Advanced Search (OLGA)

Gene: Pmf1 (polyamine-modulated factor 1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Pmf1

Name:

polyamine-modulated factor 1

RGD ID:

1584694

Description:

Predicted to enable leucine zipper domain binding activity and transcription coactivator activity. Predicted to be involved in chromosome segregation. Predicted to be located in Golgi apparatus; kinetochore; and nucleoplasm. Predicted to be part of MIS12/MIND type complex. Human ortholog(s) of this gene implicated in bladder carcinoma and urinary bladder cancer. Orthologous to several human genes including PMF1 (polyamine modulated factor 1); INTERACTS WITH 1-naphthyl isothiocyanate; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC681050; similar to polyamine-modulated factor 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PMF1 (polyamine modulated factor 1)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):	Pmf1 (polyamine-modulated factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PMF1 (polyamine modulated factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	LOC101978306 (polyamine-modulated factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PMF1 (polyamine modulated factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	PMF1-BGLAP (PMF1-BGLAP readthrough)	HGNC	HomoloGene, Treefam
Alliance orthologs ³
Homo sapiens (human):	PMF1 (polyamine modulated factor 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Pmf1 (polyamine-modulated factor 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	PMF1-BGLAP (PMF1-BGLAP readthrough)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	si:dkey-6i22.5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	NNF1	Alliance	DIOPT (Hieranoid\|OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	pmf1	Alliance	DIOPT (Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	176,145,896 - 176,166,022 (-)	NCBI		GRCr8
mRatBN7.2	2	173,848,074 - 173,868,272 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	173,848,074 - 173,868,270 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	180,992,811 - 181,012,347 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	179,015,172 - 179,034,708 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	173,615,181 - 173,634,763 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	187,751,770 - 187,771,933 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	187,751,776 - 187,771,865 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	207,154,781 - 207,174,337 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	180,492,380 - 180,511,936 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	2	167,793,331 - 167,812,873 (-)	NCBI		Celera
Cytogenetic Map	2	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pmf1	Rat	bladder carcinoma	disease_progression	ISO	PMF1 (Homo sapiens)	30296649		RGD
Pmf1	Rat	Leukoaraiosis	susceptibility	ISO	PMF1 (Homo sapiens)	30296652	DNA:SNP: :rs2984613(human)	RGD
Pmf1	Rat	urinary bladder cancer	disease_progression	ISO	PMF1 (Homo sapiens)	30296651		RGD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pmf1	Rat	Charcot-Marie-Tooth disease type 2		ISO	PMF1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Charcot-Marie-Tooth disease type 2	ClinVar	PMID:18585512 more ...
Pmf1	Rat	gastrointestinal stromal tumor		ISO	PMF1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Gastrointestinal stromal tumor	ClinVar	PMID:28492532
Pmf1	Rat	genetic disease		ISO	PMF1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar
Pmf1	Rat	immunodeficiency 42		ISO	PMF1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Autosomal recessive mendelian susceptibility to mycobacterial diseases due to complete RORgamma receptor deficiency	ClinVar	PMID:28492532
Pmf1	Rat	MHC class II deficiency		ISO	PMF1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: MHC class II deficiency	ClinVar	PMID:28492532
Pmf1	Rat	parathyroid carcinoma		ISO	PMF1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Parathyroid carcinoma	ClinVar	PMID:28492532
Pmf1	Rat	severe congenital neutropenia 3		ISO	PMF1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Kostmann syndrome	ClinVar	PMID:28492532
Pmf1	Rat	severe congenital neutropenia 5		ISO	PMF1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Congenital neutropenia-myelofibrosis-nephromegaly syndrome	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pmf1	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	Pmf1 (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of PMF1 mRNA	CTD	PMID:22206623
Pmf1	Rat	1-naphthyl isothiocyanate	increases expression	EXP		6480464	1-Naphthylisothiocyanate results in increased expression of PMF1 mRNA	CTD	PMID:30723492
Pmf1	Rat	17beta-estradiol	affects expression	EXP		6480464	Estradiol affects the expression of PMF1 mRNA	CTD	PMID:32145629
Pmf1	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of PMF1 mRNA	CTD	PMID:34747641
Pmf1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of PMF1 mRNA	CTD	PMID:33387578
Pmf1	Rat	2-methylcholine	affects expression	ISO	PMF1 (Homo sapiens)	6480464	beta-methylcholine affects the expression of PMF1 mRNA	CTD	PMID:21179406
Pmf1	Rat	4,4'-diaminodiphenylmethane	decreases expression	ISO	Pmf1 (Mus musculus)	6480464	4 and 4'-diaminodiphenylmethane results in decreased expression of PMF1 mRNA	CTD	PMID:18648102
Pmf1	Rat	5-fluorouracil	multiple interactions	ISO	PMF1 (Homo sapiens)	6480464	TP53 protein affects the reaction [Fluorouracil results in decreased expression of PMF1 mRNA]	CTD	PMID:15016801
Pmf1	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of PMF1 mRNA	CTD	PMID:24780913
Pmf1	Rat	acetamide	increases expression	EXP		6480464	acetamide results in increased expression of PMF1 mRNA	CTD	PMID:31881176
Pmf1	Rat	arsane	affects methylation	ISO	PMF1 (Homo sapiens)	6480464	Arsenic affects the methylation of PMF1 gene	CTD	PMID:25304211
Pmf1	Rat	arsenic atom	affects methylation	ISO	PMF1 (Homo sapiens)	6480464	Arsenic affects the methylation of PMF1 gene	CTD	PMID:25304211
Pmf1	Rat	atrazine	decreases expression	ISO	PMF1 (Homo sapiens)	6480464	Atrazine results in decreased expression of PMF1 mRNA	CTD	PMID:22378314
Pmf1	Rat	benzo[a]pyrene	increases methylation	ISO	PMF1 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of PMF1 promoter	CTD	PMID:27901495
Pmf1	Rat	beta-lapachone	increases expression	ISO	PMF1 (Homo sapiens)	6480464	beta-lapachone results in increased expression of PMF1 mRNA	CTD	PMID:38218311
Pmf1	Rat	beta-lapachone	decreases expression	ISO	PMF1 (Homo sapiens)	6480464	beta-lapachone results in decreased expression of PMF1 mRNA	CTD	PMID:38218311
Pmf1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of PMF1 mRNA	CTD	PMID:25181051 and PMID:30816183
Pmf1	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of PMF1 mRNA	CTD	PMID:32145629
Pmf1	Rat	cadmium atom	decreases expression	ISO	PMF1 (Homo sapiens)	6480464	Cadmium results in decreased expression of PMF1 mRNA	CTD	PMID:23369406
Pmf1	Rat	carbon nanotube	decreases expression	ISO	Pmf1 (Mus musculus)	6480464	Nanotubes more ...	CTD	PMID:25620056
Pmf1	Rat	carbon nanotube	increases expression	ISO	Pmf1 (Mus musculus)	6480464	Nanotubes more ...	CTD	PMID:25554681
Pmf1	Rat	choline	multiple interactions	ISO	Pmf1 (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of PMF1 gene	CTD	PMID:20938992
Pmf1	Rat	cisplatin	decreases expression	EXP		6480464	Cisplatin results in decreased expression of PMF1 mRNA	CTD	PMID:22023808
Pmf1	Rat	cobalt dichloride	decreases expression	ISO	PMF1 (Homo sapiens)	6480464	cobaltous chloride results in decreased expression of PMF1 mRNA	CTD	PMID:19376846
Pmf1	Rat	copper(II) sulfate	decreases expression	ISO	PMF1 (Homo sapiens)	6480464	Copper Sulfate results in decreased expression of PMF1 mRNA	CTD	PMID:19549813
Pmf1	Rat	Cuprizon	increases expression	EXP		6480464	Cuprizone results in increased expression of PMF1 mRNA	CTD	PMID:26577399
Pmf1	Rat	dibutyl phthalate	decreases expression	ISO	Pmf1 (Mus musculus)	6480464	Dibutyl Phthalate results in decreased expression of PMF1 mRNA	CTD	PMID:17361019 and PMID:21266533
Pmf1	Rat	dibutyl phthalate	increases expression	ISO	Pmf1 (Mus musculus)	6480464	Dibutyl Phthalate results in increased expression of PMF1 mRNA	CTD	PMID:17361019
Pmf1	Rat	diuron	decreases expression	ISO	PMF1 (Homo sapiens)	6480464	Diuron results in decreased expression of PMF1 mRNA	CTD	PMID:35967413
Pmf1	Rat	doxorubicin	affects expression	ISO	PMF1 (Homo sapiens)	6480464	Doxorubicin affects the expression of PMF1 mRNA	CTD	PMID:29803840
Pmf1	Rat	fenthion	increases expression	ISO	Pmf1 (Mus musculus)	6480464	Fenthion results in increased expression of PMF1 mRNA	CTD	PMID:34813904
Pmf1	Rat	folic acid	multiple interactions	ISO	Pmf1 (Mus musculus)	6480464	[1 more ...	CTD	PMID:20938992 and PMID:22206623
Pmf1	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of PMF1 mRNA	CTD	PMID:33387578
Pmf1	Rat	L-methionine	multiple interactions	ISO	Pmf1 (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of PMF1 gene	CTD	PMID:20938992
Pmf1	Rat	lidocaine	increases expression	EXP		6480464	Lidocaine results in increased expression of PMF1 mRNA	CTD	PMID:35283115
Pmf1	Rat	methotrexate	affects expression	ISO	Pmf1 (Mus musculus)	6480464	Methotrexate affects the expression of PMF1 mRNA	CTD	PMID:18502557
Pmf1	Rat	methoxyacetic acid	decreases expression	ISO	PMF1 (Homo sapiens)	6480464	methoxyacetic acid results in decreased expression of PMF1 mRNA	CTD	PMID:15103026
Pmf1	Rat	monosodium L-glutamate	increases expression	ISO	Pmf1 (Mus musculus)	6480464	Sodium Glutamate results in increased expression of PMF1 mRNA	CTD	PMID:20111022
Pmf1	Rat	monosodium L-glutamate	multiple interactions	ISO	Pmf1 (Mus musculus)	6480464	[Sodium Glutamate co-treated with High Fructose Corn Syrup] results in increased expression of PMF1 mRNA	CTD	PMID:20111022
Pmf1	Rat	nitrates	multiple interactions	ISO	Pmf1 (Mus musculus)	6480464	[Particulate Matter results in increased abundance of Nitrates] which results in increased expression of PMF1 mRNA	CTD	PMID:35964746
Pmf1	Rat	oxaliplatin	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of PMF1 mRNA	CTD	PMID:25729387
Pmf1	Rat	ozone	multiple interactions	ISO	Pmf1 (Mus musculus)	6480464	[Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of PMF1 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of PMF1 mRNA	CTD	PMID:34911549
Pmf1	Rat	paracetamol	decreases expression	EXP		6480464	Acetaminophen results in decreased expression of PMF1 mRNA	CTD	PMID:33387578
Pmf1	Rat	pirinixic acid	increases expression	ISO	Pmf1 (Mus musculus)	6480464	pirinixic acid results in increased expression of PMF1 mRNA	CTD	PMID:18301758
Pmf1	Rat	propanal	decreases expression	ISO	PMF1 (Homo sapiens)	6480464	propionaldehyde results in decreased expression of PMF1 mRNA	CTD	PMID:26079696
Pmf1	Rat	sodium dichromate	decreases expression	ISO	Pmf1 (Mus musculus)	6480464	sodium bichromate results in decreased expression of PMF1 mRNA	CTD	PMID:22155349
Pmf1	Rat	sodium dichromate	increases expression	ISO	Pmf1 (Mus musculus)	6480464	sodium bichromate results in increased expression of PMF1 mRNA	CTD	PMID:22155349
Pmf1	Rat	tetrachloromethane	multiple interactions	ISO	Pmf1 (Mus musculus)	6480464	PLG gene mutant form promotes the reaction [Carbon Tetrachloride results in increased expression of PMF1 mRNA]	CTD	PMID:16006527
Pmf1	Rat	tetrachloromethane	decreases expression	EXP		6480464	Carbon Tetrachloride results in decreased expression of PMF1 mRNA	CTD	PMID:33387578
Pmf1	Rat	thioacetamide	affects expression	EXP		6480464	Thioacetamide affects the expression of PMF1 mRNA	CTD	PMID:34492290
Pmf1	Rat	titanium dioxide	increases expression	ISO	Pmf1 (Mus musculus)	6480464	titanium dioxide results in increased expression of PMF1 mRNA	CTD	PMID:29264374
Pmf1	Rat	titanium dioxide	increases methylation	ISO	Pmf1 (Mus musculus)	6480464	titanium dioxide results in increased methylation of PMF1 gene	CTD	PMID:35295148
Pmf1	Rat	topotecan	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of PMF1 mRNA	CTD	PMID:25729387
Pmf1	Rat	trimellitic anhydride	increases expression	ISO	Pmf1 (Mus musculus)	6480464	trimellitic anhydride results in increased expression of PMF1 mRNA	CTD	PMID:19042947
Pmf1	Rat	triphenyl phosphate	affects expression	ISO	PMF1 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of PMF1 mRNA	CTD	PMID:37042841
Pmf1	Rat	tungsten	increases expression	ISO	Pmf1 (Mus musculus)	6480464	Tungsten results in increased expression of PMF1 mRNA	CTD	PMID:30912803
Pmf1	Rat	urethane	decreases expression	ISO	PMF1 (Homo sapiens)	6480464	Urethane results in decreased expression of PMF1 mRNA	CTD	PMID:28818685
Pmf1	Rat	valproic acid	affects expression	ISO	Pmf1 (Mus musculus)	6480464	Valproic Acid affects the expression of PMF1 mRNA	CTD	PMID:17292431
Pmf1	Rat	valproic acid	decreases expression	ISO	Pmf1 (Mus musculus)	6480464	Valproic Acid results in decreased expression of PMF1 mRNA	CTD	PMID:19136453
Pmf1	Rat	valproic acid	decreases expression	ISO	PMF1 (Homo sapiens)	6480464	Valproic Acid results in decreased expression of PMF1 mRNA	CTD	PMID:23179753 more ...
Pmf1	Rat	valproic acid	affects expression	ISO	PMF1 (Homo sapiens)	6480464	Valproic Acid affects the expression of PMF1 mRNA	CTD	PMID:25979313
Pmf1	Rat	valproic acid	increases methylation	ISO	PMF1 (Homo sapiens)	6480464	Valproic Acid results in increased methylation of PMF1 gene	CTD	PMID:29154799
Pmf1	Rat	vorinostat	decreases expression	ISO	PMF1 (Homo sapiens)	6480464	vorinostat results in decreased expression of PMF1 mRNA	CTD	PMID:27188386

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pmf1	Rat	cell division	involved_in	IEA	UniProtKB-KW:KW-0132	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Pmf1	Rat	chromosome segregation	involved_in	ISO	PMF1 (Homo sapiens)	1624291	PMID:15502821	RGD	PMID:15502821
Pmf1	Rat	chromosome segregation	involved_in	IBA	PANTHER:PTN001035903 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Pmf1	Rat	positive regulation of DNA-templated transcription	involved_in	IEA	GO:0003713	1600115	GO_REF:0000108	GOC	GO_REF:0000108

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pmf1	Rat	chromosome	located_in	IEA	UniProtKB-KW:KW-0158	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Pmf1	Rat	chromosome, centromeric region	located_in	IEA	UniProtKB-KW:KW-0137	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Pmf1	Rat	Golgi apparatus	located_in	ISO	PMF1 (Homo sapiens) and UniProtKB:Q6P1K2-1	1624291		RGD	GO_REF:0000052
Pmf1	Rat	intracellular membrane-bounded organelle	located_in	ISO	PMF1 (Homo sapiens) and UniProtKB:Q6P1K2-1	1624291		RGD	GO_REF:0000052
Pmf1	Rat	kinetochore	located_in	ISO	PMF1 (Homo sapiens)	1624291	PMID:15371340	RGD	PMID:15371340
Pmf1	Rat	kinetochore	located_in	IEA	UniProtKB-KW:KW-0995	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Pmf1	Rat	MIS12/MIND type complex	part_of	IBA	PANTHER:PTN001035903 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Pmf1	Rat	MIS12/MIND type complex	part_of	IEA	InterPro:IPR007128	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Pmf1	Rat	MIS12/MIND type complex	part_of	ISO	PMF1 (Homo sapiens)	1624291	PMID:16585270 more ...	RGD	PMID:16585270 more ...
Pmf1	Rat	nucleoplasm	located_in	ISO	PMF1 (Homo sapiens) more ...	1624291		RGD	GO_REF:0000052
Pmf1	Rat	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Pmf1	Rat	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Pmf1	Rat	outer kinetochore	part_of	ISO	PMF1 (Homo sapiens)	1624291	PMID:24530301	RGD	PMID:24530301

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pmf1	Rat	leucine zipper domain binding	enables	ISO	PMF1 (Homo sapiens)	1624291	UniProtKB:Q16236 and PMID:11256947	RGD	PMID:11256947
Pmf1	Rat	protein binding	enables	ISO	PMF1 (Homo sapiens)	1624291	UniProtKB:O14901 more ...	RGD	PMID:15371340 more ...
Pmf1	Rat	protein binding	enables	ISO	Pmf1 (Mus musculus)	1624291	UniProtKB:Q60795 and PMID:11583586	RGD	PMID:11583586
Pmf1	Rat	protein binding	enables	ISO	PMF1 (Homo sapiens) and UniProtKB:Q6P1K2-3	1624291	UniProtKB:Q7Z699 more ...	RGD	PMID:32296183 and PMID:32814053
Pmf1	Rat	protein binding	enables	ISO	PMF1 (Homo sapiens) and UniProtKB:Q6P1K2-3	1624291	UniProtKB:P42858 more ...	RGD	PMID:32296183 and PMID:32814053
Pmf1	Rat	transcription coactivator activity	enables	ISO	PMF1 (Homo sapiens)	1624291	PMID:11256947	RGD	PMID:11256947

#	Reference Title	Reference Citation
1.	Identification of PMF1 methylation in association with bladder cancer progression.	Aleman A, etal., Clin Cancer Res. 2008 Dec 15;14(24):8236-43. doi: 10.1158/1078-0432.CCR-08-0778.
2.	Polyamine-modulated factor-1 methylation predicts Bacillus Calmette-Guérin response in patients with high-grade non-muscle-invasive bladder carcinoma.	Alvarez-Múgica M, etal., Eur Urol. 2013 Feb;63(2):364-70. doi: 10.1016/j.eururo.2012.05.050. Epub 2012 Jun 5.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	The Associations of PMF1, ICAM1, AGT, TRIM65, FBF1, and ACOX1 Variants With Leukoaraiosis in Chinese Population.	Huang WQ, etal., Front Genet. 2019 Jul 23;10:615. doi: 10.3389/fgene.2019.00615. eCollection 2019.
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:11256947	PMID:15371340	PMID:15502821	PMID:16585270	PMID:17552904

Pmf1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	176,145,896 - 176,166,022 (-)	NCBI		GRCr8
mRatBN7.2	2	173,848,074 - 173,868,272 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	173,848,074 - 173,868,270 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	180,992,811 - 181,012,347 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	179,015,172 - 179,034,708 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	173,615,181 - 173,634,763 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	187,751,770 - 187,771,933 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	187,751,776 - 187,771,865 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	207,154,781 - 207,174,337 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	180,492,380 - 180,511,936 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	2	167,793,331 - 167,812,873 (-)	NCBI		Celera
Cytogenetic Map	2	q34	NCBI

PMF1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	156,213,007 - 156,240,042 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	156,212,993 - 156,240,042 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	156,182,798 - 156,209,833 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	154,449,408 - 154,476,457 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	152,995,888 - 153,022,899	NCBI
Celera	1	129,255,764 - 129,282,815 (+)	NCBI		Celera
Cytogenetic Map	1	q22	NCBI
HuRef	1	127,544,511 - 127,570,967 (+)	NCBI		HuRef
CHM1_1	1	157,578,747 - 157,605,841 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	155,351,461 - 155,378,502 (+)	NCBI		T2T-CHM13v2.0

Pmf1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	88,301,445 - 88,317,752 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	88,301,450 - 88,317,638 (-)	Ensembl		GRCm39 Ensembl
GRCm38	3	88,394,138 - 88,410,445 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	88,394,143 - 88,410,331 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	88,198,065 - 88,214,238 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	88,480,070 - 88,496,243 (-)	NCBI		MGSCv36	mm8
Celera	3	88,433,784 - 88,449,956 (-)	NCBI		Celera
Cytogenetic Map	3	F1	NCBI
cM Map	3	38.82	NCBI

PMF1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	93,605,235 - 93,631,577 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	93,337,133 - 93,363,475 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	131,556,843 - 131,583,180 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	135,387,760 - 135,412,907 (+)	NCBI	panpan1.1	PanPan1.1	panPan2

LOC101978306
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	26,424,183 - 26,449,218 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936580	5,454,580 - 5,479,884 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936580	5,454,574 - 5,479,600 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PMF1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	7,627,084 - 7,655,751 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	7,627,524 - 7,655,724 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	6,919,605 - 6,949,961 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants in Pmf1
88 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	63
Count of miRNA genes:	60
Interacting mature miRNAs:	62
Transcripts:	ENSRNOT00000035383
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578648	Bss11	Bone structure and strength QTL 11	4.7		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	2	114837527	211674221	Rat
1358356	Srcrt1	Stress Responsive Cort QTL1	3.66		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	2	161699179	222436696	Rat
1331734	Bp204	Blood pressure QTL 204	3.61192		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	168358098	223265385	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
6907363	Bp357	Blood pressure QTL 357	4.1	0.002	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	129540907	174540907	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118463	226797303	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	81754530	227146641	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	18960362	228801039	Rat
1298076	Bp166	Blood pressure QTL 166		0.0009	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	136445150	202447032	Rat
152025245	Scl81	Serum cholesterol level QTL 81	3.49		blood cholesterol amount (VT:0000180)		2	122609194	206936711	Rat
70162	Bp63	Blood pressure QTL 63	5.64		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	2	169745596	214745596	Rat
1554319	Bmd2	Bone mineral density QTL 2	13.4	0.0001	lumbar vertebra area (VT:0010570)	lumbar vertebra cross-sectional area (CMO:0001689)	2	114837675	212549332	Rat
12879836	Kidm61	Kidney mass QTL 61		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	152413072	185122374	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	78665619	219826953	Rat
10043136	Iddm54	Insulin dependent diabetes mellitus QTL 54	3.4	0.0001	blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	143657411	190602963	Rat
12879837	Am2	Aortic mass QTL 2		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	2	152413072	185122374	Rat
12879838	Cm86	Cardiac mass QTL 86		0.002	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	152413072	185122374	Rat
1302793	Bw16	Body weight QTL 16	5	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	2	157142209	202446871	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	43154682	202446871	Rat
12879839	Cm85	Cardiac mass QTL 85		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	2	152413072	185122374	Rat
61469	Bp16	Blood pressure QTL 16	5.64		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	2	169745596	214745596	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	2	135552573	202446871	Rat
1549833	Bp257	Blood pressure QTL 257		0.003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	168354880	185122374	Rat
1358900	Bw48	Body weight QTL 48	4.88		body mass (VT:0001259)	body weight (CMO:0000012)	2	157142078	211086598	Rat
12879845	Cm89	Cardiac mass QTL 89		0.008	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	152413072	175950118	Rat
61473	Bp19	Blood pressure QTL 19	6.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	172710921	175950118	Rat
1359030	Bp277	Blood pressure QTL 277			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	114837527	185876470	Rat
12879846	Cm90	Cardiac mass QTL 90		0.011	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	2	152413072	175950118	Rat
12879847	Am4	Aortic mass QTL 4		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	2	152413072	175950118	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	56043031	202447032	Rat
12879840	Bw179	Body weight QTL 179		0.005	body mass (VT:0001259)	body weight (CMO:0000012)	2	152413072	185122374	Rat
1581502	Esta3	Estrogen-induced thymic atrophy QTL 3			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	2	136916935	189599348	Rat
1359032	Hrtrt18	Heart rate QTL 18			heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	2	157142078	192625452	Rat
2301966	Bp322	Blood pressure QTL 322	3.58		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150540301	202447032	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118275	202447032	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	81689826	221035911	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
1359022	Ppulsi1	Prepulse inhibition QTL 1	3.63		prepulse inhibition trait (VT:0003088)	acoustic startle response measurement (CMO:0001519)	2	136916935	213594495	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	249053267	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	78665619	249053267	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	76539322	202447032	Rat
8662843	Vetf9	Vascular elastic tissue fragility QTL 9	2.05		thoracic aorta molecular composition trait (VT:0010568)	aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003)	2	157142078	226277316	Rat
631501	Bp101	Blood pressure QTL 101	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150341684	202446871	Rat
2301415	Cm67	Cardiac mass QTL 67		0.003	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	2	152413072	175950118	Rat
2307174	Activ3	Activity QTL 3	4.83	0.000058	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	2	168594495	213594495	Rat
1331794	Bp202	Blood pressure QTL 202	3.66819		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	141194931	223265385	Rat
71113	Cari2	Carrageenan-induced inflammation QTL 2	2.7	0.009	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	2	141596551	202447032	Rat
1331805	Cm29	Cardiac mass QTL 29	3.50746		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	2	141194931	223265385	Rat
11565180	Kidm56	Kidney mass QTL 56		0.003	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	152413072	175950118	Rat
634308	Sach6	Saccharin preference QTL 6	4.9		taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	2	112456140	212696837	Rat
1598805	Memor8	Memory QTL 8	3		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	2	150341585	189039377	Rat
11565181	Bw176	Body weight QTL 176		0.002	body mass (VT:0001259)	body weight (CMO:0000012)	2	152413072	175950118	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
724568	Uae13	Urinary albumin excretion QTL 13	4.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	2	143157029	210020885	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1300165	Rf9	Renal function QTL 9	3.28		kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	2	133914684	202447032	Rat
61401	Niddm2	Non-insulin dependent diabetes mellitus QTL 2	4.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	144599348	189599348	Rat
631507	Bp105	Blood pressure QTL 105		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	112456140	212696837	Rat
1641925	Alcrsp2	Alcohol response QTL 2			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	221167075	Rat
1354609	Niddm62	Non-insulin dependent diabetes mellitus QTL 62	4.72	0.000006	insulin secretion trait (VT:0003564)	plasma insulin level (CMO:0000342)	2	150540301	202447032	Rat
1598833	Bp295	Blood pressure QTL 295	3.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	147798556	192798556	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	81754530	222436696	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	46123260	202447032	Rat
631522	Bp74	Blood pressure QTL 74		0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	172710921	184114403	Rat
7488927	Bp365	Blood pressure QTL 365		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	162765032	207765032	Rat
1598838	Bp290	Blood pressure QTL 290	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	166539266	211539266	Rat
7488925	Bp364	Blood pressure QTL 364		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	160564068	205564068	Rat
2293843	Kiddil6	Kidney dilation QTL 6	3.1		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	42804607	182042367	Rat
2306901	Bp337	Blood pressure QTL 337		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	164073756	227146641	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	74786664	206665859	Rat
6903312	Bw112	Body weight QTL 112	3.2	0.0013	body mass (VT:0001259)	body weight (CMO:0000012)	2	143657569	184114274	Rat
7488904	Bp363	Blood pressure QTL 363		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	172982062	175950118	Rat
1354601	Slep1	Serum leptin concentration QTL 1	5.39		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	2	43171017	184114403	Rat

RH130360

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	173,868,466 - 173,868,668 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	187,772,160 - 187,772,361	NCBI	Rnor6.0
Rnor_5.0	2	207,174,659 - 207,174,860	UniSTS	Rnor5.0
RGSC_v3.4	2	180,512,258 - 180,512,459	UniSTS	RGSC3.4
Celera	2	167,813,195 - 167,813,396	UniSTS
RH 3.4 Map	2	1148.2	UniSTS
Cytogenetic Map	2	q34	UniSTS

RH138385

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	173,869,680 - 173,869,800 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	187,773,374 - 187,773,493	NCBI	Rnor6.0
Rnor_5.0	2	207,175,873 - 207,175,992	UniSTS	Rnor5.0
RGSC_v3.4	2	180,513,472 - 180,513,591	UniSTS	RGSC3.4
Celera	2	167,814,409 - 167,814,528	UniSTS
RH 3.4 Map	2	1148.9	UniSTS
Cytogenetic Map	2	q34	UniSTS

RH135423

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	2	176,145,910 - 176,146,147 (+)	Marker Load Pipeline
mRatBN7.2	2	173,848,088 - 173,848,325 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	187,751,785 - 187,752,021	NCBI	Rnor6.0
Rnor_5.0	2	207,154,284 - 207,154,520	UniSTS	Rnor5.0
RGSC_v3.4	2	180,491,883 - 180,492,119	UniSTS	RGSC3.4
Celera	2	167,792,830 - 167,793,070	UniSTS
Cytogenetic Map	2	q34	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001191568	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017591104	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282530	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC119762	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473976	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233374	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000035383 ⟹ ENSRNOP00000036204

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	173,848,074 - 173,868,191 (-)	Ensembl
Rnor_6.0 Ensembl	2	187,751,776 - 187,771,865 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000092517 ⟹ ENSRNOP00000075901

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	173,848,083 - 173,868,270 (-)	Ensembl
Rnor_6.0 Ensembl	2	187,752,282 - 187,771,857 (-)	Ensembl

RefSeq Acc Id:

NM_001191568 ⟹ NP_001178497

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	176,145,896 - 176,165,980 (-)	NCBI
mRatBN7.2	2	173,848,074 - 173,868,161 (-)	NCBI
Rnor_6.0	2	187,752,282 - 187,771,838 (-)	NCBI
Rnor_5.0	2	207,154,781 - 207,174,337 (-)	NCBI
Celera	2	167,793,331 - 167,812,873 (-)	NCBI

Sequence:

show sequence

ATGGCTGGAGTGAGCCAAGATAATGAGGCTGCGGAAAAGGGGCCCGAGGGTTCATCTACGGAAGCTGTGCCAGGCGACACGACCATCTCCAGGGTGAAACTCCTCGATACCATAGTGGACACTTTCCT
CCAGAAACTAGTCGCGGGCAAGAGCTATGAGAGGTTCGCCAGCTGTTACAAACACTTGCACCAGTTGAACCCTGAGGCGACACGGTGGATCTATGACAAGTTTGTGGCTCAGTTGCAGACGTCTATCC
GTGAGGAAATCTCAGAAATCAAAGAGGAGGGGAACCTAGAAGCTGTCCTGAACTCCCTGGATAAGATAATAGAAGAAGGCAAAGATCGTGGAGAGACAGCCTGGCGACCTAGTGGAATCCCAGAGAAA
GACCTGTGCAGTGTCATGGCACCCTACTTCTTGAAGCAGCAGGATACCCTGTGCCGTCAAGTTCAGAAACAGGAAGCCAAGAACCAGGAACTGGCTGAGGCTGTGCTGGCTGGACGCCGGCAGGTGGA
GGAGCTACAGCAGCAGGTTCAGGCCGTCCAGCAAACATGGCAGGCTCTACACAGAGAGCAGAGGGAGCTGTTGTCGGTGCTAAGGGCACCCGAGTGA

hide sequence

RefSeq Acc Id:

XM_017591104 ⟹ XP_017446593

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	176,145,896 - 176,166,021 (-)	NCBI
mRatBN7.2	2	173,848,074 - 173,868,272 (-)	NCBI
Rnor_6.0	2	187,751,770 - 187,771,933 (-)	NCBI

Sequence:

show sequence

CATCCGGCTCAGTGACGGGCATTCCCTTGCCTCCAATCGGAGGTCCTGTTGGGAGGAGCTGCAGGACCAGTTCATTTTGGCGGTTCAATTTCAACATGGCTGGAGTGAGCCAAGATAATGAGGCTGCG
GAAAAGGGGCCCGAGGGTTCATCTACGGAAGCTGTGCCAGGCGACACGACCATCTCCAGGGTGAAACTCCTCGATACCATAGTGGACACTTTCCTCCAGAAACTAGTCGCGGGCAAGAGGCGACCTAG
TGGAATCCCAGAGAAAGACCTGTGCAGTGTCATGGCACCCTACTTCTTGAAGCAGCAGGATACCCTGTGCCGTCAAGTTCAGAAACAGGAAGCCAAGAACCAGGAACTGGCTGAGGCTGTGCTGGCTG
GACGCCGGCAGGTGGAGGAGCTACAGCAGCAGGTTCAGGCCGTCCAGCAAACATGGCAGGCTCTACACAGAGAGCAGAGGGAGCTGTTGTCGGTGCTAAGGGCACCCGAGTGAGAAGCCCCAGAGCTG
AGAGCAGTCGCAGCCCTGTAGAGCACTTGTGGAGCCAGTTTCCAGGCAGTGATGAAGCTCCCTCCACTGCTCAGGTTCTGGTAGGGTCAGACTACCTTCAGCTTCCTGCCACCATCTTCTGCCTGCAA
GAATGGGACTCCCACCCTGGGCATCAGACACCAGGCTTTGTCTCCTGGAGTTGCAGCCAGCACTGCCCCATGCCTTCCTGATTCCCCAGCCCTCCCTGGACTGGATTTGGGTAGTGTTTCAGTCTTTA
CTGATTGCCGCCTTGTTGACCAGCTCACGGTCCCTTGCCATGTTCTCCCCGACTGATTGCTGCCTTGCTGGCTAGCCCAAGGGCCCTTGCCATGTTCTCCCCGACTGATTGCTGCCTTGCTGGCTAGC
CCAAGGGCCCTTGCCATGTTCTCCCCGACTGATTGCTGCCTTGCTGGCTAGCCCAAGGGCCCTTGCCATGTTCTCCCCACATCCGTAAATAAACTTCCTCTACCACACTGTAA

hide sequence

RefSeq Acc Id:

XM_063282530 ⟹ XP_063138600

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	176,145,896 - 176,166,022 (-)	NCBI


Protein RefSeqs	NP_001178497	(Get FASTA)	NCBI Sequence Viewer
	XP_017446593	(Get FASTA)	NCBI Sequence Viewer
	XP_063138600	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM00716	(Get FASTA)	NCBI Sequence Viewer
	EDM00717	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000036204
	ENSRNOP00000036204.5
	ENSRNOP00000075901
	ENSRNOP00000075901.1

RefSeq Acc Id:

NP_001178497 ⟸ NM_001191568

- UniProtKB:

A6J673 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAGVSQDNEAAEKGPEGSSTEAVPGDTTISRVKLLDTIVDTFLQKLVAGKSYERFASCYKHLHQLNPEATRWIYDKFVAQLQTSIREEISEIKEEGNLEAVLNSLDKIIEEGKDRGETAWRPSGIPEK
DLCSVMAPYFLKQQDTLCRQVQKQEAKNQELAEAVLAGRRQVEELQQQVQAVQQTWQALHREQRELLSVLRAPE

hide sequence

RefSeq Acc Id:	XP_017446593 ⟸ XM_017591104
- Peptide Label:	isoform X1
- UniProtKB:	A0A0U1RS22 (UniProtKB/TrEMBL), A6J672 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAGVSQDNEAAEKGPEGSSTEAVPGDTTISRVKLLDTIVDTFLQKLVAGKRRPSGIPEKDLCSVMAPYFLKQQDTLCRQVQKQEAKNQELAEAVLAGRRQVEELQQQVQAVQQTWQALHREQRELLSV LRAPE hide sequence

Ensembl Acc Id:

ENSRNOP00000075901 ⟸ ENSRNOT00000092517

Ensembl Acc Id:

ENSRNOP00000036204 ⟸ ENSRNOT00000035383

RefSeq Acc Id:	XP_063138600 ⟸ XM_063282530
- Peptide Label:	isoform X2

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZEH8-F1-model_v2	AlphaFold	D3ZEH8	1-202	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13691439

Promoter ID:

EPDNEW_R1962

Type:

initiation region

Name:

Pmf1_1

Description:

polyamine-modulated factor 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	2	187,771,854 - 187,771,914	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-52484	BioCyc
Ensembl Genes	ENSRNOG00000019620	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000035383	ENTREZGENE
	ENSRNOT00000035383.6	UniProtKB/TrEMBL
	ENSRNOT00000092517	ENTREZGENE
	ENSRNOT00000092517.2	UniProtKB/TrEMBL
InterPro	Nnf1	UniProtKB/TrEMBL
NCBI Gene	681050	ENTREZGENE
PANTHER	POLYAMINE-MODULATED FACTOR 1	UniProtKB/TrEMBL
	PTHR15459	UniProtKB/TrEMBL
Pfam	Nnf1	UniProtKB/TrEMBL
PhenoGen	Pmf1	PhenoGen
RatGTEx	ENSRNOG00000019620	RatGTEx
UniProt	A0A0U1RS22	ENTREZGENE, UniProtKB/TrEMBL
	A6J672	ENTREZGENE, UniProtKB/TrEMBL
	A6J673	ENTREZGENE, UniProtKB/TrEMBL
	D3ZEH8_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-05	Pmf1	polyamine-modulated factor 1	LOC681050	similar to polyamine-modulated factor 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-01-09	LOC681050	similar to polyamine-modulated factor 1	LOC686408	similar to polyamine-modulated factor 1	Data merged from RGD:1597675	1643240	APPROVED
2006-11-20	LOC686408	similar to polyamine-modulated factor 1			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-19	LOC681050	similar to polyamine-modulated factor 1			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar