Advanced Search (OLGA)

Gene: Usp10 (ubiquitin specific peptidase 10) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Usp10

Name:

ubiquitin specific peptidase 10

RGD ID:

1561965

Description:

Predicted to enable several functions, including cysteine-type peptidase activity; p53 binding activity; and transmembrane transporter binding activity. Predicted to be involved in several processes, including DNA damage response, signal transduction by p53 class mediator; monoubiquitinated protein deubiquitination; and negative regulation of canonical NF-kappaB signal transduction. Predicted to be located in cytoplasm; intermediate filament cytoskeleton; and nucleoplasm. Predicted to be part of protein-containing complex. Predicted to be active in cytosolic ribosome; early endosome; and nucleus. Orthologous to human USP10 (ubiquitin specific peptidase 10); INTERACTS WITH (+)-schisandrin B; 2,4-dinitrotoluene; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

deubiquitinating enzyme 10; MGC124997; ubiquitin carboxyl-terminal hydrolase 10; ubiquitin specific protease 10; ubiquitin thioesterase 10; ubiquitin thiolesterase 10; ubiquitin-specific-processing protease 10

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	USP10 (ubiquitin specific peptidase 10)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Usp10 (ubiquitin specific peptidase 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Usp10 (ubiquitin specific peptidase 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	USP10 (ubiquitin specific peptidase 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	USP10 (ubiquitin specific peptidase 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Usp10 (ubiquitin specific peptidase 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	USP10 (ubiquitin specific peptidase 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	USP10 (ubiquitin specific peptidase 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Usp10 (ubiquitin specific peptidase 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	USP10 (ubiquitin specific peptidase 10)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Usp10 (ubiquitin specific peptidase 10)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	usp10 (ubiquitin specific peptidase 10)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	UBP3	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Usp10	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	usp10	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	64,881,255 - 64,923,522 (+)	NCBI		GRCr8
mRatBN7.2	19	47,972,858 - 48,014,900 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	47,972,611 - 48,014,897 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	54,767,502 - 54,809,229 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	55,448,244 - 55,489,969 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	57,661,267 - 57,703,079 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	52,566,274 - 52,608,820 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	52,566,607 - 52,608,817 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	63,313,910 - 63,356,424 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	50,202,951 - 50,244,677 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	19	47,229,671 - 47,271,396 (+)	NCBI		Celera
Cytogenetic Map	19	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Usp10	Rat	persistent fetal circulation syndrome		ISO	USP10 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Congenital alveolar capillary dysplasia	ClinVar
Usp10	Rat	schizophrenia		ISO	USP10 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Schizophrenia	ClinVar	PMID:21681106 and PMID:30208311

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Usp10	Rat	(+)-schisandrin B	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of USP10 mRNA]	CTD	PMID:31150632
Usp10	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	Usp10 (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of USP10 mRNA	CTD	PMID:22206623
Usp10	Rat	17alpha-ethynylestradiol	affects expression	ISO	Usp10 (Mus musculus)	6480464	Ethinyl Estradiol affects the expression of USP10 mRNA	CTD	PMID:17555576
Usp10	Rat	17beta-estradiol	increases expression	ISO	Usp10 (Mus musculus)	6480464	Estradiol results in increased expression of USP10 mRNA	CTD	PMID:39298647
Usp10	Rat	2,2',4,4'-Tetrabromodiphenyl ether	decreases expression	ISO	USP10 (Homo sapiens)	6480464	2 more ...	CTD	PMID:31675489
Usp10	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	USP10 (Homo sapiens)	6480464	Tetrachlorodibenzodioxin affects the expression of USP10 mRNA	CTD	PMID:22574217
Usp10	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Usp10 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of USP10 mRNA	CTD	PMID:21570461 and PMID:24680724
Usp10	Rat	2,4,6-tribromophenol	decreases expression	ISO	USP10 (Homo sapiens)	6480464	2 more ...	CTD	PMID:31675489
Usp10	Rat	2,4-dinitrotoluene	affects expression	EXP		6480464	2 and 4-dinitrotoluene affects the expression of USP10 mRNA	CTD	PMID:21346803
Usp10	Rat	2,6-dinitrotoluene	affects expression	EXP		6480464	2 and 6-dinitrotoluene affects the expression of USP10 mRNA	CTD	PMID:21346803
Usp10	Rat	3-isobutyl-1-methyl-7H-xanthine	multiple interactions	ISO	USP10 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of USP10 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of USP10 mRNA	CTD	PMID:28628672
Usp10	Rat	4,4'-sulfonyldiphenol	multiple interactions	ISO	USP10 (Homo sapiens)	6480464	[bisphenol S co-treated with Fulvestrant] results in increased methylation of USP10 gene and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of USP10 mRNA	CTD	PMID:28628672 and PMID:31601247
Usp10	Rat	4-amino-2,6-dinitrotoluene	affects expression	EXP		6480464	4-amino-2 and 6-dinitrotoluene affects the expression of USP10 mRNA	CTD	PMID:21346803
Usp10	Rat	aflatoxin B1	decreases methylation	ISO	USP10 (Homo sapiens)	6480464	Aflatoxin B1 results in decreased methylation of USP10 intron	CTD	PMID:30157460
Usp10	Rat	all-trans-retinoic acid	decreases expression	ISO	USP10 (Homo sapiens)	6480464	Tretinoin results in decreased expression of USP10 mRNA	CTD	PMID:33167477
Usp10	Rat	aristolochic acid A	decreases expression	ISO	USP10 (Homo sapiens)	6480464	aristolochic acid I results in decreased expression of USP10 mRNA	CTD	PMID:33212167
Usp10	Rat	arsane	multiple interactions	ISO	USP10 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] which co-treated with Benzo(a)pyrene] results in increased expression of USP10 protein	CTD	PMID:32802178
Usp10	Rat	arsenic atom	multiple interactions	ISO	USP10 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] which co-treated with Benzo(a)pyrene] results in increased expression of USP10 protein	CTD	PMID:32802178
Usp10	Rat	benzatropine	multiple interactions	ISO	USP10 (Homo sapiens)	6480464	[Cuprizone co-treated with Benztropine] results in increased expression of USP10 protein	CTD	PMID:34122009
Usp10	Rat	benzo[a]pyrene	increases expression	ISO	Usp10 (Mus musculus)	6480464	Benzo(a)pyrene results in increased expression of USP10 mRNA	CTD	PMID:22228805
Usp10	Rat	benzo[a]pyrene	multiple interactions	ISO	USP10 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] which co-treated with Benzo(a)pyrene] results in increased expression of USP10 protein	CTD	PMID:32802178
Usp10	Rat	benzo[a]pyrene	decreases methylation	ISO	USP10 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased methylation of USP10 promoter	CTD	PMID:27901495
Usp10	Rat	benzo[a]pyrene diol epoxide I	decreases expression	ISO	USP10 (Homo sapiens)	6480464	7 more ...	CTD	PMID:19150397
Usp10	Rat	beta-lapachone	increases expression	ISO	USP10 (Homo sapiens)	6480464	beta-lapachone results in increased expression of USP10 mRNA	CTD	PMID:38218311
Usp10	Rat	bis(2-ethylhexyl) phthalate	increases expression	ISO	Usp10 (Mus musculus)	6480464	Diethylhexyl Phthalate results in increased expression of USP10 mRNA	CTD	PMID:34319233
Usp10	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of USP10 mRNA	CTD	PMID:25181051 more ...
Usp10	Rat	bisphenol A	decreases expression	ISO	USP10 (Homo sapiens)	6480464	bisphenol A results in decreased expression of USP10 protein	CTD	PMID:37567409
Usp10	Rat	bisphenol A	multiple interactions	ISO	USP10 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of USP10 mRNA	CTD	PMID:28628672
Usp10	Rat	cadmium dichloride	affects localization	ISO	USP10 (Homo sapiens)	6480464	Cadmium Chloride affects the localization of USP10 protein	CTD	PMID:18261755
Usp10	Rat	caffeine	affects phosphorylation	ISO	USP10 (Homo sapiens)	6480464	Caffeine affects the phosphorylation of USP10 protein	CTD	PMID:35688186
Usp10	Rat	CGP 52608	multiple interactions	ISO	USP10 (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to USP10 gene]	CTD	PMID:28238834
Usp10	Rat	chlorpyrifos	increases expression	ISO	Usp10 (Mus musculus)	6480464	Chlorpyrifos results in increased expression of USP10 mRNA	CTD	PMID:37019170
Usp10	Rat	choline	multiple interactions	ISO	Usp10 (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of USP10 gene	CTD	PMID:20938992
Usp10	Rat	cobalt dichloride	decreases expression	ISO	USP10 (Homo sapiens)	6480464	cobaltous chloride results in decreased expression of USP10 mRNA	CTD	PMID:19376846
Usp10	Rat	Cuprizon	multiple interactions	ISO	USP10 (Homo sapiens)	6480464	[Cuprizone co-treated with Benztropine] results in increased expression of USP10 protein	CTD	PMID:34122009
Usp10	Rat	dexamethasone	multiple interactions	ISO	USP10 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of USP10 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of USP10 mRNA	CTD	PMID:28628672
Usp10	Rat	Dibutyl phosphate	affects expression	ISO	USP10 (Homo sapiens)	6480464	di-n-butylphosphoric acid affects the expression of USP10 mRNA	CTD	PMID:37042841
Usp10	Rat	dicrotophos	increases expression	ISO	USP10 (Homo sapiens)	6480464	dicrotophos results in increased expression of USP10 mRNA	CTD	PMID:28302478
Usp10	Rat	endosulfan	increases expression	EXP		6480464	Endosulfan results in increased expression of USP10 mRNA	CTD	PMID:29391264
Usp10	Rat	enzyme inhibitor	multiple interactions	ISO	USP10 (Homo sapiens)	6480464	[Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of USP10 protein	CTD	PMID:23301498
Usp10	Rat	fenofibrate	increases expression	ISO	Usp10 (Mus musculus)	6480464	Fenofibrate results in increased expression of USP10 mRNA	CTD	PMID:21318169
Usp10	Rat	fenofibrate	multiple interactions	ISO	Usp10 (Mus musculus)	6480464	PPARA protein affects the reaction [Fenofibrate results in increased expression of USP10 mRNA]	CTD	PMID:21318169
Usp10	Rat	flutamide	increases expression	EXP		6480464	Flutamide results in increased expression of USP10 mRNA	CTD	PMID:24136188
Usp10	Rat	folic acid	multiple interactions	ISO	Usp10 (Mus musculus)	6480464	[1 more ...	CTD	PMID:20938992 and PMID:22206623
Usp10	Rat	FR900359	affects phosphorylation	ISO	USP10 (Homo sapiens)	6480464	FR900359 affects the phosphorylation of USP10 protein	CTD	PMID:37730182
Usp10	Rat	fulvestrant	multiple interactions	ISO	USP10 (Homo sapiens)	6480464	[bisphenol S co-treated with Fulvestrant] results in increased methylation of USP10 gene	CTD	PMID:31601247
Usp10	Rat	furan	increases methylation	EXP		6480464	furan results in increased methylation of USP10 gene	CTD	PMID:22079235
Usp10	Rat	geldanamycin	increases expression	ISO	USP10 (Homo sapiens)	6480464	geldanamycin results in increased expression of USP10 mRNA	CTD	PMID:26705709
Usp10	Rat	hydrogen peroxide	multiple interactions	ISO	Usp10 (Mus musculus)	158013773	melatonin inhibits the reaction [hydrogen peroxide increases expression of Usp10 protein in C-kit+ cardiac progenitor cells]	RGD
Usp10	Rat	hydrogen peroxide	increases expression	ISO	Usp10 (Mus musculus)	158013773	hydrogen peroxide increases expression of Usp10 protein in C-kit+ cardiac progenitor cells	RGD
Usp10	Rat	indometacin	multiple interactions	ISO	USP10 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of USP10 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of USP10 mRNA	CTD	PMID:28628672
Usp10	Rat	ivermectin	decreases expression	ISO	USP10 (Homo sapiens)	6480464	Ivermectin results in decreased expression of USP10 protein	CTD	PMID:32959892
Usp10	Rat	L-methionine	multiple interactions	ISO	Usp10 (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of USP10 gene	CTD	PMID:20938992
Usp10	Rat	lead(0)	affects splicing	ISO	USP10 (Homo sapiens)	6480464	Lead affects the splicing of USP10 mRNA	CTD	PMID:28903495
Usp10	Rat	luzindole	multiple interactions	ISO	Usp10 (Mus musculus)	158013773	luzindole inhibits the reaction [melatonin inhibits the reaction [hydrogen peroxide increases expression of Usp10 protein in C-kit+ cardiac progenitor cells]]	RGD
Usp10	Rat	menadione	affects expression	ISO	USP10 (Homo sapiens)	6480464	Vitamin K 3 affects the expression of USP10 mRNA	CTD	PMID:20044591
Usp10	Rat	methoxychlor	affects methylation	EXP		6480464	Methoxychlor affects the methylation of USP10 gene	CTD	PMID:35440735
Usp10	Rat	nefazodone	increases expression	EXP		6480464	nefazodone results in increased expression of USP10 mRNA	CTD	PMID:24136188
Usp10	Rat	nimesulide	increases expression	EXP		6480464	nimesulide results in increased expression of USP10 mRNA	CTD	PMID:24136188
Usp10	Rat	oxaliplatin	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of USP10 mRNA	CTD	PMID:25729387
Usp10	Rat	paracetamol	affects expression	ISO	Usp10 (Mus musculus)	6480464	Acetaminophen affects the expression of USP10 mRNA	CTD	PMID:17562736
Usp10	Rat	pentachlorophenol	increases expression	ISO	Usp10 (Mus musculus)	6480464	Pentachlorophenol results in increased expression of USP10 mRNA	CTD	PMID:23892564
Usp10	Rat	perfluorooctanoic acid	increases expression	ISO	Usp10 (Mus musculus)	6480464	perfluorooctanoic acid results in increased expression of USP10 protein	CTD	PMID:36214631 and PMID:37422089
Usp10	Rat	pirinixic acid	multiple interactions	ISO	Usp10 (Mus musculus)	6480464	[pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of USP10 mRNA and PPARA protein affects the reaction [pirinixic acid results in increased expression of USP10 mRNA]	CTD	PMID:19710929 and PMID:21318169
Usp10	Rat	pirinixic acid	increases expression	ISO	Usp10 (Mus musculus)	6480464	pirinixic acid results in increased expression of USP10 mRNA	CTD	PMID:18301758 more ...
Usp10	Rat	pirinixic acid	decreases expression	ISO	Usp10 (Mus musculus)	6480464	pirinixic acid results in decreased expression of USP10 mRNA	CTD	PMID:18445702
Usp10	Rat	potassium chromate	increases expression	ISO	USP10 (Homo sapiens)	6480464	potassium chromate(VI) results in increased expression of USP10 mRNA	CTD	PMID:22714537
Usp10	Rat	pyrogallol	increases expression	ISO	Usp10 (Mus musculus)	6480464	Pyrogallol results in increased expression of USP10 mRNA	CTD	PMID:20362636
Usp10	Rat	rotenone	decreases expression	EXP		6480464	Rotenone results in decreased expression of USP10 protein	CTD	PMID:35544339
Usp10	Rat	sodium arsenite	multiple interactions	ISO	USP10 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] which co-treated with Benzo(a)pyrene] results in increased expression of USP10 protein more ...	CTD	PMID:30528433 and PMID:32802178
Usp10	Rat	sodium fluoride	increases expression	ISO	Usp10 (Mus musculus)	6480464	Sodium Fluoride results in increased expression of USP10 mRNA	CTD	PMID:27862939
Usp10	Rat	tamoxifen	affects expression	ISO	Usp10 (Mus musculus)	6480464	Tamoxifen affects the expression of USP10 mRNA	CTD	PMID:17555576
Usp10	Rat	tetrachloromethane	increases expression	EXP		6480464	Carbon Tetrachloride results in increased expression of USP10 mRNA	CTD	PMID:16239168 and PMID:31150632
Usp10	Rat	tetrachloromethane	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of USP10 mRNA]	CTD	PMID:31150632
Usp10	Rat	thimerosal	decreases expression	ISO	USP10 (Homo sapiens)	6480464	Thimerosal results in decreased expression of USP10 mRNA	CTD	PMID:27188386
Usp10	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of USP10 mRNA	CTD	PMID:23411599 and PMID:34492290
Usp10	Rat	thiram	decreases expression	ISO	USP10 (Homo sapiens)	6480464	Thiram results in decreased expression of USP10 mRNA	CTD	PMID:38568856
Usp10	Rat	titanium dioxide	increases methylation	ISO	Usp10 (Mus musculus)	6480464	titanium dioxide results in increased methylation of USP10 gene	CTD	PMID:35295148
Usp10	Rat	topotecan	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of USP10 mRNA	CTD	PMID:25729387
Usp10	Rat	triphenyl phosphate	affects expression	ISO	USP10 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of USP10 mRNA	CTD	PMID:37042841
Usp10	Rat	triptonide	decreases expression	ISO	Usp10 (Mus musculus)	6480464	triptonide results in decreased expression of USP10 mRNA	CTD	PMID:33045310
Usp10	Rat	vinclozolin	decreases expression	EXP		6480464	vinclozolin results in decreased expression of USP10 mRNA	CTD	PMID:23034163
Usp10	Rat	vorinostat	decreases expression	ISO	USP10 (Homo sapiens)	6480464	vorinostat results in decreased expression of USP10 mRNA	CTD	PMID:27188386

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Usp10	Rat	autophagy	involved_in	IEA	UniProtKB-KW:KW-0072	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Usp10	Rat	cellular response to interleukin-1	involved_in	ISS	UniProtKB:Q14694	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Usp10	Rat	cellular response to interleukin-1	involved_in	ISO	USP10 (Homo sapiens)	1624291	PMID:25861989	RGD	PMID:25861989
Usp10	Rat	cellular response to interleukin-1	involved_in	IEA	UniProtKB:Q14694 and ensembl:ENSP00000219473	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Usp10	Rat	DNA damage response	involved_in	ISS	UniProtKB:Q14694	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Usp10	Rat	DNA damage response	involved_in	IEA	UniProtKB:Q14694 and ensembl:ENSP00000219473	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Usp10	Rat	DNA damage response	involved_in	IEA	UniProtKB-KW:KW-0227	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Usp10	Rat	DNA damage response	involved_in	ISO	USP10 (Homo sapiens)	1624291	PMID:25861989	RGD	PMID:25861989
Usp10	Rat	DNA damage response, signal transduction by p53 class mediator	involved_in	ISS	UniProtKB:Q14694	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Usp10	Rat	DNA damage response, signal transduction by p53 class mediator	involved_in	IBA	PANTHER:PTN002551655 and UniProtKB:Q14694	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Usp10	Rat	DNA damage response, signal transduction by p53 class mediator	involved_in	ISO	USP10 (Homo sapiens)	1624291	PMID:20096447	RGD	PMID:20096447
Usp10	Rat	DNA damage response, signal transduction by p53 class mediator	involved_in	IEA	UniProtKB:Q14694 and ensembl:ENSP00000219473	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Usp10	Rat	DNA repair	involved_in	IEA	UniProtKB-KW:KW-0234	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Usp10	Rat	monoubiquitinated protein deubiquitination	involved_in	IEA	UniProtKB:Q14694 and ensembl:ENSP00000219473	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Usp10	Rat	monoubiquitinated protein deubiquitination	involved_in	ISO	USP10 (Homo sapiens)	1624291	PMID:34348161 and PMID:34469731	RGD	PMID:34348161 and PMID:34469731
Usp10	Rat	negative regulation of canonical NF-kappaB signal transduction	involved_in	ISS	UniProtKB:Q14694	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Usp10	Rat	negative regulation of canonical NF-kappaB signal transduction	involved_in	ISO	USP10 (Homo sapiens)	1624291	PMID:25861989	RGD	PMID:25861989
Usp10	Rat	negative regulation of canonical NF-kappaB signal transduction	involved_in	IEA	UniProtKB:Q14694 and ensembl:ENSP00000219473	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Usp10	Rat	negative regulation of stress granule assembly	involved_in	IEA	UniProtKB:Q14694 and ensembl:ENSP00000219473	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Usp10	Rat	negative regulation of stress granule assembly	involved_in	ISS	UniProtKB:Q14694	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Usp10	Rat	negative regulation of stress granule assembly	involved_in	ISO	USP10 (Homo sapiens)	1624291	PMID:27022092 and PMID:32302570	RGD	PMID:27022092 and PMID:32302570
Usp10	Rat	protein deubiquitination	involved_in	ISS	UniProtKB:Q14694	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Usp10	Rat	protein deubiquitination	involved_in	IEA	UniProtKB:Q14694 and ensembl:ENSP00000219473	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Usp10	Rat	protein deubiquitination	involved_in	IEA	InterPro:IPR001394	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Usp10	Rat	protein deubiquitination	involved_in	ISO	USP10 (Homo sapiens)	1624291	PMID:19398555 more ...	RGD	PMID:19398555 more ...
Usp10	Rat	proteolysis	involved_in	IEA	UniProtKB-KW:KW-0645	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Usp10	Rat	regulation of autophagy	involved_in	ISS	UniProtKB:Q14694	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Usp10	Rat	regulation of autophagy	involved_in	IBA	PANTHER:PTN002551655 and UniProtKB:Q14694	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Usp10	Rat	regulation of autophagy	involved_in	ISO	USP10 (Homo sapiens)	1624291	PMID:21962518	RGD	PMID:21962518
Usp10	Rat	regulation of autophagy	involved_in	IEA	UniProtKB:Q14694 and ensembl:ENSP00000219473	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Usp10	Rat	regulation of protein stability	involved_in	IBA	FB:FBgn0016756 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Usp10	Rat	rescue of stalled ribosome	involved_in	IEA	UniProtKB:Q14694 and ensembl:ENSP00000219473	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Usp10	Rat	rescue of stalled ribosome	involved_in	ISS	UniProtKB:Q14694	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Usp10	Rat	rescue of stalled ribosome	involved_in	ISO	USP10 (Homo sapiens)	1624291	PMID:31981475 more ...	RGD	PMID:31981475 more ...

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Usp10	Rat	cytoplasm	located_in	ISO	USP10 (Homo sapiens)	1624291	PMID:20096447	RGD	PMID:20096447
Usp10	Rat	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Usp10	Rat	cytoplasm	located_in	IEA	UniProtKB:Q14694 and ensembl:ENSP00000219473	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Usp10	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Usp10	Rat	cytoplasm	located_in	ISS	UniProtKB:Q14694	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Usp10	Rat	cytosol	located_in	ISO	USP10 (Homo sapiens) more ...	1624291		RGD	GO_REF:0000052
Usp10	Rat	cytosol	located_in	IEA	UniProtKB:Q14694 and ensembl:ENSP00000219473	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Usp10	Rat	cytosol	is_active_in	IBA	FB:FBgn0016756 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Usp10	Rat	cytosolic ribosome	is_active_in	ISO	USP10 (Homo sapiens)	1624291	PMID:34348161 and PMID:34469731	RGD	PMID:34348161 and PMID:34469731
Usp10	Rat	cytosolic ribosome	is_active_in	IEA	UniProtKB:Q14694 and ensembl:ENSP00000219473	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Usp10	Rat	early endosome	located_in	ISO	USP10 (Homo sapiens)	1624291	PMID:19398555	RGD	PMID:19398555
Usp10	Rat	early endosome	located_in	IEA	UniProtKB-SubCell:SL-0094	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Usp10	Rat	early endosome	is_active_in	IBA	PANTHER:PTN000608145 and UniProtKB:Q14694	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Usp10	Rat	early endosome	located_in	IEA	UniProtKB:Q14694 and ensembl:ENSP00000219473	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Usp10	Rat	early endosome	located_in	ISS	UniProtKB:Q14694	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Usp10	Rat	endosome	located_in	IEA	UniProtKB-KW:KW-0967	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Usp10	Rat	intermediate filament cytoskeleton	located_in	IEA	UniProtKB:Q14694 and ensembl:ENSP00000219473	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Usp10	Rat	intermediate filament cytoskeleton	located_in	ISO	USP10 (Homo sapiens) more ...	1624291		RGD	GO_REF:0000052
Usp10	Rat	nucleoplasm	located_in	IEA	UniProtKB:Q14694 and ensembl:ENSP00000219473	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Usp10	Rat	nucleoplasm	located_in	ISO	USP10 (Homo sapiens) more ...	1624291		RGD	GO_REF:0000052
Usp10	Rat	nucleus	located_in	ISO	USP10 (Homo sapiens)	1624291	PMID:20096447 and PMID:24845384	RGD	PMID:20096447 and PMID:24845384
Usp10	Rat	nucleus	located_in	IEA	UniProtKB:Q14694 and ensembl:ENSP00000219473	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Usp10	Rat	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Usp10	Rat	nucleus	is_active_in	IBA	FB:FBgn0016756 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Usp10	Rat	nucleus	located_in	ISS	UniProtKB:Q14694	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Usp10	Rat	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Usp10	Rat	protein-containing complex	part_of	ISS	UniProtKB:Q14694	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Usp10	Rat	protein-containing complex	part_of	ISO	USP10 (Homo sapiens)	1624291	PMID:25861989	RGD	PMID:25861989
Usp10	Rat	protein-containing complex	part_of	IEA	UniProtKB:Q14694 and ensembl:ENSP00000219473	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Usp10	Rat	cysteine-type deubiquitinase activity	enables	ISS	UniProtKB:Q14694	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Usp10	Rat	cysteine-type deubiquitinase activity	enables	IEA	EC:3.4.19.12	1600115	GO_REF:0000003	UniProt	GO_REF:0000003
Usp10	Rat	cysteine-type deubiquitinase activity	enables	IEA	InterPro:IPR001394 and InterPro:IPR018200	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Usp10	Rat	cysteine-type deubiquitinase activity	enables	ISO	USP10 (Homo sapiens)	1624291	PMID:19398555 more ...	RGD	PMID:19398555 more ...
Usp10	Rat	cysteine-type deubiquitinase activity	enables	IBA	FB:FBgn0005632 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Usp10	Rat	cysteine-type deubiquitinase activity	enables	IEA	UniRule:UR000880756	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Usp10	Rat	cysteine-type deubiquitinase activity	enables	IEA	UniProtKB:Q14694 and ensembl:ENSP00000219473	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Usp10	Rat	cysteine-type endopeptidase activity	enables	ISS	UniProtKB:Q14694	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Usp10	Rat	cysteine-type endopeptidase activity	enables	ISO	USP10 (Homo sapiens)	1624291	PMID:21962518	RGD	PMID:21962518
Usp10	Rat	cysteine-type endopeptidase activity	enables	IEA	UniProtKB:Q14694 and ensembl:ENSP00000219473	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Usp10	Rat	cysteine-type peptidase activity	enables	IEA	UniProtKB-KW:KW-0788	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Usp10	Rat	hydrolase activity	enables	IEA	UniProtKB-KW:KW-0378	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Usp10	Rat	molecular function inhibitor activity	enables	IEA	UniProtKB:Q14694 and ensembl:ENSP00000219473	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Usp10	Rat	molecular function inhibitor activity	enables	ISO	USP10 (Homo sapiens)	1624291	PMID:27022092 and PMID:32302570	RGD	PMID:27022092 and PMID:32302570
Usp10	Rat	p53 binding	enables	ISS	UniProtKB:Q14694	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Usp10	Rat	p53 binding	enables	ISO	USP10 (Homo sapiens)	1624291	UniProtKB:P04637 and PMID:20096447	RGD	PMID:20096447
Usp10	Rat	p53 binding	enables	IEA	UniProtKB:Q14694 and ensembl:ENSP00000219473	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Usp10	Rat	peptidase activity	enables	IEA	UniProtKB-KW:KW-0645	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Usp10	Rat	protein binding	enables	ISO	Usp10 (Mus musculus)	1624291	UniProtKB:P10637 and PMID:35987808	RGD	PMID:35987808
Usp10	Rat	protein binding	enables	ISO	USP10 (Homo sapiens)	1624291	UniProtKB:P13569 more ...	RGD	PMID:19398555 more ...
Usp10	Rat	transmembrane transporter binding	enables	ISS	UniProtKB:Q14694	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Usp10	Rat	transmembrane transporter binding	enables	ISO	USP10 (Homo sapiens)	1624291	PMID:19398555	RGD	PMID:19398555
Usp10	Rat	transmembrane transporter binding	enables	IEA	UniProtKB:Q14694 and ensembl:ENSP00000219473	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

#	Reference Title	Reference Citation
1.	Long noncoding RNA H19 mediates melatonin inhibition of premature senescence of c-kit(+) cardiac progenitor cells by promoting miR-675.	Cai B, etal., J Pineal Res. 2016 Aug;61(1):82-95. doi: 10.1111/jpi.12331. Epub 2016 Apr 29.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

PMID:19398555	PMID:20096447	PMID:21962518	PMID:22658674	PMID:22681889	PMID:24845384	PMID:25861989	PMID:35987808

Usp10
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	64,881,255 - 64,923,522 (+)	NCBI		GRCr8
mRatBN7.2	19	47,972,858 - 48,014,900 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	47,972,611 - 48,014,897 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	54,767,502 - 54,809,229 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	55,448,244 - 55,489,969 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	57,661,267 - 57,703,079 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	52,566,274 - 52,608,820 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	52,566,607 - 52,608,817 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	63,313,910 - 63,356,424 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	50,202,951 - 50,244,677 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	19	47,229,671 - 47,271,396 (+)	NCBI		Celera
Cytogenetic Map	19	q12	NCBI

USP10
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	84,700,000 - 84,779,922 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	84,699,986 - 84,779,922 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	16	84,733,606 - 84,813,528 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	83,291,056 - 83,371,029 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	16	83,291,084 - 83,370,670	NCBI
Celera	16	69,035,743 - 69,115,795 (+)	NCBI		Celera
Cytogenetic Map	16	q24.1	NCBI
HuRef	16	70,486,450 - 70,566,405 (+)	NCBI		HuRef
CHM1_1	16	86,145,099 - 86,225,097 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	16	90,766,262 - 90,846,179 (+)	NCBI		T2T-CHM13v2.0

Usp10
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	120,637,099 - 120,684,299 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	120,637,099 - 120,684,299 (+)	Ensembl		GRCm39 Ensembl
GRCm38	8	119,910,360 - 119,957,560 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	119,910,360 - 119,957,560 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	122,434,752 - 122,481,457 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	122,796,829 - 122,843,534 (+)	NCBI		MGSCv36	mm8
Celera	8	124,131,245 - 124,177,988 (+)	NCBI		Celera
Cytogenetic Map	8	E1	NCBI
cM Map	8	68.61	NCBI

Usp10
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955541	242,091 - 296,059 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955541	242,182 - 296,018 (+)	NCBI	ChiLan1.0	ChiLan1.0

USP10
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	18	94,449,698 - 94,529,802 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	16	100,366,823 - 100,446,915 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	16	65,367,463 - 65,447,549 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	16	84,719,540 - 84,787,714 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	84,712,913 - 84,787,714 (+)	Ensembl	panpan1.1		panPan2

USP10
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	67,736,215 - 67,774,756 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	67,736,730 - 67,809,206 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	67,750,854 - 67,823,397 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	67,968,955 - 68,042,190 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	67,968,955 - 68,042,589 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	67,984,393 - 68,056,880 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	67,819,079 - 67,892,003 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	68,234,061 - 68,306,639 (-)	NCBI		UU_Cfam_GSD_1.0

Usp10
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	27,554,574 - 27,618,345 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936641	3,307,931 - 3,350,517 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936641	3,308,121 - 3,350,476 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

USP10
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	3,977,231 - 4,043,533 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	3,977,235 - 4,043,539 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	4,473,366 - 4,491,966 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

USP10
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	70,105,653 - 70,186,512 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	70,139,470 - 70,185,884 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666047	5,563,590 - 5,644,539 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Usp10
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624746	1,554,023 - 1,617,308 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624746	1,553,891 - 1,616,711 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Usp10
127 total Variants

Assembly: RGSC_v3.4

Chromosome	Start Pos	End Pos	Reference Nucleotide	Variant Nucleotide	Variant Type	Strain	Variant Page
19	50203043	50203044	C	T	snv	SS/JrHsdMcwi (MCW)	View more Information

Predicted Target Of

	Summary Value
Count of predictions:	78
Count of miRNA genes:	60
Interacting mature miRNAs:	71
Transcripts:	ENSRNOT00000022432
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578764	Stresp19	Stress response QTL 19	3.6	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	19	15630201	57337602	Rat
61350	Bp32	Blood pressure QTL 32		0.012	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	19	20483575	57337602	Rat
5135224	Leukc1	Leukocyte quantity QTL 1			eosinophil quantity (VT:0002602)	blood eosinophil count (CMO:0000033)	19	44340214	55283277	Rat
724546	Kidm3	Kidney mass QTL 3	3.1		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	19	29322490	57337602	Rat
2317848	Alcrsp21	Alcohol response QTL 21	1.899999976158142	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	19	3204777	48204777	Rat
7411549	Bw130	Body weight QTL 130	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	15455860	57337602	Rat
1358200	Insglur2	Insulin/glucose ratio QTL 2	4.1		blood glucose amount (VT:0000188)	serum glucose level (CMO:0000543)	19	33838214	55283146	Rat
724566	Uae12	Urinary albumin excretion QTL 12	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	2187927	56457239	Rat
1331737	Uae29	Urinary albumin excretion QTL 29	5.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	4096155	55283277	Rat
2298478	Eau8	Experimental allergic uveoretinitis QTL 8		0.0163	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	19	17154433	57337602	Rat

BI288552

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	48,002,896 - 48,003,067 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	52,596,492 - 52,596,662	NCBI	Rnor6.0
Rnor_5.0	19	63,344,096 - 63,344,266	UniSTS	Rnor5.0
RGSC_v3.4	19	50,232,674 - 50,232,844	UniSTS	RGSC3.4
Celera	19	47,259,393 - 47,259,563	UniSTS
RH 3.4 Map	19	647.2	UniSTS
Cytogenetic Map	19	q12	UniSTS

RH129100

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	47,999,157 - 47,999,339 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	52,592,753 - 52,592,934	NCBI	Rnor6.0
Rnor_5.0	19	63,340,357 - 63,340,538	UniSTS	Rnor5.0
RGSC_v3.4	19	50,228,935 - 50,229,116	UniSTS	RGSC3.4
Celera	19	47,255,654 - 47,255,835	UniSTS
RH 3.4 Map	19	635.1	UniSTS
Cytogenetic Map	19	q12	UniSTS

RH130276

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	2,128,850 - 2,129,056 (-)	MAPPER	mRatBN7.2
mRatBN7.2	19	48,014,655 - 48,014,871 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	52,608,576 - 52,608,791	NCBI	Rnor6.0
Rnor_5.0	19	63,356,180 - 63,356,395	UniSTS	Rnor5.0
RGSC_v3.4	19	50,244,433 - 50,244,648	UniSTS	RGSC3.4
Celera	19	47,271,152 - 47,271,367	UniSTS
RH 3.4 Map	19	657.2	UniSTS
Cytogenetic Map	19	q12	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001034146	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001434519	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001434520	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008772609	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008772610	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC136183	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC105892	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473972	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000019	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000022432 ⟹ ENSRNOP00000022432

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	47,990,018 - 48,014,897 (+)	Ensembl
Rnor_6.0 Ensembl	19	52,566,607 - 52,608,817 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000113547 ⟹ ENSRNOP00000079829

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	47,972,611 - 48,014,897 (+)	Ensembl

RefSeq Acc Id:

NM_001034146 ⟹ NP_001029318

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	64,881,797 - 64,923,522 (+)	NCBI
mRatBN7.2	19	47,973,174 - 48,014,900 (+)	NCBI
Rnor_6.0	19	52,566,607 - 52,608,820 (+)	NCBI
Rnor_5.0	19	63,313,910 - 63,356,424 (+)	NCBI
RGSC_v3.4	19	50,202,951 - 50,244,677 (+)	RGD
Celera	19	47,229,671 - 47,271,396 (+)	RGD

Sequence:

show sequence

GTGTCTGTGCGGCGAGAAGATGGCGGCGACGGGGGACGCGGCGTGAAAAGCCGGAGGAGCTCCGAACCTCATTGAGACGGGCCGCCATGGCCCTCCACAACCCACAGTATATTTTTGGCGATTTCAGC
CCTGATGAATTCAATCAGTTTTTTGTGACTCCCCGCTCTTCAGTCGAGCTCCCTCCATACAGTGGGACTCAGTGTGGCATTCAGGCTGAAGAGGAACTTCTGGACGGACAAGAACATCAGAGGATTGA
GTTTGGTGTAGACGAAGTCATCGAACCCAGTGATGGTCTGCAGAGAGCCCCTAGCTACAGTATTTCAAGCACCTTGAACCCTCAGGCACCTGAATTTATCCTTGGTTGTCCAACTTCCAAGAAGACCC
CTGATGACATAGAAAAAGACGAGACCTACAGCTCCATTGATCAGTACCCGGCCTCAGCCTTGGCTCTGGAAAGCAGCTCTAACGCAGAGGCCGAGACCTTGGAGAATGACAGTGGCGCTGGTGGTCTT
GGTCAGAGGGAGCGGAAGAAGAAGAAGAAGCGGCCCCCTGGGTACTACAGTTATCTGAAAGATGGTAGTGAAGAGGGTGCTTCCCCGGCCGCCCTTGTCAACGGCCATGCCACGTCAGTGGGCACGAA
CAGCGAGGGTGTGGAGGATCCTGAGTTCATGGTGGACATGCTTCCTTCAGTCATGCCCAGGACTTGTGACAGCCCTCAGAACCCCATGGACTTAATCAGTGACCCTGTCCCTGATAGTCCTTTCCCCA
GGACACTAGGTGGTGATGCCAGGACTGCAGGACTGCCTGAGGGCTGCCGTGAAACTGACTTTGAGCAGCCCTGCCTCCCTACAGACAACCTGCTAAGGACAGCTGTGACGCAGCCCAACGCTGGCGCC
GACACTACTGAGAACCTCGCAGTTGCTAATGGAAAAATACTTGAATCCTTGGGCGAGGGCACTGCTGCTGCCAATGGGGTAGAGCTGCACACTGATGAGAGTGCAGACTTGGACCCTGCGAAGCCTGA
GAGCCAGTCACCTCCTGCCGAAAGTGCGCTCTCTGTCTCTGGCGCCATTTCCATTAGCCAACCTGCAAAGTCCTGGGCTAGCCTCTTTCATGATTCTAAGCCTTCTTCCTCCTCACCCGTGGCGTATG
TGGAAACTAAGTGTTCCCCCCCTGTCCCGTCCCCCCTGGCCTCTGAAAAACAGATGGAAGTCAAAGAAGGGCTTGTTCCCGTGTCAGAGGACCCCGTAGCCATAAAGATTGCAGAGTTATTGGAGACT
GTAACCCTAGTACATAAGCCAGTGTCATTGCAACCCCGTGGGCTGATCAATAAAGGAAACTGGTGCTACATTAATGCCACCCTGCAGGCATTGGTGGCTTGCCCTCCGATGTATCACCTGATGAAGTT
CATTCCTCTGTACTCAAAAGTGCAAAGGCCGTGCACGTCCACGCCCATGATAGATAGCTTTGTTCGGCTCATGAACGAGTTTACTAATATGCCAGTACCTCCCAAACCCCGCCAAGCTCTTGGGGATA
AAATCGTGAGAGATATCCGCCCAGGAGCTGCCTTTGAACCCACATACATTTATCGACTCCTGACAGTCATCAAGTCGAGCCTGTCTGAAAAGGGCCGACAGGAGGACGCCGAGGAGTACCTAGGCTTC
ATCCTCAATGGACTCCACGAGGAGATGCTGAGCCTGAAGAAGCTTCTCTCACCCACGCACGAAAAGCACTCTGTTTCTAATGGGCCCGGAAGCCACTTGATAGAGGATGAGGAGCTGGAAGACACAGG
CGAGGGCAGTGAGGACGAGTGGGAGCAAGTGGGTCCCAAGAACAAGACGTCTGTCACCCGGCAGGCGGATTTCGTTCAGACGCCTATCACTGGCATTTTCGGTGGACACATCAGGTCTGTGGTTTACC
AGCAGAGTTCCAAAGAATCTGCCACGCTGCAGCCATTTTTCACACTGCAGTTGGACATCCAGTCCGACAAGATTCGCACAGTCCAGGATGCCTTGGAAAGCTTGGTGGCAAGAGAGTCTGTCCAGGGC
TACACCACCAAGACCAAGCAGGAGGTTGAAGTCAGCCGTAGAGTGACTCTGGAGAAGCTTCCCCCTGTCCTTGTGCTCCACCTGAAGCGCTTCGTCTATGAGAAGACGGGCGGATGCCAGAAGCTCGT
CAAGAACATCGAGTACCCTGTGGACTTGGAGATCAGCAGAGAACTGCTTTCTCCAGGCGTCAAAAATAAAAACTTTAAATGCCACAGAACCTATAGGCTGTTCGCAGTGGTCTACCATCATGGCAACA
GTGCTACAGGTGGCCACTACACCACGGACGTCTTCCAGATTGGGCTTAACGGCTGGCTGCGAATTGATGACCAGACGGTCAAGGTTATCAACCAGTACCAGGTGGTGAGACCAAGTGCTGACCGCACC
GCCTACCTCCTGTATTACCGCCGTGTGGACCTGCTGTAGCTCTGCCCGTGTGTCCGACGCTGTCTCCCATATCTCCCAGCTCACTAACCGCCCGCCTCTCCAGTGGCTCTGTGGAGAGAGGCTCTCCC
TCTGCGCCAGGGGGCTTGGATGGAAGATGTCTGGGGGGTCTGCACAGCGCAGCTCATGCTGACTCTGACTTCAGACTGGACTGTGGCTTGAGTGAGGAGACACACACGAGCCGCCGCTTCTGAAGAGC
CGCTGGTTCCTGAGCCCCTGGGGAGGTGGCTCGCACTGGGTCCCAGTTTGATGCGTAGTGGAATAAGTCCCGCACCAGCAGCTCTTGTAAATTTGTGAAAATGAATTTTATCTTTCCTTAAAAAAATA
ATTTTTTTAATTCATCACACTTTCTTCCTTTACCCTTTAGTTTTTGATAAATGACAAAAATGAGCCAGTTATCAGAGATGAGATAGCTCTTACTTCAAAAGGAGATAAATATAAAAAAAAATATGTTG
CTGGTTCCTAACAGGAAACGAATTTTAAATGATTGCAAGAGGGAAACTGCTGACATAGACATCGCGGGTCAGACATGTGGGTAGACGTCAGGCTGCAGAGGTGGCTGGCGGATTGTAACTTTATCACC
GTGAACAGATTTCAAATCGCATTCATGTTCTGTGTGCACATGAACAGTGGGCAGAGGGACGGACACTTGCCGGTGTCTGCTGTGGAGTCTGCCACACCTCTGATGCCATGTCCCTGTTATACACAGTG
TAGTGCTTCCTCGGAGTATAAAGTTGTCACCCGTCAATAAAGATCACAAAGTTGGTTTAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_008772609 ⟹ XP_008770831

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	64,881,255 - 64,923,522 (+)	NCBI
mRatBN7.2	19	47,972,858 - 48,014,900 (+)	NCBI
Rnor_6.0	19	52,566,274 - 52,608,064 (+)	NCBI

Sequence:

show sequence

GTTAAGAGAATGAAGAGTGAAGGAATGAATGAATGAACGGTCGGAAGAGCGCGCTCCAGAAGGTAAAGGATCCGTGGGGGATCTCCAGTGGCGATCCCAGGGCGGAGCTCAGGCGGGCACTGCGCAGT
TACCACTCCCGGACTCCACCTTGCAGCCCCGGGGTGCGTGGCCAGTTCAATCCTCACGCCCTCACCCGGAGCGGCCAGCCTCCGCGCGTTGTGAGCGGAAGGGTCGCCGGCCCGGGCGCACGCCCACC
TGTCGCGCGCAGGCGCAGAACGTCGCCTGGCTCTCCCGCGGTGCAGTCAGTGCGCAGGCGCGGCGGCCGATGCGAGTGTGTCTGTGCGGCGAGAAGATGGCGGCGACGGGGGACGCGGCGTGAAAAGC
CGGAGGAGCTCCGAACCTCATTGAGACGGGCCGCCATGGCCCTCCACAACCCACAGTATATTTTTGGCGATTTCAGCCCTGATGAATTCAATCAGTTTTTTGTGACTCCCCGCTCTTCAGTCGAGCTC
CCTCCATACAGTGGGACTCAGTGTGGCATTCAGGCTGAAGAGGAACTTCTGGACGCAGGACAAGAACATCAGAGGATTGAGTTTGGTGTAGACGAAGTCATCGAACCCAGTGATGGTCTGCAGAGAGC
CCCTAGCTACAGTATTTCAAGCACCTTGAACCCTCAGGCACCTGAATTTATCCTTGGTTGTCCAACTTCCAAGAAGACCCCTGATGACATAGAAAAAGACGAGACCTACAGCTCCATTGATCAGTACC
CGGCCTCAGCCTTGGCTCTGGAAAGCAGCTCTAACGCAGAGGCCGAGACCTTGGAGAATGACAGTGGCGCTGGTGGTCTTGGTCAGAGGGAGCGGAAGAAGAAGAAGAAGCGGCCCCCTGGGTACTAC
AGTTATCTGAAAGATGGTAGTGAAGAGGGTGCTTCCCCGGCCGCCCTTGTCAACGGCCATGCCACGTCAGTGGGCACGAACAGCGAGGGTGTGGAGGATCCTGAGTTCATGGTGGACATGCTTCCTTC
AGTCATGCCCAGGACTTGTGACAGCCCTCAGAACCCCATGGACTTAATCAGTGACCCTGTCCCTGATAGTCCTTTCCCCAGGACACTAGGTGGTGATGCCAGGACTGCAGGACTGCCTGAGGGCTGCC
GTGAAACTGACTTTGAGCAGCCCTGCCTCCCTACAGACAACCTGCTAAGGACAGCTGTGACGCAGCCCAACGCTGGCGCCGACACTACTGAGAACCTCGCAGTTGCTAATGGAAAAATACTTGAATCC
TTGGGCGAGGGCACTGCTGCTGCCAATGGGGTAGAGCTGCACACTGATGAGAGTGCAGACTTGGACCCTGCGAAGCCTGAGAGCCAGTCACCTCCTGCCGAAAGTGCGCTCTCTGTCTCTGGCGCCAT
TTCCATTAGCCAACCTGCAAAGTCCTGGGCTAGCCTCTTTCATGATTCTAAGCCTTCTTCCTCCTCACCCGTGGCGTATGTGGAAACTAAGTGTTCCCCCCCTGTCCCGTCCCCCCTGGCCTCTGAAA
AACAGATGGAAGTCAAAGAAGGGCTTGTTCCCGTGTCAGAGGACCCCGTAGCCATAAAGATTGCAGAGTTATTGGAGACTGTAACCCTAGTACATAAGCCAGTGTCATTGCAACCCCGTGGGCTGATC
AATAAAGGAAACTGGTGCTACATTAATGCCACCCTGCAGGCATTGGTGGCTTGCCCTCCGATGTATCACCTGATGAAGTTCATTCCTCTGTACTCAAAAGTGCAAAGGCCGTGCACGTCCACGCCCAT
GATAGATAGCTTTGTTCGGCTCATGAACGAGTTTACTAATATGCCAGTACCTCCCAAACCCCGCCAAGCTCTTGGGGATAAAATCGTGAGAGATATCCGCCCAGGAGCTGCCTTTGAACCCACATACA
TTTATCGACTCCTGACAGTCATCAAGTCGAGCCTGTCTGAAAAGGGCCGACAGGAGGACGCCGAGGAGTACCTAGGCTTCATCCTCAATGGACTCCACGAGGAGATGCTGAGCCTGAAGAAGCTTCTC
TCACCCACGCACGAAAAGCACTCTGTTTCTAATGGGCCCGGAAGCCACTTGATAGAGGATGAGGAGCTGGAAGACACAGGCGAGGGCAGTGAGGACGAGTGGGAGCAAGTGGGTCCCAAGAACAAGAC
GTCTGTCACCCGGCAGGCGGATTTCGTTCAGACGCCTATCACTGGCATTTTCGGTGGACACATCAGGTCTGTGGTTTACCAGCAGAGTTCCAAAGAATCTGCCACGCTGCAGCCATTTTTCACACTGC
AGTTGGACATCCAGTCCGACAAGATTCGCACAGTCCAGGATGCCTTGGAAAGCTTGGTGGCAAGAGAGTCTGTCCAGGGCTACACCACCAAGACCAAGCAGGAGGTTGAAGTCAGCCGTAGAGTGACT
CTGGAGAAGCTTCCCCCTGTCCTTGTGCTCCACCTGAAGCGCTTCGTCTATGAGAAGACGGGCGGATGCCAGAAGCTCGTCAAGAACATCGAGTACCCTGTGGACTTGGAGATCAGCAGAGAACTGCT
TTCTCCAGGCGTCAAAAATAAAAACTTTAAATGCCACAGAACCTATAGGCTGTTCGCAGTGGTCTACCATCATGGCAACAGTGCTACAGGTGGCCACTACACCACGGACGTCTTCCAGATTGGGCTTA
ACGGCTGGCTGCGAATTGATGACCAGACGGTCAAGGTTATCAACCAGTACCAGGTGGTGAGACCAAGTGCTGACCGCACCGCCTACCTCCTGTATTACCGCCGTGTGGACCTGCTGTAGCTCTGCCCG
TGTGTCCGACGCTGTCTCCCATATCTCCCAGCTCACTAACCGCCCGCCTCTCCAGTGGCTCTGTGGAGAGAGGCTCTCCCTCTGCGCCAGGGGGCTTGGATGGAAGATGTCTGGGGGGTCTGCACAGC
GCAGCTCATGCTGACTCTGACTTCAGACTGGACTGTGGCTTGAGTGAGGAGACACACACGAGCCGCCGCTTCTGAAGAGCCGCTGGTTCCTGAGCCCCTGGGGAGGTGGCTCGCACTGGGTCCCAGTT
TGATGCGTAGTGGAATAAGTCCCGCACCAGCAGCTCTTGTAAATTTGTGAAAATGAATTTTATCTTTCCTTAAAAAAATAATTTTTTTAATTCA

hide sequence


Protein RefSeqs	NP_001029318	(Get FASTA)	NCBI Sequence Viewer
	NP_001421448	(Get FASTA)	NCBI Sequence Viewer
	NP_001421449	(Get FASTA)	NCBI Sequence Viewer
	XP_008770831	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI05893	(Get FASTA)	NCBI Sequence Viewer
	EDL92690	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000022432
	ENSRNOP00000079829
GenBank Protein	Q3KR59	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001029318 ⟸ NM_001034146

- UniProtKB:

Q3KR59 (UniProtKB/Swiss-Prot), A0A8L2QBF0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MALHNPQYIFGDFSPDEFNQFFVTPRSSVELPPYSGTQCGIQAEEELLDGQEHQRIEFGVDEVIEPSDGLQRAPSYSISSTLNPQAPEFILGCPTSKKTPDDIEKDETYSSIDQYPASALALESSSNA
EAETLENDSGAGGLGQRERKKKKKRPPGYYSYLKDGSEEGASPAALVNGHATSVGTNSEGVEDPEFMVDMLPSVMPRTCDSPQNPMDLISDPVPDSPFPRTLGGDARTAGLPEGCRETDFEQPCLPTD
NLLRTAVTQPNAGADTTENLAVANGKILESLGEGTAAANGVELHTDESADLDPAKPESQSPPAESALSVSGAISISQPAKSWASLFHDSKPSSSSPVAYVETKCSPPVPSPLASEKQMEVKEGLVPVS
EDPVAIKIAELLETVTLVHKPVSLQPRGLINKGNWCYINATLQALVACPPMYHLMKFIPLYSKVQRPCTSTPMIDSFVRLMNEFTNMPVPPKPRQALGDKIVRDIRPGAAFEPTYIYRLLTVIKSSLS
EKGRQEDAEEYLGFILNGLHEEMLSLKKLLSPTHEKHSVSNGPGSHLIEDEELEDTGEGSEDEWEQVGPKNKTSVTRQADFVQTPITGIFGGHIRSVVYQQSSKESATLQPFFTLQLDIQSDKIRTVQ
DALESLVARESVQGYTTKTKQEVEVSRRVTLEKLPPVLVLHLKRFVYEKTGGCQKLVKNIEYPVDLEISRELLSPGVKNKNFKCHRTYRLFAVVYHHGNSATGGHYTTDVFQIGLNGWLRIDDQTVKV
INQYQVVRPSADRTAYLLYYRRVDLL

hide sequence

RefSeq Acc Id:

XP_008770831 ⟸ XM_008772609

- Peptide Label:

isoform X1

- Sequence:

show sequence

MNGRKSALQKVKDPWGISSGDPRAELRRALRSYHSRTPPCSPGVRGQFNPHALTRSGQPPRVVS
GRVAGPGARPPVARRRRTSPGSPAVQSVRRRGGRCECVCAARRWRRRGTRREKPEELRTSLRRAAMALHNPQYIFGDFSPDEFNQFFVTPRSSVELPPYSGTQCGIQAEEELLDAGQEHQRIEFGVDE
VIEPSDGLQRAPSYSISSTLNPQAPEFILGCPTSKKTPDDIEKDETYSSIDQYPASALALESSSNAEAETLENDSGAGGLGQRERKKKKKRPPGYYSYLKDGSEEGASPAALVNGHATSVGTNSEGVE
DPEFMVDMLPSVMPRTCDSPQNPMDLISDPVPDSPFPRTLGGDARTAGLPEGCRETDFEQPCLPTDNLLRTAVTQPNAGADTTENLAVANGKILESLGEGTAAANGVELHTDESADLDPAKPESQSPP
AESALSVSGAISISQPAKSWASLFHDSKPSSSSPVAYVETKCSPPVPSPLASEKQMEVKEGLVPVSEDPVAIKIAELLETVTLVHKPVSLQPRGLINKGNWCYINATLQALVACPPMYHLMKFIPLYS
KVQRPCTSTPMIDSFVRLMNEFTNMPVPPKPRQALGDKIVRDIRPGAAFEPTYIYRLLTVIKSSLSEKGRQEDAEEYLGFILNGLHEEMLSLKKLLSPTHEKHSVSNGPGSHLIEDEELEDTGEGSED
EWEQVGPKNKTSVTRQADFVQTPITGIFGGHIRSVVYQQSSKESATLQPFFTLQLDIQSDKIRTVQDALESLVARESVQGYTTKTKQEVEVSRRVTLEKLPPVLVLHLKRFVYEKTGGCQKLVKNIEY
PVDLEISRELLSPGVKNKNFKCHRTYRLFAVVYHHGNSATGGHYTTDVFQIGLNGWLRIDDQTVKVINQYQVVRPSADRTAYLLYYRRVDLL

hide sequence

Ensembl Acc Id:

ENSRNOP00000022432 ⟸ ENSRNOT00000022432

Ensembl Acc Id:

ENSRNOP00000079829 ⟸ ENSRNOT00000113547

Protein Domains

USP

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q3KR59-F1-model_v2	AlphaFold	Q3KR59	1-794	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13701188

Promoter ID:

EPDNEW_R11709

Type:

initiation region

Name:

Usp10_1

Description:

ubiquitin specific peptidase 10

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	19	52,566,603 - 52,566,663	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-5497	BioCyc
Ensembl Genes	ENSRNOG00000016509	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000022432	ENTREZGENE
	ENSRNOT00000113547	ENTREZGENE
Gene3D-CATH	Cysteine proteinases	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7367339	IMAGE-MGC_LOAD
InterPro	Ataxin-2_C	UniProtKB/Swiss-Prot
	Papain-like_cys_pep_sf	UniProtKB/Swiss-Prot
	Peptidase_C19	UniProtKB/Swiss-Prot
	Peptidase_C19_UCH	UniProtKB/Swiss-Prot
	USP_CS	UniProtKB/Swiss-Prot
	USP_dom	UniProtKB/Swiss-Prot
KEGG Report	rno:307905	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:124997	IMAGE-MGC_LOAD
NCBI Gene	307905	ENTREZGENE
PANTHER	UBIQUITIN CARBOXYL-TERMINAL HYDROLASE	UniProtKB/Swiss-Prot
	UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 10	UniProtKB/Swiss-Prot
Pfam	PAM2	UniProtKB/Swiss-Prot
	UCH	UniProtKB/Swiss-Prot
PhenoGen	Usp10	PhenoGen
PROSITE	USP_1	UniProtKB/Swiss-Prot
	USP_2	UniProtKB/Swiss-Prot
	USP_3	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000016509	RatGTEx
Superfamily-SCOP	SSF54001	UniProtKB/Swiss-Prot
UniProt	A0A8I5ZPC2_RAT	UniProtKB/TrEMBL
	A0A8L2QBF0	ENTREZGENE, UniProtKB/TrEMBL
	A6IZL2	ENTREZGENE, UniProtKB/TrEMBL
	Q3KR59	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-04	Usp10	ubiquitin specific peptidase 10	Usp10	ubiquitin specific protease 10	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-02-09	Usp10	ubiquitin specific protease 10			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar