Symbol:
Uchl3 (Ensembl: Uchl3-ps1)
Name:
ubiquitin C-terminal hydrolase L3 (Ensembl:ubiquitin C-terminal hydrolase L3, pseudogene 1)
RGD ID:
1561196
Description:
Predicted to enable cysteine-type deubiquitinase activity and ubiquitin binding activity. Predicted to be involved in cellular response to insulin stimulus; positive regulation of fat cell differentiation; and protein catabolic process. Predicted to act upstream of or within several processes, including adult walking behavior; eating behavior; and protein deubiquitination. Predicted to be located in Golgi apparatus; cytosol; and nucleoplasm. Predicted to be active in cytoplasm. Orthologous to human UCHL3 (ubiquitin C-terminal hydrolase L3); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene; 4,4'-sulfonyldiphenol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC498560; RGD1561196; similar to ubiqutin carboxyl-terminal hydrolase l3; ubiquitin carboxyl-terminal esterase L3; ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase); ubiquitin carboxyl-terminal hydrolase isozyme L3; ubiquitin thioesterase L3; UCH-L3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Related Pseudogenes:
Uchl3-ps1
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 84,888,847 - 84,942,095 (+) NCBI GRCr8 mRatBN7.2 15 78,485,304 - 78,527,355 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 161,856,958 - 161,857,835 (-) Ensembl mRatBN7.2 Ensembl mRatBN7.2 Ensembl 15 78,485,315 - 78,527,355 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 82,496,066 - 82,538,090 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 83,572,627 - 83,614,651 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 80,493,216 - 80,535,240 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 86,153,624 - 86,198,127 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 86,153,628 - 86,198,127 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 89,919,728 - 89,964,227 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 85,628,490 - 85,670,420 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 15 77,676,770 - 77,718,591 (+) NCBI Celera Cytogenetic Map 15 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Uchl3 Rat (1->4)-beta-D-glucan multiple interactions ISO Uchl3 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of UCHL3 mRNA CTD PMID:36331819 Uchl3 Rat 1,2-dichloroethane decreases expression ISO Uchl3 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of UCHL3 mRNA CTD PMID:28960355 Uchl3 Rat 1H-pyrazole increases expression ISO Uchl3 (Mus musculus) 6480464 pyrazole results in increased expression of UCHL3 mRNA CTD PMID:17945193 Uchl3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Uchl3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of UCHL3 mRNA CTD PMID:21570461 Uchl3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of UCHL3 mRNA CTD PMID:33387578 Uchl3 Rat 2,6-dimethoxyphenol multiple interactions ISO UCHL3 (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Uchl3 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of UCHL3 mRNA CTD PMID:21346803 Uchl3 Rat 2-hydroxypropanoic acid decreases expression ISO UCHL3 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of UCHL3 mRNA CTD PMID:30851411 Uchl3 Rat 4,4'-sulfonyldiphenol increases expression ISO UCHL3 (Homo sapiens) 6480464 bisphenol S results in increased expression of UCHL3 mRNA CTD PMID:27685785 Uchl3 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of UCHL3 mRNA CTD PMID:36041667 Uchl3 Rat 4,4'-sulfonyldiphenol multiple interactions ISO UCHL3 (Homo sapiens) 6480464 [bisphenol S co-treated with Fulvestrant] results in increased methylation of UCHL3 gene CTD PMID:31601247 Uchl3 Rat 4,4'-sulfonyldiphenol decreases expression ISO UCHL3 (Homo sapiens) 6480464 bisphenol S results in decreased expression of UCHL3 protein CTD PMID:33181973 Uchl3 Rat 4,4'-sulfonyldiphenol increases expression ISO Uchl3 (Mus musculus) 6480464 bisphenol S results in increased expression of UCHL3 mRNA CTD PMID:39298647 Uchl3 Rat aflatoxin B1 increases expression ISO UCHL3 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of UCHL3 mRNA CTD PMID:27153756 Uchl3 Rat aldehydo-D-glucose increases secretion ISO UCHL3 (Homo sapiens) 6480464 Glucose deficiency results in increased secretion of UCHL3 protein CTD PMID:24802182 Uchl3 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of UCHL3 mRNA CTD PMID:16483693 Uchl3 Rat arsane multiple interactions ISO Uchl3 (Mus musculus) 6480464 [[lead chloride results in increased abundance of Lead] co-treated with [sodium arsenite results in increased abundance of Arsenic]] results in increased expression of UCHL3 protein and [methylmercuric chloride co-treated with [sodium arsenite results in increased abundance of Arsenic]] results in increased expression of UCHL3 protein CTD PMID:32179164 Uchl3 Rat arsenic atom multiple interactions ISO Uchl3 (Mus musculus) 6480464 [[lead chloride results in increased abundance of Lead] co-treated with [sodium arsenite results in increased abundance of Arsenic]] results in increased expression of UCHL3 protein and [methylmercuric chloride co-treated with [sodium arsenite results in increased abundance of Arsenic]] results in increased expression of UCHL3 protein CTD PMID:32179164 Uchl3 Rat arsenite(3-) decreases expression ISO Uchl3 (Mus musculus) 6480464 arsenite results in decreased expression of UCHL3 mRNA CTD PMID:33053406 Uchl3 Rat arsenous acid increases expression ISO UCHL3 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of UCHL3 protein CTD PMID:25419056 Uchl3 Rat benzatropine decreases expression ISO UCHL3 (Homo sapiens) 6480464 Benztropine results in decreased expression of UCHL3 protein CTD PMID:34122009 Uchl3 Rat beta-lapachone increases expression ISO UCHL3 (Homo sapiens) 6480464 beta-lapachone results in increased expression of UCHL3 mRNA CTD PMID:38218311 Uchl3 Rat bis(2-ethylhexyl) phthalate increases expression ISO Uchl3 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of UCHL3 mRNA CTD PMID:19850644 Uchl3 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Uchl3 (Mus musculus) 6480464 PPARA protein promotes the reaction [Diethylhexyl Phthalate results in increased expression of UCHL3 mRNA] CTD PMID:19850644 Uchl3 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of UCHL3 mRNA CTD PMID:25181051 Uchl3 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of UCHL3 mRNA CTD PMID:36779543 Uchl3 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of UCHL3 mRNA CTD PMID:36041667 Uchl3 Rat bisphenol A affects expression ISO UCHL3 (Homo sapiens) 6480464 bisphenol A affects the expression of UCHL3 mRNA CTD PMID:30903817 Uchl3 Rat bisphenol AF increases expression ISO UCHL3 (Homo sapiens) 6480464 bisphenol AF results in increased expression of UCHL3 protein CTD PMID:34186270 Uchl3 Rat Bisphenol B increases expression ISO UCHL3 (Homo sapiens) 6480464 bisphenol B results in increased expression of UCHL3 protein CTD PMID:34186270 Uchl3 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of UCHL3 mRNA CTD PMID:36041667 Uchl3 Rat cadmium dichloride affects localization ISO UCHL3 (Homo sapiens) 6480464 Cadmium Chloride affects the localization of UCHL3 protein CTD PMID:18261755 Uchl3 Rat cannabidiol multiple interactions ISO UCHL3 (Homo sapiens) 6480464 [Cuprizone co-treated with Cannabidiol] results in decreased expression of UCHL3 protein CTD PMID:34122009 Uchl3 Rat CGP 52608 multiple interactions ISO UCHL3 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to UCHL3 gene] CTD PMID:28238834 Uchl3 Rat chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of UCHL3 mRNA CTD PMID:18668222 Uchl3 Rat cobalt dichloride decreases expression ISO UCHL3 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of UCHL3 mRNA and cobaltous chloride results in decreased expression of UCHL3 protein CTD PMID:16622835 more ... Uchl3 Rat cocaine affects expression EXP 6480464 Cocaine affects the expression of UCHL3 mRNA CTD PMID:20187946 Uchl3 Rat copper(II) sulfate increases expression ISO UCHL3 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of UCHL3 mRNA CTD PMID:19549813 Uchl3 Rat crocidolite asbestos decreases expression ISO Uchl3 (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of UCHL3 mRNA CTD PMID:29279043 Uchl3 Rat Cuprizon multiple interactions ISO UCHL3 (Homo sapiens) 6480464 [Cuprizone co-treated with Cannabidiol] results in decreased expression of UCHL3 protein CTD PMID:34122009 Uchl3 Rat cyclosporin A increases expression ISO UCHL3 (Homo sapiens) 6480464 Cyclosporine results in increased expression of UCHL3 mRNA CTD PMID:20106945 and PMID:25562108 Uchl3 Rat D-glucose increases secretion ISO UCHL3 (Homo sapiens) 6480464 Glucose deficiency results in increased secretion of UCHL3 protein CTD PMID:24802182 Uchl3 Rat DDT increases expression EXP 6480464 DDT results in increased expression of UCHL3 mRNA CTD PMID:30207508 Uchl3 Rat diarsenic trioxide increases expression ISO UCHL3 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of UCHL3 protein CTD PMID:25419056 Uchl3 Rat dibutyl phthalate decreases expression ISO Uchl3 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of UCHL3 mRNA CTD PMID:17361019 Uchl3 Rat dicrotophos decreases expression ISO UCHL3 (Homo sapiens) 6480464 dicrotophos results in decreased expression of UCHL3 mRNA CTD PMID:28302478 Uchl3 Rat diuron increases expression EXP 6480464 Diuron results in increased expression of UCHL3 mRNA CTD PMID:21551480 Uchl3 Rat dorsomorphin multiple interactions ISO UCHL3 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Uchl3 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of UCHL3 mRNA CTD PMID:29391264 Uchl3 Rat ethanol affects expression ISO Uchl3 (Mus musculus) 6480464 Ethanol affects the expression of UCHL3 mRNA CTD PMID:30319688 Uchl3 Rat fenthion increases expression ISO Uchl3 (Mus musculus) 6480464 Fenthion results in increased expression of UCHL3 mRNA CTD PMID:34813904 Uchl3 Rat folic acid decreases expression ISO Uchl3 (Mus musculus) 6480464 Folic Acid results in decreased expression of UCHL3 mRNA CTD PMID:25629700 Uchl3 Rat fulvestrant multiple interactions ISO UCHL3 (Homo sapiens) 6480464 [bisphenol S co-treated with Fulvestrant] results in increased methylation of UCHL3 gene CTD PMID:31601247 Uchl3 Rat furfural multiple interactions ISO UCHL3 (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Uchl3 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of UCHL3 mRNA CTD PMID:22061828 Uchl3 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of UCHL3 mRNA CTD PMID:33387578 Uchl3 Rat glucose increases secretion ISO UCHL3 (Homo sapiens) 6480464 Glucose deficiency results in increased secretion of UCHL3 protein CTD PMID:24802182 Uchl3 Rat graphite affects expression EXP 6480464 Graphite affects the expression of UCHL3 mRNA CTD PMID:29933104 Uchl3 Rat inulin multiple interactions ISO Uchl3 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of UCHL3 mRNA CTD PMID:36331819 Uchl3 Rat ivermectin decreases expression ISO UCHL3 (Homo sapiens) 6480464 Ivermectin results in decreased expression of UCHL3 protein CTD PMID:32959892 Uchl3 Rat lead(0) multiple interactions ISO Uchl3 (Mus musculus) 6480464 [[lead chloride results in increased abundance of Lead] co-treated with [sodium arsenite results in increased abundance of Arsenic]] results in increased expression of UCHL3 protein and [[lead chloride results in increased abundance of Lead] which co-treated with methylmercuric chloride] results in increased expression of UCHL3 protein CTD PMID:32179164 Uchl3 Rat lead(II) chloride multiple interactions ISO Uchl3 (Mus musculus) 6480464 [[lead chloride results in increased abundance of Lead] co-treated with [sodium arsenite results in increased abundance of Arsenic]] results in increased expression of UCHL3 protein and [[lead chloride results in increased abundance of Lead] which co-treated with methylmercuric chloride] results in increased expression of UCHL3 protein CTD PMID:32179164 Uchl3 Rat Mesaconitine decreases expression EXP 6480464 mesaconitine results in decreased expression of UCHL3 protein CTD PMID:37182599 Uchl3 Rat methapyrilene increases expression EXP 6480464 Methapyrilene results in increased expression of UCHL3 protein CTD PMID:30467583 Uchl3 Rat methidathion increases expression ISO Uchl3 (Mus musculus) 6480464 methidathion results in increased expression of UCHL3 mRNA CTD PMID:34813904 Uchl3 Rat methylmercury chloride multiple interactions ISO Uchl3 (Mus musculus) 6480464 [[lead chloride results in increased abundance of Lead] which co-treated with methylmercuric chloride] results in increased expression of UCHL3 protein and [methylmercuric chloride co-treated with [sodium arsenite results in increased abundance of Arsenic]] results in increased expression of UCHL3 protein CTD PMID:32179164 Uchl3 Rat microcystin-LR decreases expression EXP 6480464 cyanoginosin LR results in decreased expression of UCHL3 protein CTD PMID:22430071 Uchl3 Rat N-nitrosodiethylamine decreases expression EXP 6480464 Diethylnitrosamine results in decreased expression of UCHL3 mRNA CTD PMID:20360939 Uchl3 Rat ozone multiple interactions ISO Uchl3 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of UCHL3 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of UCHL3 mRNA CTD PMID:34911549 Uchl3 Rat paracetamol increases expression ISO UCHL3 (Homo sapiens) 6480464 Acetaminophen results in increased expression of UCHL3 mRNA CTD PMID:22230336 Uchl3 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of UCHL3 mRNA CTD PMID:33387578 Uchl3 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Uchl3 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of UCHL3 mRNA and [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of UCHL3 mRNA CTD PMID:36331819 Uchl3 Rat phenobarbital affects expression ISO UCHL3 (Homo sapiens) 6480464 Phenobarbital affects the expression of UCHL3 mRNA CTD PMID:19159669 Uchl3 Rat phenylmercury acetate increases expression ISO UCHL3 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of UCHL3 mRNA CTD PMID:26272509 Uchl3 Rat phenylmercury acetate multiple interactions ISO UCHL3 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of UCHL3 mRNA CTD PMID:27188386 Uchl3 Rat phlorizin decreases expression ISO Uchl3 (Mus musculus) 6480464 Phlorhizin results in decreased expression of UCHL3 mRNA CTD PMID:22538082 Uchl3 Rat pirinixic acid increases expression ISO Uchl3 (Mus musculus) 6480464 pirinixic acid results in increased expression of UCHL3 mRNA CTD PMID:18301758 and PMID:23811191 Uchl3 Rat quercetin decreases expression ISO UCHL3 (Homo sapiens) 6480464 Quercetin results in decreased expression of UCHL3 mRNA CTD PMID:21632981 Uchl3 Rat rac-lactic acid decreases expression ISO UCHL3 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of UCHL3 mRNA CTD PMID:30851411 Uchl3 Rat sarin decreases expression ISO UCHL3 (Homo sapiens) 6480464 Sarin results in decreased expression of UCHL3 mRNA CTD PMID:19522546 Uchl3 Rat SB 431542 multiple interactions ISO UCHL3 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Uchl3 Rat senecionine increases expression ISO UCHL3 (Homo sapiens) 6480464 senecionine results in increased expression of UCHL3 mRNA CTD PMID:26100227 Uchl3 Rat Senkirkine increases expression ISO UCHL3 (Homo sapiens) 6480464 senkirkine results in increased expression of UCHL3 mRNA CTD PMID:26100227 Uchl3 Rat silicon dioxide decreases expression ISO Uchl3 (Mus musculus) 6480464 Silicon Dioxide results in decreased expression of UCHL3 mRNA CTD PMID:19073995 Uchl3 Rat sodium arsenite increases expression ISO UCHL3 (Homo sapiens) 6480464 sodium arsenite results in increased expression of UCHL3 mRNA CTD PMID:38568856 Uchl3 Rat sodium arsenite multiple interactions ISO Uchl3 (Mus musculus) 6480464 [[lead chloride results in increased abundance of Lead] co-treated with [sodium arsenite results in increased abundance of Arsenic]] results in increased expression of UCHL3 protein and [methylmercuric chloride co-treated with [sodium arsenite results in increased abundance of Arsenic]] results in increased expression of UCHL3 protein CTD PMID:32179164 Uchl3 Rat sodium chloride multiple interactions ISO UCHL3 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of UCHL3 protein more ... CTD PMID:38598786 Uchl3 Rat temozolomide decreases expression ISO UCHL3 (Homo sapiens) 6480464 Temozolomide results in decreased expression of UCHL3 mRNA CTD PMID:31758290 Uchl3 Rat thalidomide decreases expression ISO Uchl3 (Mus musculus) 6480464 Thalidomide results in decreased expression of UCHL3 mRNA CTD PMID:26217789 Uchl3 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of UCHL3 mRNA CTD PMID:34492290 Uchl3 Rat titanium dioxide increases expression ISO UCHL3 (Homo sapiens) 6480464 titanium dioxide results in increased expression of UCHL3 protein CTD PMID:30910687 Uchl3 Rat titanium dioxide decreases methylation ISO Uchl3 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of UCHL3 promoter CTD PMID:35295148 Uchl3 Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of UCHL3 gene CTD PMID:27618143 Uchl3 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of UCHL3 mRNA CTD PMID:33387578 Uchl3 Rat trichostatin A increases expression ISO UCHL3 (Homo sapiens) 6480464 trichostatin A results in increased expression of UCHL3 mRNA CTD PMID:24935251 and PMID:26272509 Uchl3 Rat trichostatin A multiple interactions ISO UCHL3 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of UCHL3 mRNA CTD PMID:27188386 Uchl3 Rat trimellitic anhydride increases expression ISO Uchl3 (Mus musculus) 6480464 trimellitic anhydride results in increased expression of UCHL3 mRNA CTD PMID:19042947 Uchl3 Rat undecane decreases expression EXP 6480464 undecane results in decreased expression of UCHL3 protein CTD PMID:17337753 Uchl3 Rat valproic acid affects expression ISO UCHL3 (Homo sapiens) 6480464 Valproic Acid affects the expression of UCHL3 mRNA CTD PMID:25979313 Uchl3 Rat valproic acid increases expression ISO UCHL3 (Homo sapiens) 6480464 Valproic Acid results in increased expression of UCHL3 mRNA CTD PMID:23179753 more ... Uchl3 Rat valproic acid multiple interactions ISO UCHL3 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of UCHL3 mRNA CTD PMID:27188386
(1->4)-beta-D-glucan (ISO) 1,2-dichloroethane (ISO) 1H-pyrazole (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,6-dimethoxyphenol (ISO) 2,6-dinitrotoluene (EXP) 2-hydroxypropanoic acid (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) aflatoxin B1 (ISO) aldehydo-D-glucose (ISO) ammonium chloride (EXP) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) benzatropine (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (EXP) cadmium dichloride (ISO) cannabidiol (ISO) CGP 52608 (ISO) chlorpyrifos (EXP) cobalt dichloride (ISO) cocaine (EXP) copper(II) sulfate (ISO) crocidolite asbestos (ISO) Cuprizon (ISO) cyclosporin A (ISO) D-glucose (ISO) DDT (EXP) diarsenic trioxide (ISO) dibutyl phthalate (ISO) dicrotophos (ISO) diuron (EXP) dorsomorphin (ISO) endosulfan (EXP) ethanol (ISO) fenthion (ISO) folic acid (ISO) fulvestrant (ISO) furfural (ISO) gentamycin (EXP) glucose (ISO) graphite (EXP) inulin (ISO) ivermectin (ISO) lead(0) (ISO) lead(II) chloride (ISO) Mesaconitine (EXP) methapyrilene (EXP) methidathion (ISO) methylmercury chloride (ISO) microcystin-LR (EXP) N-nitrosodiethylamine (EXP) ozone (ISO) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) phenylmercury acetate (ISO) phlorizin (ISO) pirinixic acid (ISO) quercetin (ISO) rac-lactic acid (ISO) sarin (ISO) SB 431542 (ISO) senecionine (ISO) Senkirkine (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sodium chloride (ISO) temozolomide (ISO) thalidomide (ISO) thioacetamide (EXP) titanium dioxide (ISO) trichloroethene (EXP) trichostatin A (ISO) trimellitic anhydride (ISO) undecane (EXP) valproic acid (ISO)
Uchl3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 84,888,847 - 84,942,095 (+) NCBI GRCr8 mRatBN7.2 15 78,485,304 - 78,527,355 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 161,856,958 - 161,857,835 (-) Ensembl mRatBN7.2 Ensembl mRatBN7.2 Ensembl 15 78,485,315 - 78,527,355 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 82,496,066 - 82,538,090 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 83,572,627 - 83,614,651 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 80,493,216 - 80,535,240 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 86,153,624 - 86,198,127 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 86,153,628 - 86,198,127 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 89,919,728 - 89,964,227 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 85,628,490 - 85,670,420 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 15 77,676,770 - 77,718,591 (+) NCBI Celera Cytogenetic Map 15 q21 NCBI
UCHL3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 13 75,549,502 - 75,606,020 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 13 75,549,483 - 75,606,020 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 13 76,123,638 - 76,180,156 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 13 75,021,928 - 75,078,070 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 13 75,021,927 - 75,078,067 NCBI Celera 13 57,021,803 - 57,077,943 (+) NCBI Celera Cytogenetic Map 13 q22.2 NCBI HuRef 13 56,821,075 - 56,877,308 (+) NCBI HuRef CHM1_1 13 76,091,356 - 76,147,870 (+) NCBI CHM1_1 T2T-CHM13v2.0 13 74,773,163 - 74,829,671 (+) NCBI T2T-CHM13v2.0
Uchl3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 14 101,891,387 - 101,933,561 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 14 101,891,403 - 101,933,561 (+) Ensembl GRCm39 Ensembl GRCm38 14 101,653,892 - 101,696,125 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 14 101,653,967 - 101,696,125 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 14 102,053,184 - 102,095,342 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 14 100,540,246 - 100,582,053 (+) NCBI MGSCv36 mm8 Celera 14 100,293,249 - 100,335,409 (+) NCBI Celera Cytogenetic Map 14 E2.3 NCBI cM Map 14 50.9 NCBI
Uchl3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955404 31,414,208 - 31,464,968 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955404 31,414,076 - 31,465,205 (-) NCBI ChiLan1.0 ChiLan1.0
UCHL3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 14 77,127,881 - 77,183,967 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 13 75,725,673 - 75,781,714 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 13 56,776,436 - 56,832,539 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 13 75,549,305 - 75,878,805 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 13 75,549,647 - 75,878,673 (+) Ensembl panpan1.1 panPan2
UCHL3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 22 29,348,962 - 29,397,944 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 22 29,348,706 - 29,407,965 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 22 29,151,524 - 29,258,782 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 22 29,625,506 - 29,732,716 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 22 29,684,385 - 29,736,169 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 22 29,276,538 - 29,383,650 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 22 29,320,217 - 29,427,245 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 22 29,388,463 - 29,495,905 (+) NCBI UU_Cfam_GSD_1.0
Uchl3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 130,107,193 - 130,163,980 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936511 5,522,965 - 5,581,334 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936511 5,524,425 - 5,581,156 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
UCHL3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 11 47,828,421 - 47,887,629 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 11 47,829,037 - 47,885,800 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 11 52,436,220 - 52,477,054 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
UCHL3
Uchl3
.
Predicted Target Of
Count of predictions: 8 Count of miRNA genes: 8 Interacting mature miRNAs: 8 Transcripts: ENSRNOT00000028960 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1549844 Bss7 Bone structure and strength QTL 7 6.4 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 15 75788062 101769107 Rat 2300326 Plaw1 Placental weight QTL 1 15 0.005 placenta mass (VT:0004257) placenta wet weight (CMO:0002088) 15 68327165 100062518 Rat 70155 Gcs1 Gastric cancer susceptibility QTL1 3.8 stomach morphology trait (VT:0000470) stomach tumor susceptibility score (CMO:0002043) 15 76306099 101769107 Rat 1582227 Gluco30 Glucose level QTL 30 3.6 0.0003 blood glucose amount (VT:0000188) absolute change in blood glucose level area under curve (CMO:0002034) 15 28030665 82262678 Rat 1582228 Epfw3 Epididymal fat weight QTL 3 4.1 0.0002 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 15 28030665 82262678 Rat 1578646 Bmd18 Bone mineral density QTL 18 5.2 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 15 22806240 98288169 Rat 1578647 Bmd17 Bone mineral density QTL 17 4 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 15 22806240 98288169 Rat 631516 Gluco31 Glucose level QTL 31 7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 15 55596089 95018120 Rat 1331724 Bp223 Blood pressure QTL 223 3.53715 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 15 73690518 95018228 Rat 2317055 Aia10 Adjuvant induced arthritis QTL 10 3.41 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 15 75788062 101769107 Rat 1582214 Stl21 Serum triglyceride level QTL 21 3.1 0.022 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 15 28030665 82262678 Rat 731177 Uae26 Urinary albumin excretion QTL 26 2.4 0.025 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 15 67588667 101769107 Rat 1300144 Rf23 Renal function QTL 23 3.61 renal blood flow trait (VT:2000006) absolute change in renal vascular resistance (CMO:0001900) 15 40631268 98288169 Rat 1576315 Schws6 Schwannoma susceptibility QTL 6 0.0069 nervous system integrity trait (VT:0010566) post-insult time of death (CMO:0002005) 15 53806152 98806152 Rat 61477 Aia4 Adjuvant induced arthritis QTL 4 3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 15 55596089 91365858 Rat 70182 BpQTLcluster12 Blood pressure QTL cluster 12 3.53 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 15 73690657 95018120 Rat 152025253 Hrtrt24 Heart rate QTL 24 3.82 heart pumping trait (VT:2000009) 15 27885774 86257085 Rat 1581555 Eae19 Experimental allergic encephalomyelitis QTL 19 4.7 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis severity score (CMO:0001419) 15 76306099 90088744 Rat 631655 Bp126 Blood pressure QTL 126 4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 15 58156477 101769107 Rat 61424 Scl1 Serum cholesterol level QTL 1 7.7 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 15 16725528 80672115 Rat 1598828 Glom14 Glomerulus QTL 14 2.5 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 15 34054139 79054139 Rat 1641889 Colcr6 Colorectal carcinoma resistance QTL 6 2.9 0.0126 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 15 73690518 99794247 Rat 1582242 Gluco28 Glucose level QTL 28 3.3 0.0008 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 15 28030665 82262678 Rat 1578660 Bss19 Bone structure and strength QTL 19 4.3 femur morphology trait (VT:0000559) bone trabecular cross-sectional area (CMO:0002311) 15 22806240 98288169 Rat 1582244 Bw79 Body weight QTL 79 4 0.0002 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 15 28030665 82262678 Rat
Uchl4
Rat Assembly Chr Position (strand) Source JBrowse RGSC_v3.4 3 163,941,308 - 163,942,074 UniSTS RGSC3.4 Celera 3 161,050,303 - 161,051,069 UniSTS Cytogenetic Map 3 q42 UniSTS Cytogenetic Map 15 q21 UniSTS
BM390056
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 78,494,992 - 78,495,193 (-) MAPPER mRatBN7.2 mRatBN7.2 15 78,494,992 - 78,495,193 (+) MAPPER mRatBN7.2 Rnor_6.0 15 86,163,284 - 86,163,484 NCBI Rnor6.0 Rnor_6.0 3 171,124,878 - 171,125,078 NCBI Rnor6.0 Rnor_5.0 3 177,191,047 - 177,191,247 UniSTS Rnor5.0 Rnor_5.0 15 89,929,384 - 89,929,584 UniSTS Rnor5.0 RGSC_v3.4 15 85,638,146 - 85,638,346 UniSTS RGSC3.4 Celera 15 77,686,426 - 77,686,626 UniSTS RH 3.4 Map 15 503.1 UniSTS Cytogenetic Map 15 q21 UniSTS Cytogenetic Map 3 q42 UniSTS
PMC85452P1
Rat Assembly Chr Position (strand) Source JBrowse RGSC_v3.4 3 163,941,362 - 163,942,072 UniSTS RGSC3.4 Celera 3 161,050,357 - 161,051,067 UniSTS Cytogenetic Map 3 q42 UniSTS Cytogenetic Map 15 q21 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
18
15
64
198
141
139
84
46
84
12
330
149
164
69
110
55
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000012842 ⟹ ENSRNOP00000012842
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 78,485,315 - 78,527,349 (+) Ensembl Rnor_6.0 Ensembl 15 86,153,628 - 86,198,127 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000028960 ⟹ ENSRNOP00000029819
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 78,496,608 - 78,527,355 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000104271 ⟹ ENSRNOP00000091247
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 78,485,336 - 78,527,355 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000112431 ⟹ ENSRNOP00000092785
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 78,485,336 - 78,527,355 (+) Ensembl
RefSeq Acc Id:
NM_001110165 ⟹ NP_001103635
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 84,900,078 - 84,942,095 (+) NCBI mRatBN7.2 15 78,485,336 - 78,527,355 (+) NCBI Rnor_6.0 15 86,153,628 - 86,198,127 (+) NCBI Rnor_5.0 15 89,919,728 - 89,964,227 (+) NCBI RGSC_v3.4 15 85,628,490 - 85,670,420 (+) RGD Celera 15 77,676,770 - 77,718,591 (+) RGD
Sequence:
AAGCAGCGGCGGTGGTGGTGGTGGTGGTGGTGGCGGCGGCGGCTGCTGTCAGAGCTGGAGCGCGGCCGGCTGAGCAGTCATGGAGGGTCAGCGCTGGCTGCCGCTGGAGGCCAACCCTGAGGTCACCA
hide sequence
RefSeq Acc Id:
XM_039093599 ⟹ XP_038949527
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 84,899,862 - 84,942,093 (+) NCBI mRatBN7.2 15 78,485,304 - 78,527,353 (+) NCBI
RefSeq Acc Id:
XM_063274569 ⟹ XP_063130639
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 84,899,862 - 84,942,093 (+) NCBI
RefSeq Acc Id:
XM_063274570 ⟹ XP_063130640
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 84,900,051 - 84,942,093 (+) NCBI
RefSeq Acc Id:
XM_063274571 ⟹ XP_063130641
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 84,900,098 - 84,942,093 (+) NCBI
RefSeq Acc Id:
XM_063274572 ⟹ XP_063130642
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 84,900,051 - 84,942,093 (+) NCBI
RefSeq Acc Id:
XM_063274573 ⟹ XP_063130643
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 84,888,847 - 84,942,093 (+) NCBI
RefSeq Acc Id:
XM_063274574 ⟹ XP_063130644
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 84,900,051 - 84,942,093 (+) NCBI
RefSeq Acc Id:
XM_063274575 ⟹ XP_063130645
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 84,900,102 - 84,942,093 (+) NCBI
RefSeq Acc Id:
XM_063274576 ⟹ XP_063130646
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 84,900,060 - 84,942,093 (+) NCBI
RefSeq Acc Id:
XM_063274577 ⟹ XP_063130647
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 84,900,045 - 84,942,093 (+) NCBI
RefSeq Acc Id:
XM_063274578 ⟹ XP_063130648
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 84,899,862 - 84,942,093 (+) NCBI
RefSeq Acc Id:
XM_063274579 ⟹ XP_063130649
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 84,900,045 - 84,942,093 (+) NCBI
RefSeq Acc Id:
XM_063274580 ⟹ XP_063130650
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 84,900,059 - 84,942,093 (+) NCBI
RefSeq Acc Id:
XM_063274581 ⟹ XP_063130651
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 84,900,051 - 84,942,093 (+) NCBI
RefSeq Acc Id:
XM_063274582 ⟹ XP_063130652
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 84,900,051 - 84,942,093 (+) NCBI
RefSeq Acc Id:
XM_063274583 ⟹ XP_063130653
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 84,900,063 - 84,942,093 (+) NCBI
RefSeq Acc Id:
NP_001103635 ⟸ NM_001110165
- UniProtKB:
Q91Y78 (UniProtKB/Swiss-Prot), A0A8J8Y1V7 (UniProtKB/TrEMBL), A6KKZ2 (UniProtKB/TrEMBL)
- Sequence:
MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMEPELLSMVPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSALKKFLEESVA
hide sequence
Ensembl Acc Id:
ENSRNOP00000012842 ⟸ ENSRNOT00000012842
RefSeq Acc Id:
XP_038949527 ⟸ XM_039093599
- Peptide Label:
isoform X15
- UniProtKB:
A0A8I6AE48 (UniProtKB/TrEMBL), A0A8J8Y1V7 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000092785 ⟸ ENSRNOT00000112431
Ensembl Acc Id:
ENSRNOP00000029819 ⟸ ENSRNOT00000028960
Ensembl Acc Id:
ENSRNOP00000091247 ⟸ ENSRNOT00000104271
RefSeq Acc Id:
XP_063130643 ⟸ XM_063274573
- Peptide Label:
isoform X5
RefSeq Acc Id:
XP_063130639 ⟸ XM_063274569
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_063130648 ⟸ XM_063274578
- Peptide Label:
isoform X10
- UniProtKB:
A0A8J8Y1V7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063130647 ⟸ XM_063274577
- Peptide Label:
isoform X9
- UniProtKB:
A0A8J8Y1V7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063130649 ⟸ XM_063274579
- Peptide Label:
isoform X11
RefSeq Acc Id:
XP_063130642 ⟸ XM_063274572
- Peptide Label:
isoform X4
- UniProtKB:
A0A8I6GJY6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063130644 ⟸ XM_063274574
- Peptide Label:
isoform X6
RefSeq Acc Id:
XP_063130640 ⟸ XM_063274570
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_063130652 ⟸ XM_063274582
- Peptide Label:
isoform X14
RefSeq Acc Id:
XP_063130651 ⟸ XM_063274581
- Peptide Label:
isoform X13
RefSeq Acc Id:
XP_063130650 ⟸ XM_063274580
- Peptide Label:
isoform X12
RefSeq Acc Id:
XP_063130646 ⟸ XM_063274576
- Peptide Label:
isoform X8
RefSeq Acc Id:
XP_063130653 ⟸ XM_063274583
- Peptide Label:
isoform X16
RefSeq Acc Id:
XP_063130641 ⟸ XM_063274571
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_063130645 ⟸ XM_063274575
- Peptide Label:
isoform X7
- UniProtKB:
A0A8I6GJY6 (UniProtKB/TrEMBL)
RGD ID: 13699863 Promoter ID: EPDNEW_R10386 Type: initiation region Name: Uchl3_1 Description: ubiquitin C-terminal hydrolase L3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 15 86,153,626 - 86,153,686 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-11-19
Uchl3
ubiquitin C-terminal hydrolase L3
Uchl3
ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-10-02
Uchl3
ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase)
RGD1561196
similar to ubiqutin carboxyl-terminal hydrolase l3
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
RGD1561196
similar to ubiqutin carboxyl-terminal hydrolase l3
RGD1561196_predicted
similar to ubiqutin carboxyl-terminal hydrolase l3 (predicted)
'predicted' is removed
2292626 APPROVED
2006-03-07
RGD1561196_predicted
similar to ubiqutin carboxyl-terminal hydrolase l3 (predicted)
LOC498560
similar to ubiqutin carboxyl-terminal hydrolase l3
Symbol and Name status set to approved
1299863 APPROVED
2006-02-09
LOC498560
similar to ubiqutin carboxyl-terminal hydrolase l3
Symbol and Name status set to provisional
70820 PROVISIONAL
