Symbol:
Usp4
Name:
ubiquitin specific peptidase 4
RGD ID:
1587387
Description:
Predicted to enable adenosine receptor binding activity; cysteine-type deubiquitinase activity; and identical protein binding activity. Predicted to be involved in several processes, including positive regulation of TORC1 signaling; protein localization to cell surface; and spliceosomal tri-snRNP complex assembly. Predicted to be located in cytoplasm. Predicted to be active in nucleus. Orthologous to human USP4 (ubiquitin specific peptidase 4); INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 3,4-methylenedioxymethamphetamine; aconitine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
deubiquitinating enzyme 4; LOC290864; similar to Ubiquitin carboxyl-terminal hydrolase 4 (Ubiquitin thiolesterase 4) (Ubiquitin-specific processing protease 4) (Deubiquitinating enzyme 4) (Ubiquitous nuclear protein); ubiquitin carboxyl-terminal hydrolase 4; ubiquitin specific peptidase 4 (proto-oncogene); ubiquitin specific protease 4; ubiquitin specific protease 4 (proto-oncogene); ubiquitin thioesterase 4; ubiquitin-specific-processing protease 4
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 117,912,576 - 117,957,934 (+) NCBI GRCr8 mRatBN7.2 8 109,035,402 - 109,079,382 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 109,036,099 - 109,080,427 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 114,663,178 - 114,706,678 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 112,862,508 - 112,906,009 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 110,705,153 - 110,748,655 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 117,126,692 - 117,171,012 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 117,126,692 - 117,171,012 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 116,474,812 - 116,519,375 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Celera 8 108,338,833 - 108,383,118 (+) NCBI Celera Cytogenetic Map 8 q32 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Usp4 Rat 1,2-dimethylhydrazine multiple interactions ISO Usp4 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of USP4 mRNA CTD PMID:22206623 Usp4 Rat 1,2-dimethylhydrazine affects expression ISO Usp4 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine affects the expression of USP4 mRNA CTD PMID:22206623 Usp4 Rat 17alpha-ethynylestradiol increases expression ISO Usp4 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of USP4 mRNA CTD PMID:17942748 Usp4 Rat 17alpha-ethynylestradiol multiple interactions ISO Usp4 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of USP4 mRNA CTD PMID:17942748 Usp4 Rat 17beta-estradiol increases expression ISO Usp4 (Mus musculus) 6480464 Estradiol results in increased expression of USP4 mRNA CTD PMID:39298647 Usp4 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression EXP 6480464 2 more ... CTD PMID:27291303 Usp4 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Usp4 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of USP4 mRNA CTD PMID:17942748 Usp4 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Usp4 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of USP4 mRNA CTD PMID:21570461 Usp4 Rat 3,3',4,4'-tetrachlorobiphenyl multiple interactions ISO Usp4 (Mus musculus) 6480464 3 more ... CTD PMID:19467301 Usp4 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Usp4 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of USP4 mRNA CTD PMID:26251327 Usp4 Rat 3,4-methylenedioxymethamphetamine increases expression EXP 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of USP4 mRNA CTD PMID:30071829 Usp4 Rat 4,4'-diaminodiphenylmethane decreases expression ISO Usp4 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of USP4 mRNA CTD PMID:18648102 Usp4 Rat 4,4'-sulfonyldiphenol increases expression ISO Usp4 (Mus musculus) 6480464 bisphenol S results in increased expression of USP4 mRNA CTD PMID:39298647 Usp4 Rat 4-hydroxyphenyl retinamide increases expression ISO Usp4 (Mus musculus) 6480464 Fenretinide results in increased expression of USP4 mRNA CTD PMID:28973697 Usp4 Rat aconitine increases expression EXP 6480464 Aconitine results in increased expression of USP4 protein CTD PMID:33236894 Usp4 Rat allethrin multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in decreased expression of USP4 protein CTD PMID:34896426 Usp4 Rat antirheumatic drug decreases expression ISO USP4 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of USP4 mRNA CTD PMID:24449571 Usp4 Rat arsenite(3-) multiple interactions ISO USP4 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to USP4 mRNA] CTD PMID:32406909 Usp4 Rat benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of USP4 mRNA CTD PMID:21839799 Usp4 Rat benzo[a]pyrene affects methylation ISO USP4 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of USP4 3' UTR CTD PMID:27901495 Usp4 Rat benzo[a]pyrene increases methylation ISO USP4 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of USP4 promoter CTD PMID:27901495 Usp4 Rat benzo[a]pyrene increases expression ISO Usp4 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of USP4 mRNA CTD PMID:22228805 Usp4 Rat beta-lapachone increases expression ISO USP4 (Homo sapiens) 6480464 beta-lapachone results in increased expression of USP4 mRNA CTD PMID:38218311 Usp4 Rat bis(2-ethylhexyl) phthalate decreases expression ISO USP4 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased expression of USP4 protein CTD PMID:31163220 Usp4 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of USP4 mRNA CTD PMID:25181051 Usp4 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of USP4 mRNA CTD PMID:30816183 and PMID:32528016 Usp4 Rat bisphenol A decreases methylation ISO Usp4 (Mus musculus) 6480464 bisphenol A results in decreased methylation of USP4 promoter CTD PMID:27312807 Usp4 Rat Brodifacoum increases expression EXP 6480464 bromfenacoum results in increased expression of USP4 protein CTD PMID:28903499 Usp4 Rat caffeine increases phosphorylation ISO USP4 (Homo sapiens) 6480464 Caffeine results in increased phosphorylation of USP4 protein CTD PMID:35688186 Usp4 Rat clofibrate increases expression EXP 6480464 Clofibrate results in increased expression of USP4 mRNA CTD PMID:32741897 Usp4 Rat coumestrol decreases expression ISO USP4 (Homo sapiens) 6480464 Coumestrol results in decreased expression of USP4 mRNA CTD PMID:19167446 Usp4 Rat cyclosporin A increases expression ISO USP4 (Homo sapiens) 6480464 Cyclosporine results in increased expression of USP4 mRNA CTD PMID:25562108 Usp4 Rat cyhalothrin multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in decreased expression of USP4 protein CTD PMID:34896426 Usp4 Rat cylindrospermopsin increases expression ISO USP4 (Homo sapiens) 6480464 cylindrospermopsin results in increased expression of USP4 mRNA CTD PMID:24921660 Usp4 Rat cypermethrin multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in decreased expression of USP4 protein CTD PMID:34896426 Usp4 Rat decabromodiphenyl ether increases expression EXP 6480464 decabromobiphenyl ether results in increased expression of USP4 mRNA CTD PMID:23640034 Usp4 Rat Dibutyl phosphate affects expression ISO USP4 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of USP4 mRNA CTD PMID:37042841 Usp4 Rat elemental selenium decreases expression ISO USP4 (Homo sapiens) 6480464 Selenium results in decreased expression of USP4 mRNA CTD PMID:19244175 Usp4 Rat ellagic acid decreases expression ISO USP4 (Homo sapiens) 6480464 Ellagic Acid results in decreased expression of USP4 mRNA CTD PMID:12002526 Usp4 Rat fenofibrate increases expression EXP 6480464 Fenofibrate results in increased expression of USP4 mRNA CTD PMID:32741897 Usp4 Rat fenthion decreases expression ISO Usp4 (Mus musculus) 6480464 Fenthion results in decreased expression of USP4 mRNA CTD PMID:34813904 Usp4 Rat fenvalerate multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in decreased expression of USP4 protein CTD PMID:34896426 Usp4 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of USP4 mRNA CTD PMID:24136188 Usp4 Rat folic acid multiple interactions ISO Usp4 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of USP4 mRNA CTD PMID:22206623 Usp4 Rat FR900359 affects phosphorylation ISO USP4 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of USP4 protein CTD PMID:37730182 Usp4 Rat ivermectin decreases expression ISO USP4 (Homo sapiens) 6480464 Ivermectin results in decreased expression of USP4 protein CTD PMID:32959892 Usp4 Rat methidathion decreases expression ISO Usp4 (Mus musculus) 6480464 methidathion results in decreased expression of USP4 mRNA CTD PMID:34813904 Usp4 Rat methyl methanesulfonate increases expression ISO USP4 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of USP4 mRNA CTD PMID:23649840 Usp4 Rat ozone increases expression EXP 6480464 Ozone results in increased expression of USP4 protein CTD PMID:33146391 Usp4 Rat paracetamol affects expression ISO Usp4 (Mus musculus) 6480464 Acetaminophen affects the expression of USP4 mRNA CTD PMID:17562736 Usp4 Rat paracetamol decreases expression ISO USP4 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of USP4 mRNA CTD PMID:21420995 Usp4 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Usp4 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of USP4 mRNA CTD PMID:36331819 Usp4 Rat phlorizin increases expression ISO Usp4 (Mus musculus) 6480464 Phlorhizin results in increased expression of USP4 mRNA CTD PMID:22538082 Usp4 Rat pirinixic acid increases expression ISO Usp4 (Mus musculus) 6480464 pirinixic acid results in increased expression of USP4 mRNA CTD PMID:23811191 Usp4 Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of USP4 mRNA CTD PMID:32741897 Usp4 Rat pyrethrins decreases expression EXP 6480464 Pyrethrins results in decreased expression of USP4 protein CTD PMID:34896426 Usp4 Rat quercetin decreases expression ISO USP4 (Homo sapiens) 6480464 Quercetin results in decreased expression of USP4 mRNA CTD PMID:21632981 Usp4 Rat resveratrol increases expression ISO USP4 (Homo sapiens) 6480464 resveratrol results in increased expression of USP4 mRNA CTD PMID:12002526 Usp4 Rat resveratrol multiple interactions ISO USP4 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of USP4 mRNA CTD PMID:23557933 Usp4 Rat selenium atom decreases expression ISO USP4 (Homo sapiens) 6480464 Selenium results in decreased expression of USP4 mRNA CTD PMID:19244175 Usp4 Rat sodium arsenite increases expression ISO USP4 (Homo sapiens) 6480464 sodium arsenite results in increased expression of USP4 mRNA CTD PMID:12016162 Usp4 Rat sodium fluoride increases expression ISO Usp4 (Mus musculus) 6480464 Sodium Fluoride results in increased expression of USP4 protein CTD PMID:28918527 Usp4 Rat tetrachloromethane decreases expression ISO Usp4 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of USP4 mRNA CTD PMID:31919559 Usp4 Rat thiram increases expression ISO USP4 (Homo sapiens) 6480464 Thiram results in increased expression of USP4 mRNA CTD PMID:38568856 Usp4 Rat titanium dioxide decreases expression ISO Usp4 (Mus musculus) 6480464 titanium dioxide results in decreased expression of USP4 mRNA CTD PMID:29264374 Usp4 Rat titanium dioxide increases methylation ISO Usp4 (Mus musculus) 6480464 titanium dioxide results in increased methylation of USP4 promoter CTD PMID:35295148 Usp4 Rat titanium dioxide decreases methylation ISO Usp4 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of USP4 gene CTD PMID:35295148 Usp4 Rat torcetrapib increases expression ISO USP4 (Homo sapiens) 6480464 torcetrapib results in increased expression of USP4 mRNA CTD PMID:19164467 and PMID:23228038 Usp4 Rat triphenyl phosphate affects expression ISO USP4 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of USP4 mRNA CTD PMID:37042841 Usp4 Rat valproic acid affects expression ISO Usp4 (Mus musculus) 6480464 Valproic Acid affects the expression of USP4 mRNA CTD PMID:17963808 Usp4 Rat valproic acid decreases expression ISO USP4 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of USP4 mRNA CTD PMID:23179753 Usp4 Rat valproic acid affects expression ISO USP4 (Homo sapiens) 6480464 Valproic Acid affects the expression of USP4 mRNA CTD PMID:25979313 Usp4 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of USP4 mRNA CTD PMID:23034163 Usp4 Rat vitamin E decreases expression ISO USP4 (Homo sapiens) 6480464 Vitamin E results in decreased expression of USP4 mRNA CTD PMID:19244175
1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 3,3',4,4'-tetrachlorobiphenyl (ISO) 3,4-methylenedioxymethamphetamine (EXP,ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) aconitine (EXP) allethrin (EXP) antirheumatic drug (ISO) arsenite(3-) (ISO) benzo[a]pyrene (EXP,ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) Brodifacoum (EXP) caffeine (ISO) clofibrate (EXP) coumestrol (ISO) cyclosporin A (ISO) cyhalothrin (EXP) cylindrospermopsin (ISO) cypermethrin (EXP) decabromodiphenyl ether (EXP) Dibutyl phosphate (ISO) elemental selenium (ISO) ellagic acid (ISO) fenofibrate (EXP) fenthion (ISO) fenvalerate (EXP) finasteride (EXP) folic acid (ISO) FR900359 (ISO) ivermectin (ISO) methidathion (ISO) methyl methanesulfonate (ISO) ozone (EXP) paracetamol (ISO) perfluorooctane-1-sulfonic acid (ISO) phlorizin (ISO) pirinixic acid (EXP,ISO) pyrethrins (EXP) quercetin (ISO) resveratrol (ISO) selenium atom (ISO) sodium arsenite (ISO) sodium fluoride (ISO) tetrachloromethane (ISO) thiram (ISO) titanium dioxide (ISO) torcetrapib (ISO) triphenyl phosphate (ISO) valproic acid (ISO) vinclozolin (EXP) vitamin E (ISO)
Biological Process
negative regulation of protein ubiquitination (IEA,ISO,ISS) positive regulation of TORC1 signaling (IEA,ISO,ISS) protein deubiquitination (IEA,ISO,ISS) protein localization to cell surface (IEA,ISO,ISS) proteolysis (IEA) regulation of protein stability (IEA,ISO,ISS) spliceosomal tri-snRNP complex assembly (IEA,ISO,ISS)
Usp4 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 117,912,576 - 117,957,934 (+) NCBI GRCr8 mRatBN7.2 8 109,035,402 - 109,079,382 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 109,036,099 - 109,080,427 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 114,663,178 - 114,706,678 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 112,862,508 - 112,906,009 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 110,705,153 - 110,748,655 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 117,126,692 - 117,171,012 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 117,126,692 - 117,171,012 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 116,474,812 - 116,519,375 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Celera 8 108,338,833 - 108,383,118 (+) NCBI Celera Cytogenetic Map 8 q32 NCBI
USP4 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 49,277,144 - 49,340,053 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 49,277,144 - 49,340,712 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 49,314,577 - 49,377,486 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 49,289,997 - 49,352,519 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 49,289,997 - 49,352,519 NCBI Celera 3 49,278,021 - 49,342,350 (-) NCBI Celera Cytogenetic Map 3 p21.31 NCBI HuRef 3 49,371,896 - 49,436,532 (-) NCBI HuRef CHM1_1 3 49,267,379 - 49,330,367 (-) NCBI CHM1_1 T2T-CHM13v2.0 3 49,305,224 - 49,369,431 (-) NCBI T2T-CHM13v2.0
Usp4 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 108,223,763 - 108,269,744 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 108,225,052 - 108,269,744 (+) Ensembl GRCm39 Ensembl GRCm38 9 108,346,564 - 108,392,545 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 108,347,853 - 108,392,545 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 108,250,162 - 108,294,860 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 108,205,963 - 108,250,621 (+) NCBI MGSCv36 mm8 Celera 9 107,957,048 - 108,001,736 (+) NCBI Celera Cytogenetic Map 9 F2 NCBI cM Map 9 59.25 NCBI
Usp4 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955532 1,247,110 - 1,285,121 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955532 1,247,110 - 1,284,564 (-) NCBI ChiLan1.0 ChiLan1.0
LOC100967331 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 49,253,962 - 49,320,547 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 49,258,730 - 49,325,329 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 49,199,328 - 49,263,861 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 50,279,642 - 50,343,901 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 50,279,642 - 50,343,903 (-) Ensembl panpan1.1 panPan2
USP4 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 39,899,880 - 39,952,959 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 39,899,897 - 39,952,420 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 39,818,226 - 39,871,287 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 40,256,219 - 40,309,777 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 40,256,236 - 40,309,829 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 39,623,674 - 39,676,723 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 40,027,139 - 40,080,595 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 40,306,950 - 40,360,016 (+) NCBI UU_Cfam_GSD_1.0
Usp4
USP4 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 31,848,851 - 31,904,243 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 31,844,780 - 31,904,418 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 35,075,799 - 35,135,425 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
USP4 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 22 10,672,920 - 10,735,374 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 22 10,672,388 - 10,732,104 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 156,278,755 - 156,354,831 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Usp4
.
Assembly: Rnor_5.0 Assembly: Rnor_6.0
Predicted Target Of
Count of predictions: 166 Count of miRNA genes: 99 Interacting mature miRNAs: 102 Transcripts: ENSRNOT00000071561, ENSRNOT00000073725 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
2303171 Bp331 Blood pressure QTL 331 5.57 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 61290298 119084929 Rat 1549909 Stresp11 Stress response QTL 11 6.83 0.0019 stress-related behavior trait (VT:0010451) number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960) 8 73473045 118473045 Rat 631210 Bw3 Body weight QTL3 5.9 mesenteric fat pad mass (VT:0010427) mesenteric fat pad weight to body weight ratio (CMO:0000654) 8 69349194 112783834 Rat 1358903 Bp252 Blood pressure QTL 252 7 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 93965141 123900184 Rat 1554321 Bmd3 Bone mineral density QTL 3 7.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 40952565 123900184 Rat 9590292 Uminl3 Urine mineral level QTL 3 3.62 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 8 71888757 116888757 Rat 8694446 Bw170 Body weight QTL 170 12.07 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 8 71888757 116888757 Rat 631650 Stl6 Serum triglyceride level QTL 6 4 0.0019 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 10378157 112202585 Rat 631653 Bp125 Blood pressure QTL 125 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 66142385 111142385 Rat 1581557 Eae16 Experimental allergic encephalomyelitis QTL 16 3.8 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 8 8462195 110921472 Rat 738011 Anxrr9 Anxiety related response QTL 9 6.1 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 8 93535351 123900184 Rat 724539 Cm19 Cardiac mass QTL 19 2.6 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 8 100149864 120994388 Rat 70197 BpQTLcluster8 Blood pressure QTL cluster 8 3.482 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 46531639 119088626 Rat 738014 Anxrr15 Anxiety related response QTL 15 3.6 0.005 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 8 95718998 123900184 Rat 2300182 Bmd56 Bone mineral density QTL 56 5.4 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 95718998 123900184 Rat 2300181 Bmd55 Bone mineral density QTL 55 5.7 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 76468691 121468691 Rat 1300171 Bp184 Blood pressure QTL 184 3.66 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 8 70513503 118219066 Rat 1358893 Bp263 Blood pressure QTL 263 5.01 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 93965141 123900184 Rat 2313400 Anxrr25 Anxiety related response QTL 25 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 8 89265192 114019816 Rat 8694200 Abfw4 Abdominal fat weight QTL 4 9.07 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 8 71888757 116888757 Rat 8694392 Bw161 Body weight QTL 161 8.06 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 8 71888757 116888757 Rat 61437 Cia6 Collagen induced arthritis QTL 6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 8 82460758 122812818 Rat
RH132731
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 109,080,249 - 109,080,399 (+) MAPPER mRatBN7.2 Rnor_6.0 8 117,170,835 - 117,170,984 NCBI Rnor6.0 Rnor_5.0 8 116,519,198 - 116,519,347 UniSTS Rnor5.0 Celera 8 108,382,941 - 108,383,090 UniSTS Cytogenetic Map 16 q12.5 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000083046 ⟹ ENSRNOP00000071463
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 109,036,099 - 109,080,427 (+) Ensembl Rnor_6.0 Ensembl 8 117,126,692 - 117,171,012 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000085609 ⟹ ENSRNOP00000069514
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 109,036,099 - 109,080,427 (+) Ensembl Rnor_6.0 Ensembl 8 117,126,692 - 117,171,012 (+) Ensembl
RefSeq Acc Id:
NM_001135012 ⟹ NP_001128484
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 117,914,655 - 117,957,934 (+) NCBI mRatBN7.2 8 109,036,099 - 109,079,382 (+) NCBI Rnor_6.0 8 117,126,692 - 117,171,012 (+) NCBI Rnor_5.0 8 116,474,812 - 116,519,375 (+) NCBI Celera 8 108,338,833 - 108,383,118 (+) NCBI
Sequence:
GGCTGGGCCCGGGCGGCGGACGAGATGGCGGAAGGCCGGGGCACCCATGAGCGACCGGATGTGGAGACCCAGAAGACGGAGCTCGGAGCCTTGATGGGGACCACGCTCCAGCGTGGGGCTCAGTGGTA
hide sequence
RefSeq Acc Id:
XM_039080938 ⟹ XP_038936866
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 117,933,065 - 117,957,934 (+) NCBI mRatBN7.2 8 109,054,293 - 109,079,099 (+) NCBI
RefSeq Acc Id:
XM_063264999 ⟹ XP_063121069
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 117,912,576 - 117,957,934 (+) NCBI
RefSeq Acc Id:
XM_063265000 ⟹ XP_063121070
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 117,912,576 - 117,947,143 (+) NCBI
RefSeq Acc Id:
XM_063265001 ⟹ XP_063121071
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 117,912,576 - 117,933,058 (+) NCBI
RefSeq Acc Id:
XM_063265002 ⟹ XP_063121072
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 117,912,576 - 117,933,058 (+) NCBI
RefSeq Acc Id:
XR_010053934
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 117,912,576 - 117,937,968 (+) NCBI
RefSeq Acc Id:
NP_001128484 ⟸ NM_001135012
- UniProtKB:
B2GUZ1 (UniProtKB/Swiss-Prot)
- Sequence:
MAEGRGTHERPDVETQKTELGALMGTTLQRGAQWYLIDSRWFKQWKKYVGFDSWDMYNVGEHNLFPGPIDNSGLFSDPESQTLKEHLIDELDYVLVPTEAWNKLLNWYGCVEGQQPIVRKVVEHGLFV
hide sequence
Ensembl Acc Id:
ENSRNOP00000071463 ⟸ ENSRNOT00000083046
Ensembl Acc Id:
ENSRNOP00000069514 ⟸ ENSRNOT00000085609
RefSeq Acc Id:
XP_038936866 ⟸ XM_039080938
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_063121069 ⟸ XM_063264999
- Peptide Label:
isoform X1
- UniProtKB:
A6I350 (UniProtKB/TrEMBL), M0R851 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063121070 ⟸ XM_063265000
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_063121071 ⟸ XM_063265001
- Peptide Label:
isoform X4
RefSeq Acc Id:
XP_063121072 ⟸ XM_063265002
- Peptide Label:
isoform X5
RGD ID: 13696298 Promoter ID: EPDNEW_R6822 Type: initiation region Name: Usp4_1 Description: ubiquitin specific peptidase 4 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 8 117,126,696 - 117,126,756 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-04-13
Usp4
ubiquitin specific peptidase 4
Usp4
ubiquitin specific peptidase 4 (proto-oncogene)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-03-04
Usp4
ubiquitin specific peptidase 4 (proto-oncogene)
LOC290864
similar to Ubiquitin carboxyl-terminal hydrolase 4 (Ubiquitin thiolesterase 4) (Ubiquitin-specific processing protease 4) (Deubiquitinating enzyme 4) (Ubiquitous nuclear protein)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-11-19
LOC290864
similar to Ubiquitin carboxyl-terminal hydrolase 4 (Ubiquitin thiolesterase 4) (Ubiquitin-specific processing protease 4) (Deubiquitinating enzyme 4) (Ubiquitous nuclear protein)
Symbol and Name status set to provisional
70820 PROVISIONAL
