 9 1,986,575 - 1,991,080 (+) Ensembl Rnor_6.0 Ensembl 9 9,863,404 - 9,865,920 (-) Ensembl
RefSeq Acc Id:
NM_001127300 ⟹ NP_001120772
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 2,073,927 - 2,076,469 (+) NCBI mRatBN7.2 9 1,986,942 - 1,989,484 (+) NCBI Rnor_6.0 9 9,863,380 - 9,865,920 (-) NCBI Rnor_5.0 9 8,864,902 - 8,867,442 (-) NCBI Celera 9 6,530,917 - 6,533,459 (-) RGD
Sequence:
TGAACGGGGAGACGATGGCGGTGCCGGTGGTTCAGGCCGTGCAGGCTGTCCATCTGGAGTCGGACGCCTTTCTGGTTTGTCTGAACCACGCCCTGAGTACGGAGAAAGAGGAGGTGATGGGTCTGTGC ATCGGGGAGCTGAACGACGACGTAAGGAGTGAGTCCAAATTCGCACACGCCGGAAGTGACGTGTGCACGGTTCCGGAGAAGGTGGATTCGATCAGAGTCGTCCACATCCACTCGGTCATCATCCTGCG CCGTTCTGACAAGAGGAAGGACCGCGTGGAGATTTCCCCAGAGCAGCTGTCTGCAGCCTCGACTGAGGCGGAAAGGTTGGCGGAACTCACTGGCCGTCCCATGAGAGTCGTCGGCTGGTACCATTCGC ACCCTCACATAACGGTGTGGCCTTCACACGTGGATGTTCGCACGCAAGCCATGTACCAAATGATGGACCAAGGCTTCGTGGGACTTATTTTCTCCTGTTTCATAGAAGACAAGAACACAAAGACCGGA CGTGTCCTCTACACTTGCTTCCAATCCGTACAAGCCCAGAAAAGCTCAGACTATGAGAGAATCGAAATCCCCGTCCACGTCGTTCCCCACGTCACCATCGGGAAAGTTTGCCTGGAGTCCGCGGTGGA GCTGCCGAAGATCCTGTGTCAGGAGGAGCAGGACGCGTACAGGCGGATCCATAGCCTCACACATCTGGACTCGGTGACCAAGATCCACAATGGCTCGGTCTTCACCAAGAATCTGTGCAGCCAGATGT CGGCGGTGAGTGGGCCTCTGCTGCAGTGGTTAGAGGACAGATTGGAGCAAAACCAGCAGCATCTGCGGGAGCTGCAGCGGGAGAAGGAGGAGCTCATGGCGGAGCTGCGTTCGCTCGAATAAATCGAG GGAGCAGCAAAAAAAAATCCGGGCGGGGGGACGTGGAGTGAACGGAAATACCTCGAGTACAATTTATTAAACAAAAATCAATTTTGAAAAAGATAAAGTCGGAGGGCCTACATTAACATAACTTCAAG ATTTATTATTGTAAAGCTACAGTGATCAAGATACGATGATATTTGCAGAAGAATCAATGCAACAGGGAAGAAAATCCGGAAATAAACCCAACAATAATGTGCTTAACTACGTTTGAAAAAGTACAAAT GTGATTCAAAGAGGAAAAGACAGTCATTTATTTCAACAAATCAAACCTTCTCAAGCTAACAAAATATATACAATAAATAAATATGTAAAAGAGTCTCTGAATGTATCACGGATTTAAATCCAATATGG AAGACTTAGGGAAAAAAGTTATTCCAAAAAAGTTTTCAGGACTTAAGGACTTAACATTTTCAACTCCAAAGCACAATATCACAAGAAAACAAAGTAGAGAGATTGGACTTTGTTAAAATTAAAGCTGT TTATTCTGCAGAAAGATGAAGAGGAAACCGTCGGTGAAAAAGATGTGTCTGAAACTCGAAAGTAAATAGCACCAGTAGAAATGAAAAGAGACGTAAACATTGTCACTAAAAATGGTGAAAATAGCAAA TCCTGTTGAGGGGGCAAATGAGATTCCTCACCAGTGACGGGAATGTAAAAATTCATCGACTGGGTAGAAAAGTTTGGAAATTTTTTTTAAGTTAAACATACACTTAGCATGACCCAGCCACCAAGCTG CACTGTCTTGGTACAAAAACTTTTACAAAATTTTTCTTGGTAGTTTTATCTGTGGAAGCTGCAAATCAGAAACAGCCCAGATTTTCTACAGTGAGTCCACAGCTAAAGAAACCGTTCTTATGGTGGAA TATTACTGTGTAGGAAAAAGGAACATACCGCCTAATGGTTTTGTCACTGAACTACATCTCAGCCTGACTTAACTGGATTTGGAATCATGTAAATACAACGTGTACATGAAGGTGTTTTCAAAAAAGTT TTAAGTGGGGAGAGAAGACTGATCTTTAACGTAGGTGACACCATTCCATGGGGTAGGGCCCCAGACTGAATAAAAAGAAGGGAATGATCAGATCATCAGGTCTGTCAAACATGGAATATATGCCTTCA AATTGTGAGCCAAGATAAACCCTACCTTACATAAGTTGCTTTTAGCAGGTCTTTTGTCAAAGAAATAAAAAAGTAAAAAAGCAGTGACAGTGACCTGTCATCTAAGATGGCTCTACCCATCAAAACTA CCTTTTAAAATTGACAAAAATACGTATGCCAGTTCCAGTTTTCATGTGCTTAGCAGATTGATGTTCATTTTCTTTTGCTGGTGAAAAGTGGCTCCTTTAAAACAAATACCCTAAAGATAGTTGGATCT TGATTTTTAATCCAGCAAGCAAGTTTTCATTTCTTCATTGGTAAATCAGGTTTATTTGCATTTAAGATTATACATGGAAGATGATTACTTATTTTAACTACTTTGTTCATTGATTTTCTGGTTGACTG TTTATTGTTTTCTTTCTCTCCATTTGGGGTTTGCTTGTTTACTTAGAAATCACCTGATCATTGCAAAATAGAAGACTTTTTAAAATTAAAAATAAAAAAAAAATCAATATTAAAAAAAAAAAAAAAAA AAAAAAAA
hide sequence
RefSeq Acc Id:
NP_001120772 ⟸ NM_001127300
- UniProtKB:
B2RYM5 (UniProtKB/Swiss-Prot)
- Sequence:
MAVPVVQAVQAVHLESDAFLVCLNHALSTEKEEVMGLCIGELNDDVRSESKFAHAGSDVCTVPEKVDSIRVVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMRVVGWYHSHPHIT VWPSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSVQAQKSSDYERIEIPVHVVPHVTIGKVCLESAVELPKILCQEEQDAYRRIHSLTHLDSVTKIHNGSVFTKNLCSQMSAVSG PLLQWLEDRLEQNQQHLRELQREKEELMAELRSLE
hide sequence
Ensembl Acc Id:
ENSRNOP00000066438 ⟸ ENSRNOT00000071068
RGD ID: 13696436
Promoter ID: EPDNEW_R6960
Type: initiation region
Name: Brcc3_1
Description: BRCA1/BRCA2-containing complex, subunit 3
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 9 9,865,925 - 9,865,985 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2023-05-05
Brcc3
BRCA1/BRCA2-containing complex subunit 3
Brcc3l1
BRCA1/BRCA2-containing complex, subunit 3 like 1
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2023-04-13
Brcc3l1
BRCA1/BRCA2-containing complex, subunit 3 like 1
Brcc3
BRCA1/BRCA2-containing complex, subunit 3
Name and Symbol changed
629549
APPROVED
2008-03-05
Brcc3
BRCA1/BRCA2-containing complex, subunit 3
LOC316794
similar to BRCA1/BRCA2-containing complex subunit 36 isoform 2
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2006-11-19
LOC316794
similar to BRCA1/BRCA2-containing complex subunit 36 isoform 2
Symbol and Name status set to provisional
70820
PROVISIONAL