Symbol:
Rpe
Name:
ribulose-5-phosphate-3-epimerase
RGD ID:
1564890
Description:
Enables D-ribulose-phosphate 3-epimerase activity and monosaccharide binding activity. Involved in pentose-phosphate shunt, non-oxidative branch. Predicted to be active in cytosol. Orthologous to several human genes including RPE (ribulose-5-phosphate-3-epimerase); PARTICIPATES IN pentose phosphate pathway; ribose 5-phosphate isomerase deficiency pathway; transaldolase deficiency pathway; INTERACTS WITH 2,3,7,8-Tetrachlorodibenzofuran; bisphenol A; buspirone.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
MGC124653; ribulose-phosphate 3-epimerase; similar to Ribulose-5-phosphate-3-epimerase
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
RPE (ribulose-5-phosphate-3-epimerase) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):
Rpe (ribulose-5-phosphate-3-epimerase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Rpe (ribulose-5-phosphate-3-epimerase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
RPE (ribulose-5-phosphate-3-epimerase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
RPE (ribulose-5-phosphate-3-epimerase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Rpe (ribulose-5-phosphate-3-epimerase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
RPE (ribulose-5-phosphate-3-epimerase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
RPE (ribulose-5-phosphate-3-epimerase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Rpe (ribulose-5-phosphate-3-epimerase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
RPEL1 (ribulose-5-phosphate-3-epimerase like 1) HGNC
EggNOG, Ensembl, OrthoDB, Panther
Alliance orthologs 3
Homo sapiens (human):
RPE (ribulose-5-phosphate-3-epimerase)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Rpe (ribulose-5-phosphate-3-epimerase)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
RPEL1 (ribulose-5-phosphate-3-epimerase like 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
rpe (ribulose-5-phosphate-3-epimerase)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
F08F8.7
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
RPE1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Rpe
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
rpe
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 75,640,867 - 75,661,009 (+) NCBI GRCr8 mRatBN7.2 9 68,191,027 - 68,211,295 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 68,191,292 - 68,211,591 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 76,683,016 - 76,701,336 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 81,811,955 - 81,830,275 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 80,206,660 - 80,228,639 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 73,687,684 - 73,713,643 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 73,687,743 - 73,711,571 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 73,592,974 - 73,615,163 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 9 65,470,071 - 65,490,200 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 9 65,672,114 - 65,690,468 (+) NCBI Celera Cytogenetic Map 9 q32 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Rpe Rat 1,2-dimethylhydrazine increases expression ISO Rpe (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of RPE mRNA CTD PMID:22206623 Rpe Rat 17beta-estradiol decreases expression ISO Rpe (Mus musculus) 6480464 Estradiol results in decreased expression of RPE mRNA CTD PMID:39298647 Rpe Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Rpe (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of RPE mRNA CTD PMID:19770486 Rpe Rat 2,3,7,8-Tetrachlorodibenzofuran increases expression EXP 6480464 2 more ... CTD PMID:32109520 Rpe Rat 2-methylcholine affects expression ISO RPE (Homo sapiens) 6480464 beta-methylcholine affects the expression of RPE mRNA CTD PMID:21179406 Rpe Rat 4,4'-diaminodiphenylmethane increases expression ISO Rpe (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of RPE mRNA CTD PMID:18648102 Rpe Rat 4,4'-sulfonyldiphenol increases expression ISO RPE (Homo sapiens) 6480464 bisphenol S results in increased expression of RPE mRNA CTD PMID:31121516 Rpe Rat 4,4'-sulfonyldiphenol increases methylation ISO RPE (Homo sapiens) 6480464 bisphenol S results in increased methylation of RPE gene CTD PMID:31601247 Rpe Rat 4-hydroxyphenyl retinamide decreases expression ISO Rpe (Mus musculus) 6480464 Fenretinide results in decreased expression of RPE mRNA CTD PMID:28973697 Rpe Rat acrolein multiple interactions ISO RPE (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with Ozone] results in increased expression of RPE mRNA CTD PMID:32845096 Rpe Rat aflatoxin B1 increases expression ISO Rpe (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of RPE mRNA CTD PMID:19770486 Rpe Rat all-trans-retinoic acid decreases expression ISO RPE (Homo sapiens) 6480464 Tretinoin results in decreased expression of RPE mRNA CTD PMID:21934132 Rpe Rat all-trans-retinoic acid increases expression ISO RPE (Homo sapiens) 6480464 Tretinoin results in increased expression of RPE mRNA CTD PMID:33167477 Rpe Rat aristolochic acid A increases expression ISO RPE (Homo sapiens) 6480464 aristolochic acid I results in increased expression of RPE protein CTD PMID:33212167 Rpe Rat aristolochic acid A decreases expression ISO RPE (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of RPE mRNA CTD PMID:33212167 Rpe Rat arsane multiple interactions ISO RPE (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of RPE mRNA CTD PMID:39836092 Rpe Rat arsenic atom multiple interactions ISO RPE (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of RPE mRNA CTD PMID:39836092 Rpe Rat benzo[a]pyrene decreases expression ISO Rpe (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of RPE mRNA CTD PMID:19770486 Rpe Rat benzo[a]pyrene increases expression ISO Rpe (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of RPE mRNA CTD PMID:22228805 Rpe Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of RPE mRNA CTD PMID:25181051 Rpe Rat bisphenol A decreases expression ISO RPE (Homo sapiens) 6480464 bisphenol A results in decreased expression of RPE mRNA CTD PMID:29275510 Rpe Rat bisphenol F increases expression ISO RPE (Homo sapiens) 6480464 bisphenol F results in increased expression of RPE mRNA CTD PMID:31121516 Rpe Rat buspirone decreases expression EXP 6480464 Buspirone results in decreased expression of RPE mRNA CTD PMID:24136188 Rpe Rat cadmium dichloride increases expression ISO RPE (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of RPE protein CTD PMID:24527689 Rpe Rat cobalt dichloride decreases expression ISO RPE (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of RPE mRNA CTD PMID:19376846 Rpe Rat dicrotophos decreases expression ISO RPE (Homo sapiens) 6480464 dicrotophos results in decreased expression of RPE mRNA CTD PMID:28302478 Rpe Rat doxorubicin decreases expression ISO RPE (Homo sapiens) 6480464 Doxorubicin results in decreased expression of RPE mRNA CTD PMID:29803840 Rpe Rat ethanol affects expression ISO Rpe (Mus musculus) 6480464 Ethanol affects the expression of RPE mRNA CTD PMID:30319688 Rpe Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of RPE mRNA CTD PMID:24136188 Rpe Rat folic acid decreases expression ISO Rpe (Mus musculus) 6480464 Folic Acid results in decreased expression of RPE mRNA CTD PMID:25629700 Rpe Rat furan increases expression EXP 6480464 furan results in increased expression of RPE mRNA CTD PMID:27387713 Rpe Rat hydrogen peroxide affects expression ISO RPE (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of RPE mRNA CTD PMID:20044591 Rpe Rat hydrogen peroxide increases expression ISO RPE (Homo sapiens) 6480464 Hydrogen Peroxide results in increased expression of RPE mRNA CTD PMID:18951874 Rpe Rat ivermectin decreases expression ISO RPE (Homo sapiens) 6480464 Ivermectin results in decreased expression of RPE protein CTD PMID:32959892 Rpe Rat manganese atom multiple interactions ISO RPE (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in increased expression of RPE mRNA CTD PMID:39836092 Rpe Rat manganese(0) multiple interactions ISO RPE (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in increased expression of RPE mRNA CTD PMID:39836092 Rpe Rat manganese(II) chloride multiple interactions ISO RPE (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in increased expression of RPE mRNA CTD PMID:39836092 Rpe Rat nickel atom decreases expression ISO RPE (Homo sapiens) 6480464 Nickel results in decreased expression of RPE mRNA CTD PMID:23195993 Rpe Rat ochratoxin A decreases expression EXP 6480464 ochratoxin A results in decreased expression of RPE mRNA CTD PMID:22124623 Rpe Rat ozone multiple interactions ISO RPE (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with Ozone] results in increased expression of RPE mRNA CTD PMID:32845096 Rpe Rat paracetamol affects expression ISO Rpe (Mus musculus) 6480464 Acetaminophen affects the expression of RPE mRNA CTD PMID:17562736 Rpe Rat paracetamol decreases expression ISO RPE (Homo sapiens) 6480464 Acetaminophen results in decreased expression of RPE mRNA CTD PMID:21420995 Rpe Rat phenytoin increases expression EXP 6480464 Phenytoin results in increased expression of RPE mRNA CTD PMID:20345932 Rpe Rat quercetin decreases expression ISO RPE (Homo sapiens) 6480464 Quercetin results in decreased expression of RPE mRNA CTD PMID:21632981 Rpe Rat resveratrol multiple interactions ISO RPE (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of RPE mRNA CTD PMID:23557933 Rpe Rat sodium arsenite decreases expression ISO RPE (Homo sapiens) 6480464 sodium arsenite results in decreased expression of RPE mRNA CTD PMID:38568856 Rpe Rat sodium arsenite multiple interactions ISO RPE (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of RPE mRNA CTD PMID:39836092 Rpe Rat sunitinib increases expression ISO RPE (Homo sapiens) 6480464 Sunitinib results in increased expression of RPE mRNA CTD PMID:31533062 Rpe Rat titanium dioxide decreases methylation ISO Rpe (Mus musculus) 6480464 titanium dioxide results in decreased methylation of RPE gene CTD PMID:35295148 Rpe Rat triphenyl phosphate affects expression ISO RPE (Homo sapiens) 6480464 triphenyl phosphate affects the expression of RPE mRNA CTD PMID:37042841 Rpe Rat triptonide affects expression ISO Rpe (Mus musculus) 6480464 triptonide affects the expression of RPE mRNA CTD PMID:33045310 Rpe Rat valproic acid increases expression ISO RPE (Homo sapiens) 6480464 Valproic Acid results in increased expression of RPE mRNA CTD PMID:23179753
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2-methylcholine (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) acrolein (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) buspirone (EXP) cadmium dichloride (ISO) cobalt dichloride (ISO) dicrotophos (ISO) doxorubicin (ISO) ethanol (ISO) flutamide (EXP) folic acid (ISO) furan (EXP) hydrogen peroxide (ISO) ivermectin (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) nickel atom (ISO) ochratoxin A (EXP) ozone (ISO) paracetamol (ISO) phenytoin (EXP) quercetin (ISO) resveratrol (ISO) sodium arsenite (ISO) sunitinib (ISO) titanium dioxide (ISO) triphenyl phosphate (ISO) triptonide (ISO) valproic acid (ISO)
Rpe Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 75,640,867 - 75,661,009 (+) NCBI GRCr8 mRatBN7.2 9 68,191,027 - 68,211,295 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 68,191,292 - 68,211,591 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 76,683,016 - 76,701,336 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 81,811,955 - 81,830,275 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 80,206,660 - 80,228,639 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 73,687,684 - 73,713,643 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 73,687,743 - 73,711,571 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 73,592,974 - 73,615,163 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 9 65,470,071 - 65,490,200 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 9 65,672,114 - 65,690,468 (+) NCBI Celera Cytogenetic Map 9 q32 NCBI
RPE Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 210,002,638 - 210,022,260 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 210,002,565 - 210,022,260 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 210,867,362 - 210,886,984 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 210,575,597 - 210,594,536 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 210,692,886 - 210,711,796 NCBI Celera 2 204,635,382 - 204,654,317 (+) NCBI Celera Cytogenetic Map 2 q34 NCBI HuRef 2 202,712,085 - 202,732,295 (+) NCBI HuRef CHM1_1 2 210,873,478 - 210,893,159 (+) NCBI CHM1_1 T2T-CHM13v2.0 2 210,483,346 - 210,502,965 (+) NCBI T2T-CHM13v2.0
Rpe Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 66,739,957 - 66,758,964 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 66,739,990 - 66,758,964 (+) Ensembl GRCm39 Ensembl GRCm38 1 66,700,797 - 66,719,805 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 66,700,831 - 66,719,805 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 66,747,467 - 66,766,379 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 66,634,101 - 66,653,013 (+) NCBI MGSCv36 mm8 Celera 1 67,215,120 - 67,233,622 (+) NCBI Celera Cytogenetic Map 1 C3 NCBI cM Map 1 33.61 NCBI
Rpe Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955457 5,425,532 - 5,441,538 (-) NCBI ChiLan1.0 ChiLan1.0
RPE Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 13 112,625,893 - 112,645,620 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2B 112,640,872 - 112,661,872 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2B 97,260,348 - 97,282,397 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2B 215,663,592 - 215,685,654 (+) NCBI panpan1.1 PanPan1.1 panPan2
RPE Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 37 17,866,729 - 17,882,702 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 37 18,747,197 - 18,762,940 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 37 17,804,510 - 17,820,257 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 37 17,804,539 - 17,827,714 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 37 17,757,437 - 17,773,149 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 37 17,719,697 - 17,735,453 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 37 17,734,148 - 17,753,357 (+) NCBI UU_Cfam_GSD_1.0
Rpe
RPE
RPE
Rpe
.
Predicted Target Of
Count of predictions: 193 Count of miRNA genes: 133 Interacting mature miRNAs: 167 Transcripts: ENSRNOT00000017197 Prediction methods: Miranda, Targetscan Result types: miRGate_prediction
7411571 Bw138 Body weight QTL 138 14.3 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 9 32535505 77535505 Rat 11353957 Bmd92 Bone mineral density QTL 92 0.01 tibia mineral mass (VT:1000283) volumetric bone mineral density (CMO:0001553) 9 46114199 91114199 Rat 61385 Edpm9 Estrogen-dependent pituitary mass QTL 9 3.43 0.05 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 9 63869687 108869687 Rat 70218 Cm28 Cardiac mass QTL 28 8.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 9 25268044 79271759 Rat 724544 Uae9 Urinary albumin excretion QTL 9 4.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 9 25268044 114175309 Rat 1578760 Cm53 Cardiac mass QTL 53 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 9 56771635 101771635 Rat 1581580 Uae34 Urinary albumin excretion QTL 34 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 9 62072275 96470995 Rat 12879506 Pur33 Proteinuria QTL 33 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 9 44649921 89649921 Rat 731164 Uae25 Urinary albumin excretion QTL 25 3.5 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 9 25661188 100929786 Rat 1598849 Memor17 Memory QTL 17 2.2 exploratory behavior trait (VT:0010471) difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678) 9 49968546 71098346 Rat 10058949 Gmadr5 Adrenal mass QTL 5 2 0.014 adrenal gland mass (VT:0010420) both adrenal glands wet weight to body weight ratio (CMO:0002411) 9 42791513 87976209 Rat 1578757 Pur6 Proteinuria QTL 6 3.3 0.005 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 9 62072275 96470995 Rat 631656 Bp108 Blood pressure QTL 108 5.97 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 48598251 93598251 Rat 2303170 Bp332 Blood pressure QTL 332 3.73 0.027 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 9 55847841 77026453 Rat 8662828 Vetf6 Vascular elastic tissue fragility QTL 6 3.9 artery integrity trait (VT:0010639) patent ductus arteriosus score (CMO:0002566) 9 36962359 92058970 Rat 61352 Bp34 Blood pressure QTL 34 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 42495343 79271511 Rat 724515 Uae16 Urinary albumin excretion QTL 16 8 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 9 58163035 100929646 Rat 731171 Glom6 Glomerulus QTL 6 2.8 0.0003 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 9 64573531 109573531 Rat 1598834 Memor11 Memory QTL 11 2.5 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 9 36962359 77814038 Rat 70186 Niddm26 Non-insulin dependent diabetes mellitus QTL 26 3.87 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 9 22071169 86369743 Rat 7207814 Bmd91 Bone mineral density QTL 91 3.5 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 9 23754144 83851531 Rat 6903941 Pur31 Proteinuria QTL 31 0.036 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 9 40194188 85194188 Rat 2303180 Bp333 Blood pressure QTL 333 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 56627713 78595166 Rat 2290450 Scl57 Serum cholesterol level QTL 57 4.15 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 9 36962359 95410867 Rat 11353949 Bp393 Blood pressure QTL 393 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 40194188 85194188 Rat 11353951 Bp394 Blood pressure QTL 394 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 44649921 89649921 Rat 10054125 Srcrt7 Stress Responsive Cort QTL 7 3.33 0.0011 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 9 1 87073594 Rat 1300134 Bp185 Blood pressure QTL 185 3.73 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 9 61381434 104821652 Rat 7411656 Foco26 Food consumption QTL 26 9.8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 9 32535505 77535505 Rat 1641894 Alcrsp12 Alcohol response QTL 12 response to alcohol trait (VT:0010489) brain neurotensin receptor 1 density (CMO:0002068) 9 27468639 72468639 Rat
BF398855
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 9 68,208,563 - 68,208,726 (+) MAPPER mRatBN7.2 Rnor_6.0 9 73,708,834 - 73,708,996 NCBI Rnor6.0 Rnor_5.0 9 73,597,621 - 73,597,783 UniSTS Rnor5.0 RGSC_v3.4 9 65,487,469 - 65,487,631 UniSTS RGSC3.4 Celera 9 65,687,737 - 65,687,899 UniSTS RH 3.4 Map 9 612.0 UniSTS Cytogenetic Map 9 q32 UniSTS
RH140448
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 9 68,210,879 - 68,211,078 (+) MAPPER mRatBN7.2 Rnor_6.0 9 73,711,150 - 73,711,348 NCBI Rnor6.0 Rnor_5.0 9 73,595,269 - 73,595,467 UniSTS Rnor5.0 RGSC_v3.4 9 65,489,785 - 65,489,983 UniSTS RGSC3.4 Celera 9 65,690,053 - 65,690,251 UniSTS RH 3.4 Map 9 615.29 UniSTS Cytogenetic Map 9 q32 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000017197 ⟹ ENSRNOP00000017197
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 9 68,191,343 - 68,211,291 (+) Ensembl Rnor_6.0 Ensembl 9 73,687,786 - 73,711,571 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000079495 ⟹ ENSRNOP00000069730
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 9 68,191,329 - 68,211,591 (+) Ensembl Rnor_6.0 Ensembl 9 73,687,743 - 73,710,726 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000079912
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 9 73,707,005 - 73,708,063 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000116351 ⟹ ENSRNOP00000086710
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 9 68,191,292 - 68,211,291 (+) Ensembl
RefSeq Acc Id:
NM_001033903 ⟹ NP_001029075
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 75,641,041 - 75,661,009 (+) NCBI mRatBN7.2 9 68,191,327 - 68,211,295 (+) NCBI Rnor_6.0 9 73,687,786 - 73,711,565 (+) NCBI Rnor_5.0 9 73,592,974 - 73,615,163 (-) NCBI RGSC_v3.4 9 65,470,071 - 65,490,200 (+) RGD Celera 9 65,672,114 - 65,690,468 (+) RGD
Sequence:
CGGCACCATGGCGTCGGGCTGCAAGATCGGCCCGTCCATCCTCAACAGCGACCTGGCCAACCTGGGGGCCGAGTGCCTGCGCATGCTGGACTCGGGGGCCGACTACCTGCACCTGGATGTAATGGACG
hide sequence
RefSeq Acc Id:
NM_001399122 ⟹ NP_001386051
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 75,641,041 - 75,661,009 (+) NCBI mRatBN7.2 9 68,191,327 - 68,211,295 (+) NCBI
RefSeq Acc Id:
NM_001399123 ⟹ NP_001386052
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 75,641,041 - 75,661,009 (+) NCBI mRatBN7.2 9 68,191,327 - 68,211,295 (+) NCBI
RefSeq Acc Id:
NM_001399124 ⟹ NP_001386053
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 75,641,041 - 75,661,009 (+) NCBI mRatBN7.2 9 68,191,327 - 68,211,295 (+) NCBI
RefSeq Acc Id:
NM_001399125 ⟹ NP_001386054
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 75,641,041 - 75,661,009 (+) NCBI mRatBN7.2 9 68,191,327 - 68,211,295 (+) NCBI
RefSeq Acc Id:
NM_001399127 ⟹ NP_001386056
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 75,641,041 - 75,661,009 (+) NCBI mRatBN7.2 9 68,191,327 - 68,211,295 (+) NCBI
RefSeq Acc Id:
XM_006245105 ⟹ XP_006245167
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 75,640,940 - 75,661,009 (+) NCBI mRatBN7.2 9 68,191,199 - 68,211,295 (+) NCBI Rnor_6.0 9 73,687,690 - 73,711,565 (+) NCBI Rnor_5.0 9 73,592,974 - 73,615,163 (-) NCBI
Sequence:
TGCGAGATGGGAGGGGGCGGAGCCAGTGCGGCGCGCCCAATCGAGACGAAGTCTTGGCTGGCCCGGGCTCTCGTGGGCTCACTCGCTCTAGGGAACCGGCACCATGGCGTCGGGCTGCAAGATCGGCC
hide sequence
RefSeq Acc Id:
XM_006245107 ⟹ XP_006245169
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 75,640,961 - 75,661,009 (+) NCBI mRatBN7.2 9 68,191,241 - 68,211,295 (+) NCBI Rnor_6.0 9 73,687,693 - 73,711,565 (+) NCBI Rnor_5.0 9 73,592,974 - 73,615,163 (-) NCBI
Sequence:
GAGATGGGAGGGGGCGGAGCCAGTGCGGCGCGCCCAATCGAGACGAAGTCTTGGCTGGCCCGGG
hide sequence
RefSeq Acc Id:
XM_008767287 ⟹ XP_008765509
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 75,640,938 - 75,661,009 (+) NCBI mRatBN7.2 9 68,191,167 - 68,211,295 (+) NCBI Rnor_6.0 9 73,687,689 - 73,711,565 (+) NCBI
Sequence:
GTGCGAGATGGGAGGGGGCGGAGCCAGTGCGGCGCGCCCAATCGAGACGAAGTCTTGGCTGGCC
hide sequence
RefSeq Acc Id:
XM_008767288 ⟹ XP_008765510
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 75,640,867 - 75,661,009 (+) NCBI mRatBN7.2 9 68,191,027 - 68,211,295 (+) NCBI Rnor_6.0 9 73,687,684 - 73,711,565 (+) NCBI
Sequence:
AGACAGTGCGAGATGGGAGGGGGCGGAGCCAGTGCGGCGCGCCCAATCGAGACGAAGTCTTGGC
hide sequence
RefSeq Acc Id:
XM_008767289 ⟹ XP_008765511
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 75,640,984 - 75,661,009 (+) NCBI mRatBN7.2 9 68,191,304 - 68,211,295 (+) NCBI Rnor_6.0 9 73,687,820 - 73,711,565 (+) NCBI
Sequence:
TCCATCCTCAACAGCGACCTGGCCAACCTGGGGGCCGAGTGCCTGCGCATGCTGGACTCGGGGG
hide sequence
RefSeq Acc Id:
XM_039084097 ⟹ XP_038940025
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 75,641,122 - 75,661,009 (+) NCBI mRatBN7.2 9 68,191,304 - 68,211,295 (+) NCBI
RefSeq Acc Id:
XM_063267618 ⟹ XP_063123688
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 75,640,945 - 75,661,009 (+) NCBI
RefSeq Acc Id:
XM_063267619 ⟹ XP_063123689
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 75,640,948 - 75,661,009 (+) NCBI
RefSeq Acc Id:
XM_063267620 ⟹ XP_063123690
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 75,641,024 - 75,661,009 (+) NCBI
RefSeq Acc Id:
NP_001029075 ⟸ NM_001033903
- Peptide Label:
isoform 4
- UniProtKB:
Q3MIF0 (UniProtKB/TrEMBL)
- Sequence:
MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSRPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIKPGTTVEYL
hide sequence
RefSeq Acc Id:
XP_006245167 ⟸ XM_006245105
- Peptide Label:
isoform X2
- Sequence:
MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFVCPDAMPPSYPTHFFFLDLDMHMMVSRPEQWVKPMAVAGANQYTFHLEATENPGALIKDIR
hide sequence
RefSeq Acc Id:
XP_006245169 ⟸ XM_006245107
- Peptide Label:
isoform X4
- UniProtKB:
A0A0G2JW38 (UniProtKB/TrEMBL)
- Sequence:
MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSRPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKHCLLQVGLAIKPGT
hide sequence
RefSeq Acc Id:
XP_008765510 ⟸ XM_008767288
- Peptide Label:
isoform X3
- Sequence:
MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFGSLLSTFYLLSSVCPDAMPPSYPTHFFFLDLDMHMMVSRPEQWVKPMAVAGANQYTFHLEA
hide sequence
RefSeq Acc Id:
XP_008765509 ⟸ XM_008767287
- Peptide Label:
isoform X1
- Sequence:
MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFGSLLSTFYLLSSVCPDAMPPSYPTHFFFLDLDMHMMVSRPEQWVKPMAVAGANQYTFHLEA
hide sequence
RefSeq Acc Id:
XP_008765511 ⟸ XM_008767289
- Peptide Label:
isoform X7
- Sequence:
MPPSYPTHFFFLDLDMHMMVSRPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKHCL
hide sequence
Ensembl Acc Id:
ENSRNOP00000069730 ⟸ ENSRNOT00000079495
Ensembl Acc Id:
ENSRNOP00000017197 ⟸ ENSRNOT00000017197
RefSeq Acc Id:
XP_038940025 ⟸ XM_039084097
- Peptide Label:
isoform X7
Ensembl Acc Id:
ENSRNOP00000086710 ⟸ ENSRNOT00000116351
RefSeq Acc Id:
NP_001386051 ⟸ NM_001399122
- Peptide Label:
isoform 1
- UniProtKB:
A0A8I6GEB4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001386052 ⟸ NM_001399123
- Peptide Label:
isoform 2
RefSeq Acc Id:
NP_001386053 ⟸ NM_001399124
- Peptide Label:
isoform 3
- UniProtKB:
A6KFD1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001386054 ⟸ NM_001399125
- Peptide Label:
isoform 5
RefSeq Acc Id:
NP_001386056 ⟸ NM_001399127
- Peptide Label:
isoform 6
- UniProtKB:
A6KFD3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063123688 ⟸ XM_063267618
- Peptide Label:
isoform X5
RefSeq Acc Id:
XP_063123689 ⟸ XM_063267619
- Peptide Label:
isoform X6
RefSeq Acc Id:
XP_063123690 ⟸ XM_063267620
- Peptide Label:
isoform X8
RGD ID: 13696730 Promoter ID: EPDNEW_R7248 Type: initiation region Name: Rpe_1 Description: ribulose-5-phosphate-3-epimerase SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 9 73,687,770 - 73,687,830 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-03-06
Rpe
ribulose-5-phosphate-3-epimerase
MGC124653
similar to Ribulose-5-phosphate-3-epimerase
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-02-09
MGC124653
similar to Ribulose-5-phosphate-3-epimerase
Symbol and Name status set to provisional
70820 PROVISIONAL
