Advanced Search (OLGA)

Gene: Pik3r6 (phosphoinositide-3-kinase, regulatory subunit 6) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Pik3r6

Name:

phosphoinositide-3-kinase, regulatory subunit 6

RGD ID:

1560850

Description:

Predicted to enable 1-phosphatidylinositol-3-kinase regulator activity. Predicted to contribute to 1-phosphatidylinositol-4,5-bisphosphate 3-kinase activity. Predicted to be involved in several processes, including positive regulation of MAP kinase activity; positive regulation of T cell differentiation; and positive regulation of angiogenesis. Predicted to be located in membrane. Predicted to be part of phosphatidylinositol 3-kinase complex, class IA and phosphatidylinositol 3-kinase complex, class IB. Orthologous to human PIK3R6 (phosphoinositide-3-kinase regulatory subunit 6); PARTICIPATES IN eicosanoid signaling pathway; ephrin - ephrin receptor bidirectional signaling axis; insulin signaling pathway; INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; Asiaticoside; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC497932; p87 phosphoinositide 3-kinase gamma adapter; phosphoinositide 3-kinase regulatory subunit 6; RGD1560850; similar to Expressed sequence BB220380

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	53,702,821 - 53,754,113 (+)	NCBI		GRCr8
mRatBN7.2	10	53,203,930 - 53,255,229 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	53,205,496 - 53,255,243 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	57,881,076 - 57,914,437 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	57,370,116 - 57,403,475 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	52,878,871 - 52,912,377 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	55,085,269 - 55,135,069 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	55,085,259 - 55,135,092 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	54,829,255 - 54,879,028 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	55,270,065 - 55,303,503 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	10	52,389,252 - 52,422,664 (+)	NCBI		Celera
Cytogenetic Map	10	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pik3r6	Rat	(1->4)-beta-D-glucan	multiple interactions	ISO	Pik3r6 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PIK3R6 mRNA	CTD	PMID:36331819
Pik3r6	Rat	1,2-dimethylhydrazine	increases expression	ISO	Pik3r6 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in increased expression of PIK3R6 mRNA	CTD	PMID:22206623
Pik3r6	Rat	2,2',4,4'-Tetrabromodiphenyl ether	decreases expression	EXP		6480464	2 more ...	CTD	PMID:27291303
Pik3r6	Rat	4-hydroxyphenyl retinamide	decreases expression	ISO	Pik3r6 (Mus musculus)	6480464	Fenretinide results in decreased expression of PIK3R6 mRNA	CTD	PMID:28973697
Pik3r6	Rat	aflatoxin B1	affects expression	ISO	PIK3R6 (Homo sapiens)	6480464	Aflatoxin B1 affects the expression of PIK3R6 protein	CTD	PMID:20106945
Pik3r6	Rat	aflatoxin B1	decreases methylation	ISO	PIK3R6 (Homo sapiens)	6480464	Aflatoxin B1 results in decreased methylation of PIK3R6 gene	CTD	PMID:27153756
Pik3r6	Rat	Aflatoxin B2 alpha	increases methylation	ISO	PIK3R6 (Homo sapiens)	6480464	aflatoxin B2 results in increased methylation of PIK3R6 polyA tail	CTD	PMID:30157460
Pik3r6	Rat	Asiaticoside	multiple interactions	EXP		6480464	asiaticoside inhibits the reaction [Rotenone results in decreased expression of PIK3R6 mRNA]	CTD	PMID:28238857
Pik3r6	Rat	benzo[a]pyrene	decreases expression	ISO	PIK3R6 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased expression of PIK3R6 mRNA	CTD	PMID:20106945
Pik3r6	Rat	benzo[a]pyrene	increases methylation	ISO	PIK3R6 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of PIK3R6 5' UTR	CTD	PMID:27901495
Pik3r6	Rat	benzo[a]pyrene	affects methylation	ISO	PIK3R6 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of PIK3R6 intron and Benzo(a)pyrene affects the methylation of PIK3R6 promoter	CTD	PMID:27901495 and PMID:30157460
Pik3r6	Rat	benzo[a]pyrene	increases expression	ISO	Pik3r6 (Mus musculus)	6480464	Benzo(a)pyrene results in increased expression of PIK3R6 mRNA	CTD	PMID:22228805
Pik3r6	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of PIK3R6 mRNA	CTD	PMID:25181051
Pik3r6	Rat	bisphenol A	decreases methylation	ISO	PIK3R6 (Homo sapiens)	6480464	bisphenol A results in decreased methylation of PIK3R6 gene	CTD	PMID:31601247
Pik3r6	Rat	bisphenol A	increases expression	ISO	Pik3r6 (Mus musculus)	6480464	bisphenol A results in increased expression of PIK3R6 mRNA	CTD	PMID:33221593
Pik3r6	Rat	bisphenol F	decreases expression	ISO	Pik3r6 (Mus musculus)	6480464	bisphenol F results in decreased expression of PIK3R6 mRNA	CTD	PMID:38685157
Pik3r6	Rat	cyclosporin A	decreases expression	ISO	PIK3R6 (Homo sapiens)	6480464	Cyclosporine results in decreased expression of PIK3R6 mRNA	CTD	PMID:20106945
Pik3r6	Rat	decabromodiphenyl ether	decreases expression	EXP		6480464	decabromobiphenyl ether results in decreased expression of PIK3R6 mRNA	CTD	PMID:23640034
Pik3r6	Rat	dibutyl phthalate	decreases expression	ISO	Pik3r6 (Mus musculus)	6480464	Dibutyl Phthalate results in decreased expression of PIK3R6 mRNA	CTD	PMID:21266533
Pik3r6	Rat	dioxygen	increases expression	ISO	PIK3R6 (Homo sapiens)	6480464	Oxygen deficiency results in increased expression of PIK3R6 mRNA	CTD	PMID:26516004
Pik3r6	Rat	formaldehyde	increases expression	ISO	PIK3R6 (Homo sapiens)	6480464	Formaldehyde results in increased expression of PIK3R6 mRNA	CTD	PMID:23649840 and PMID:27905399
Pik3r6	Rat	furan	increases expression	EXP		6480464	furan results in increased expression of PIK3R6 mRNA	CTD	PMID:27387713
Pik3r6	Rat	methamphetamine	increases expression	EXP		6480464	Methamphetamine results in increased expression of PIK3R6 mRNA	CTD	PMID:19564919
Pik3r6	Rat	methamphetamine	multiple interactions	EXP		6480464	[Methamphetamine co-treated with SCH 23390] results in increased expression of PIK3R6 mRNA	CTD	PMID:19564919
Pik3r6	Rat	N-methyl-4-phenylpyridinium	increases expression	EXP		6480464	1-Methyl-4-phenylpyridinium results in increased expression of PIK3R6 mRNA	CTD	PMID:28801915
Pik3r6	Rat	oxaliplatin	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of PIK3R6 mRNA	CTD	PMID:25729387
Pik3r6	Rat	oxaliplatin	increases expression	EXP		6480464	oxaliplatin results in increased expression of PIK3R6 mRNA	CTD	PMID:25729387
Pik3r6	Rat	pentachlorophenol	increases expression	ISO	Pik3r6 (Mus musculus)	6480464	Pentachlorophenol results in increased expression of PIK3R6 mRNA	CTD	PMID:23892564
Pik3r6	Rat	perfluorohexanesulfonic acid	increases expression	ISO	Pik3r6 (Mus musculus)	6480464	perfluorohexanesulfonic acid results in increased expression of PIK3R6 mRNA	CTD	PMID:37995155
Pik3r6	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	Pik3r6 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PIK3R6 mRNA	CTD	PMID:36331819
Pik3r6	Rat	propiconazole	increases expression	ISO	Pik3r6 (Mus musculus)	6480464	propiconazole results in increased expression of PIK3R6 mRNA	CTD	PMID:21278054
Pik3r6	Rat	rotenone	decreases expression	EXP		6480464	Rotenone results in decreased expression of PIK3R6 mRNA	CTD	PMID:28238857
Pik3r6	Rat	rotenone	multiple interactions	EXP		6480464	[Rotenone co-treated with Levodopa] results in decreased expression of PIK3R6 mRNA and asiaticoside inhibits the reaction [Rotenone results in decreased expression of PIK3R6 mRNA]	CTD	PMID:28238857
Pik3r6	Rat	SCH 23390	increases expression	EXP		6480464	SCH 23390 results in increased expression of PIK3R6 mRNA	CTD	PMID:19564919
Pik3r6	Rat	SCH 23390	multiple interactions	EXP		6480464	[Methamphetamine co-treated with SCH 23390] results in increased expression of PIK3R6 mRNA	CTD	PMID:19564919
Pik3r6	Rat	silicon dioxide	increases expression	EXP		6480464	Silicon Dioxide results in increased expression of PIK3R6 mRNA	CTD	PMID:32721576
Pik3r6	Rat	topotecan	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of PIK3R6 mRNA	CTD	PMID:25729387
Pik3r6	Rat	triphenyl phosphate	affects expression	ISO	PIK3R6 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of PIK3R6 mRNA	CTD	PMID:37042841

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pik3r6	Rat	G protein-coupled receptor signaling pathway	involved_in	ISO	Pik3r6 (Mus musculus)	1624291	PMID:19906996	RGD	PMID:19906996
Pik3r6	Rat	G protein-coupled receptor signaling pathway	involved_in	IBA	MGI:2144613 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Pik3r6	Rat	G protein-coupled receptor signaling pathway	involved_in	ISO	PIK3R6 (Homo sapiens)	1624291	PMID:10358071	RGD	PMID:10358071
Pik3r6	Rat	G protein-coupled receptor signaling pathway	involved_in	IEA	UniProtKB:Q3U6Q4 and ensembl:ENSMUSP00000099673	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Pik3r6	Rat	positive regulation of angiogenesis	involved_in	ISO	PIK3R6 (Homo sapiens)	1624291	PMID:21393242	RGD	PMID:21393242
Pik3r6	Rat	positive regulation of angiogenesis	involved_in	IEA	UniProtKB:Q5UE93 and ensembl:ENSP00000480157	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Pik3r6	Rat	positive regulation of MAP kinase activity	involved_in	ISO	Pik3r6 (Mus musculus)	1624291	PMID:19906996	RGD	PMID:19906996
Pik3r6	Rat	positive regulation of T cell differentiation	involved_in	IEA	UniProtKB:Q3U6Q4 and ensembl:ENSMUSP00000099673	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Pik3r6	Rat	positive regulation of T cell differentiation	involved_in	ISO	Pik3r6 (Mus musculus)	1624291	PMID:12707323	RGD	PMID:12707323
Pik3r6	Rat	regulation of natural killer cell mediated cytotoxicity	involved_in	ISO	PIK3R6 (Homo sapiens)	1624291	PMID:11062502	RGD	PMID:11062502
Pik3r6	Rat	regulation of natural killer cell mediated cytotoxicity	involved_in	IEA	UniProtKB:Q5UE93 and ensembl:ENSP00000480157	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Pik3r6	Rat	regulation of natural killer cell mediated cytotoxicity	involved_in	IBA	PANTHER:PTN002694960 and UniProtKB:Q5UE93	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pik3r6	Rat	membrane	located_in	ISO	Pik3r6 (Mus musculus)	1624291	PMID:19906996	RGD	PMID:19906996
Pik3r6	Rat	membrane	located_in	IEA	UniProtKB:Q3U6Q4 and ensembl:ENSMUSP00000099673	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Pik3r6	Rat	phosphatidylinositol 3-kinase complex	part_of	IBA	MGI:2144613 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Pik3r6	Rat	phosphatidylinositol 3-kinase complex, class IA	part_of	ISO	PIK3R6 (Homo sapiens)	1624291	PMID:10358071	RGD	PMID:10358071
Pik3r6	Rat	phosphatidylinositol 3-kinase complex, class IB	part_of	ISO	Pik3r6 (Mus musculus)	1624291	PMID:15797027	RGD	PMID:15797027
Pik3r6	Rat	phosphatidylinositol 3-kinase complex, class IB	part_of	IEA	UniProtKB:Q3U6Q4 and ensembl:ENSMUSP00000099673	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Pik3r6	Rat	phosphatidylinositol 3-kinase complex, class IB	part_of	IEA	InterPro:IPR019522	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pik3r6	Rat	1-phosphatidylinositol-3-kinase regulator activity	enables	ISO	Pik3r6 (Mus musculus)	1624291	PMID:15797027	RGD	PMID:15797027
Pik3r6	Rat	1-phosphatidylinositol-3-kinase regulator activity	enables	IEA	UniProtKB:Q3U6Q4 and ensembl:ENSMUSP00000099673	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Pik3r6	Rat	1-phosphatidylinositol-3-kinase regulator activity	enables	IBA	MGI:2144613 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Pik3r6	Rat	1-phosphatidylinositol-3-kinase regulator activity	enables	IEA	InterPro:IPR019522	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Pik3r6	Rat	1-phosphatidylinositol-4,5-bisphosphate 3-kinase activity	contributes_to	ISO	Pik3r6 (Mus musculus)	1624291	PMID:19906996	RGD	PMID:19906996
Pik3r6	Rat	1-phosphatidylinositol-4,5-bisphosphate 3-kinase activity	contributes_to	IEA	UniProtKB:Q3U6Q4 and ensembl:ENSMUSP00000099673	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Pik3r6	Rat	protein binding	enables	ISO	PIK3R6 (Homo sapiens)	1624291	UniProtKB:Q13370 and PMID:21393242	RGD	PMID:21393242
Pik3r6	Rat	protein binding	enables	ISO	Pik3r6 (Mus musculus)	1624291	UniProtKB:P48736 more ...	RGD	PMID:15797027 more ...

Imported Annotations - SMPDB

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pik3r6	Rat	insulin signaling pathway		ISO	PIK3R6 (Homo sapiens)	10402751		SMPDB	SMP:00391

Imported Annotations - PID (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pik3r6	Rat	eicosanoid signaling pathway		ISO	PIK3R6 (Homo sapiens)	6484113		PID	PID:200082
Pik3r6	Rat	ephrin - ephrin receptor bidirectional signaling axis		ISO	PIK3R6 (Homo sapiens)	6484113		PID	PID:200142
Pik3r6	Rat	phosphatidylinositol 3-kinase class I signaling pathway		ISO	PIK3R6 (Homo sapiens)	6484113		PID	PID:200116
Pik3r6	Rat	platelet-derived growth factor signaling pathway		ISO	PIK3R6 (Homo sapiens)	6484113		PID	PID:200149

BioCyc Pathways

3-phosphoinositide biosynthesis

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
3.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
4.	GOA pipeline	RGD automated data pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:11062502	PMID:12707323	PMID:15797027	PMID:18831540	PMID:19906996	PMID:21393242	PMID:36252138

Pik3r6
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	53,702,821 - 53,754,113 (+)	NCBI		GRCr8
mRatBN7.2	10	53,203,930 - 53,255,229 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	53,205,496 - 53,255,243 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	57,881,076 - 57,914,437 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	57,370,116 - 57,403,475 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	52,878,871 - 52,912,377 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	55,085,269 - 55,135,069 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	55,085,259 - 55,135,092 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	54,829,255 - 54,879,028 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	55,270,065 - 55,303,503 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	10	52,389,252 - 52,422,664 (+)	NCBI		Celera
Cytogenetic Map	10	q24	NCBI

PIK3R6
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	8,802,722 - 8,867,677 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	8,802,722 - 8,867,677 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	8,706,040 - 8,770,994 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	8,646,780 - 8,711,719 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	17	8,647,316 - 8,683,739	NCBI
Celera	17	8,736,925 - 8,802,828 (-)	NCBI		Celera
Cytogenetic Map	17	p13.1	NCBI
HuRef	17	8,605,017 - 8,670,244 (-)	NCBI		HuRef
CHM1_1	17	8,715,147 - 8,780,110 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	17	8,708,926 - 8,774,833 (-)	NCBI		T2T-CHM13v2.0

Pik3r6
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	68,393,845 - 68,443,524 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	68,393,845 - 68,443,524 (+)	Ensembl		GRCm39 Ensembl
GRCm38	11	68,503,019 - 68,552,698 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	68,503,019 - 68,552,698 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	68,316,521 - 68,366,200 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	68,319,286 - 68,368,893 (+)	NCBI		MGSCv36	mm8
Celera	11	75,440,292 - 75,489,918 (+)	NCBI		Celera
Cytogenetic Map	11	B3	NCBI
cM Map	11	41.76	NCBI

Pik3r6
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955467	8,104,906 - 8,157,144 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955467	8,104,242 - 8,157,637 (+)	NCBI	ChiLan1.0	ChiLan1.0

PIK3R6
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	64,891,181 - 64,946,495 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	69,700,506 - 69,755,779 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	42,782,422 - 42,851,692 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	47,518,629 - 47,585,160 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	47,518,629 - 47,585,160 (+)	Ensembl	panpan1.1		panPan2

PIK3R6
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	33,472,240 - 33,528,369 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	33,472,771 - 33,528,400 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	33,608,573 - 33,664,684 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	33,575,473 - 33,631,553 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	33,575,457 - 33,631,578 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	33,543,177 - 33,599,204 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	33,500,676 - 33,556,758 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	33,677,115 - 33,733,252 (-)	NCBI		UU_Cfam_GSD_1.0

Pik3r6
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	48,479,138 - 48,512,137 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936595	1,953,375 - 1,986,150 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936595	1,953,372 - 1,983,765 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PIK3R6
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	53,906,511 - 53,964,514 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	12	53,910,999 - 53,971,088 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	56,661,528 - 56,723,760 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PIK3R6
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	8,158,842 - 8,224,192 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	16	8,159,400 - 8,223,937 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666059	13,158,022 - 13,223,797 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pik3r6
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624786	11,326,364 - 11,371,767 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624786	11,324,558 - 11,386,202 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Pik3r6
356 total Variants

Assembly: mRatBN7.2

Chromosome	Start Pos	End Pos	Reference Nucleotide	Variant Nucleotide	Variant Type	Strain	Variant Page
10	53235030	53235031	G	A	snv	HXB2/IpcvMcwi (2019)	View more Information

Assembly: Rnor_6.0

Chromosome	Start Pos	End Pos	Reference Nucleotide	Variant Nucleotide	Variant Type	Strain	Variant Page
10	55114889	55114890	G	A	snv	HXB2/IpcvMcwi (2019)	View more Information

Predicted Target Of

	Summary Value
Count of predictions:	46
Count of miRNA genes:	43
Interacting mature miRNAs:	46
Transcripts:	ENSRNOT00000005405
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61441	Btemp1	Thermal response to stress QTL 1	4		body temperature trait (VT:0005535)	core body temperature (CMO:0001036)	10	35392457	63642539	Rat
1549846	Scl47	Serum cholesterol level QTL 47	3.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	50574707	95574707	Rat
9589136	Insul27	Insulin level QTL 27	10.46	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	10	11474010	56474010	Rat
152025229	Scl83	Serum cholesterol level QTL 83	4.33		blood cholesterol amount (VT:0000180)		10	35710580	68663659	Rat
1578779	Tcas10	Tongue tumor susceptibility QTL 10	3.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	10	31297439	76297439	Rat
152025227	Bw195	Body weight QTL 195	5.73		body mass (VT:0001259)		10	46989699	68663659	Rat
631564	Apr3	Acute phase response QTL 3	3.9		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	10	15275955	60275955	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	26521957	98003205	Rat
2293669	Bmd33	Bone mineral density QTL 33	4.5	0.0001	femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	10	49444551	81709989	Rat
152025224	Bw193	Body weight QTL 193	6.47		body mass (VT:0001259)		10	51663405	75085664	Rat
631552	Vetf2	Vascular elastic tissue fragility QTL 2	4.5	0.0002	aorta elastic tissue integrity trait (VT:0010556)	artery internal elastic lamina non-tumorous lesion count (CMO:0001913)	10	41142633	86142633	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	743364	63851208	Rat
631557	Bp136	Blood pressure QTL 136		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	30632053	75632053	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42045676	104670812	Rat
2293679	Bmd30	Bone mineral density QTL 30	3.5	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	49444551	81709989	Rat
1578762	Toxo1	Toxoplasma gondii resistance QTL 1			brain integrity trait (VT:0010579)	percentage of study population displaying Toxoplasma gondii brain cysts at a point in time (CMO:0002028)	10	52200030	59378278	Rat
2298544	Neuinf9	Neuroinflammation QTL 9	4.6		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	10	5801990	62146030	Rat
61463	Bp12	Blood pressure QTL 12	6.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	41333258	86333258	Rat
8694173	Bw149	Body weight QTL 149	4.38	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	10	44441699	89441699	Rat
2300218	Hpcl2	Hepatic cholesterol level QTL 2			liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	45029650	95600334	Rat
1554317	Bmd4	Bone mineral density QTL 4	9.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	19816042	99406971	Rat
1598852	Anxrr19	Anxiety related response QTL 19	5.07		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	10	18167841	63167841	Rat
1581497	Esta1	Estrogen-induced thymic atrophy QTL 1			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	21329805	61345413	Rat
724527	Bp148	Blood pressure QTL 148		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	28453136	73453136	Rat
1358897	Stresp6	Stress response QTL 6	4.17	0.022	blood norepinephrine amount (VT:0005663)	plasma norepinephrine level (CMO:0001010)	10	35392267	64155584	Rat
1331762	Rf40	Renal function QTL 40	3.873		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	10	29299504	64155584	Rat
2300171	Bmd58	Bone mineral density QTL 58	4.9	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	26944628	71944628	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14487011	89062041	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	42323132	87323132	Rat
9590310	Scort19	Serum corticosterone level QTL 19	6.3	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
9589030	Epfw9	Epididymal fat weight QTL 9	19.24	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	10	44441699	89441699	Rat
10402859	Bp381	Blood pressure QTL 381		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
2293652	Bmd22	Bone mineral density QTL 22	4.9	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	49444551	81709989	Rat
70198	BpQTLcluster9	Blood pressure QTL cluster 9	2.94		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	42323132	87323132	Rat
1359017	Hrtrt21	Heart rate QTL 21	2.4		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	10	51772940	96772940	Rat
6893352	Bw100	Body weight QTL 100	0.33	0.6	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22427500	90627625	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6154182	73453136	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	51770177	107211142	Rat
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1	80676123	Rat
1354587	Kidm21	Kidney mass QTL 21	3.3		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	10	15028513	60430477	Rat
6893350	Bw99	Body weight QTL 99	0.87	0.16	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
2317043	Aia7	Adjuvant induced arthritis QTL 7	3.82		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	10	37565079	82565079	Rat
70224	Eae3	Experimental allergic encephalomyelitis QTL 3	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	10	26521957	61345413	Rat
2317042	Aia20	Adjuvant induced arthritis QTL 20	3.38		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	10	37565079	82565079	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29299504	107211142	Rat
2313087	Bmd80	Bone mineral density QTL 80	3.2	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	10	19606483	64606483	Rat
70364	Bp72	Blood pressure QTL 72			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	51121100	96121100	Rat
631530	Tls3	T-lymphoma susceptibility QTL 3	0	0.0001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	10	51774612	95600334	Rat
631535	Cm51	Cardiac mass QTL 51	3		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	10	51786282	91669536	Rat
1576319	Cia29	Collagen induced arthritis QTL 29			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	33973921	78973921	Rat
8552805	Bw145	Body weight QTL 145	2.2		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	10	41944526	78307017	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
2293705	Bmd25	Bone mineral density QTL 25	7.1	0.0001	femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	10	49444551	81709989	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40035094	102359817	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14487011	104060283	Rat
9590268	Scort13	Serum corticosterone level QTL 13	3.26	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
7207811	Bmd90	Bone mineral density QTL 90	5.2		femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	10	49444551	81709989	Rat
1576311	Pia26	Pristane induced arthritis QTL 26			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	31224026	75632053	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
7411614	Foco18	Food consumption QTL 18		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	44441699	89441699	Rat
631547	Bp87	Blood pressure QTL 87	4.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	47369470	92369470	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6357896	96121100	Rat
6893342	Cm78	Cardiac mass QTL 78	0.1	0.88	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	42876766	79813922	Rat
2292441	Bp308	Blood pressure QTL 308			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
2313055	Bw96	Body weight QTL 96	3.6	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	10	19606483	64606483	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	26521957	98952741	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001081444	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039086574	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039086575	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039086576	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039086577	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039086578	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039086579	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039086580	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039086581	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005489905	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005489906	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005489907	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005489908	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	EF207569	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000005405 ⟹ ENSRNOP00000005405

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	53,205,496 - 53,255,243 (+)	Ensembl
Rnor_6.0 Ensembl	10	55,085,259 - 55,135,092 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000117827 ⟹ ENSRNOP00000083483

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	53,226,407 - 53,255,243 (+)	Ensembl

RefSeq Acc Id:

NM_001081444 ⟹ NP_001074913

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	53,704,703 - 53,754,113 (+)	NCBI
mRatBN7.2	10	53,205,816 - 53,255,229 (+)	NCBI
Rnor_6.0	10	55,100,632 - 55,134,430 (+)	NCBI
Rnor_5.0	10	54,829,255 - 54,879,028 (+)	NCBI
RGSC_v3.4	10	55,270,065 - 55,303,503 (+)	RGD
Celera	10	52,389,252 - 52,422,664 (+)	RGD

Sequence:

show sequence

ATGGAGAGCTCAGATGTGGAGCTGGACTTCCAGAGGAGTGTACAGGCTGTGCTGCGAGAGCTCAACACCCCAAACCCAGCCCTCCAGAGTAATCAGGGCATGTGGAGATGGTCTCTGCACAAGAAGAT
GGAGAGAAATCCAGGAAAGAGCTCCGTTCTGGTCCGAATTCTGCTCAGAGAGCTGGAGAAGGCAGAAAGCGAGGACGCACGGCGTGTCATCATACCCTTGCTGCTCACTCTAATGTCAGTGCTCACTA
AGGCGACCGGCATCACGGAAGATCTATACCATAGAGCTTACACCTTCTGCACCAGGCTGCTGACCTTGCCAGCCCCCTACTCTACAGTCGCCTTGGACTGTGCCATAAGGCTGAAAACAGAGACGGCT
GTCCCAGGTACGCTGTATCAGCGGACTGTCATTGCGGAGCAGAACCTGATAAGTGAGCTCTACCCTTACCAGGAGAGAGTGTTTCTGTTTGTGGACCCCGAGCTGGTTTCTGCCTCCGTGTGCAGTGC
CCTGCTGCTGGAGATCCAGGCAGCCCAAGAGCAGCAGACACCCGAGGCCTGCATGCGCCACGTGGTCTCCCATGCCTTACAGGCAGCTCTGGGAGAAGCCTGTCACACAGGTGCTCTGAACAGGAAGC
TGCAGGCCAGCTCCCGTCGCGTACTAGAATACTATTTCCACGCTGTCGTGGCTGCCATAGAGCAGGTGGCTAGCGAGGACAGCCCCAGCCGGCTGGGACACCTGGAGAGGATGGAGGAGATTTACTGC
TCGCTGCTAGGAACTGCGACCACAAGAAGGCGCTGCGTCGGTGACCTCCTCCAAGACCGACTGCCAAGCATCCCCCTGCCCAGTCCCTACATCACCTTCCACCTGTGGACTGACCAGGAGCAGCTCTG
GAAAGAACTGGTACTCTTCCTCCGCCCACGCTCCCAGCTCCGTCTCAGTGCTGATCTGGATGCCTTGGATCTACAAGGATTTAGGCCAGACCGGGACTTGGCCCGGGTGTCCACCGACAGTGGAATTG
AACGGGACCTTCCTTTGGGGAACGATGAGCTCCCAGACCCCAGCAGCTCTGAGATGGAGCGAGCTGCACTTCAACGCAAGGGGGGCATCAAGAAGCGTGTGTGGCCCCCTGACTTCTTCATGCCCGGG
AGCTGGGATGGACCCCCAGGGTTGCATCGGAGGACTGGAAGGCCTAGTGGGGATGGGGAGCTGCTACCTGGAGTCTCCAGAGTGCATACCGCCCGCGTGCTCGTGCTGGGGGATGACAGGATGGTAGG
GCGCTTGGCCCAGGCTTACTACAGACTCAGGAAACGGGAGACCAAGAAGTTCTGCCTCACTCCTAGACTCAGCCTACAGTTCTACTACATCCCTGTGCTGGCACCTCAGGGGACTGGACAGGATCCAG
AAGCATCCAGGAAACCTGAGCTGGGAGAGCTGGCTTCCTTCCTGGGTCGAGTTGACCCTTGGTATGAAAGCACTGTCAACACCCTGTGTCCTGCCATCCTCAAGCTTGCTGAGATGCCTCCCTGTTTG
GACACATCCAGGACCGTGGACCCCTTCATCCTGGATGTCATCACTTACTATGTTCGCATGGGCACCCAACCCATCTATTTCCAGCTCTACAAGGTTAAGATCTTCACCAACTTGAGTCATGACCCTAT
AGAGGACATTTTCCTCATGGAGCTGAAGGTGAAGACCCAAGATTCCAAGTCCCCCAAAGAGGGCTCTTCACCCCGAAGGAGAGGGGCGGCTGAGGGCACAGGAGCTGAACTGTCCATGTGCTACCAGA
AGGCCCTGCTCAGCCACAGACCCAGAGAGGTCACTGTTTCTCTGCGGGCCACCGGGCTGGTCCTGAAGGCCATTCCAGCAGGTGACACTGAAGTTTCAGGGTTCTCCCACTGTACCTCACCAAATGCT
GCTTCTGCTGCAGACTGCTCCTGTCTGCACGTCAGTGTGACAGAGGTGGTCAAGACCTCCAATCTGGCAGGAAGGTCGTTCACGACATCGACGAACACCTTCCGAACATCCAGTATCCAAGTCCAGAG
CCAAGACCAGAGGCTGCTCACACTGTGGCTGGACAAGGATGGCCGGCGGACTTTCAGGGATGTGGTCAGATTTGAGGCTGGTCCCTGCCCAGAGCCATGTTCTCGGGCCCAGAAATCCAAGATGTCAG
CGTTCAATTCACATGGGCAGGAGACAGAAAAGAGCATGACCAAACCCAATTCTCTTCTGATGCCCATCAACACATTCTCTGGCATCATCCAGTGA

hide sequence

RefSeq Acc Id:

XM_039086574 ⟹ XP_038942502

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	53,704,645 - 53,754,113 (+)	NCBI
mRatBN7.2	10	53,205,758 - 53,255,229 (+)	NCBI

RefSeq Acc Id:

XM_039086575 ⟹ XP_038942503

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	53,704,645 - 53,754,113 (+)	NCBI
mRatBN7.2	10	53,205,758 - 53,255,229 (+)	NCBI

RefSeq Acc Id:

XM_039086576 ⟹ XP_038942504

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	53,704,645 - 53,754,113 (+)	NCBI
mRatBN7.2	10	53,205,757 - 53,255,229 (+)	NCBI

RefSeq Acc Id:

XM_039086577 ⟹ XP_038942505

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	53,719,994 - 53,754,113 (+)	NCBI
mRatBN7.2	10	53,221,105 - 53,255,229 (+)	NCBI

RefSeq Acc Id:

XM_039086578 ⟹ XP_038942506

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	53,704,645 - 53,754,113 (+)	NCBI
mRatBN7.2	10	53,205,757 - 53,255,229 (+)	NCBI

RefSeq Acc Id:

XM_039086579 ⟹ XP_038942507

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	53,704,680 - 53,754,113 (+)	NCBI
mRatBN7.2	10	53,205,793 - 53,255,229 (+)	NCBI

RefSeq Acc Id:

XM_039086580 ⟹ XP_038942508

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	53,702,822 - 53,733,343 (+)	NCBI
mRatBN7.2	10	53,203,932 - 53,234,460 (+)	NCBI

RefSeq Acc Id:

XM_039086581 ⟹ XP_038942509

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	53,702,821 - 53,733,662 (+)	NCBI
mRatBN7.2	10	53,203,930 - 53,234,779 (+)	NCBI

RefSeq Acc Id:

XR_005489905

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	53,704,638 - 53,743,738 (+)	NCBI
mRatBN7.2	10	53,205,749 - 53,244,853 (+)	NCBI

RefSeq Acc Id:

XR_005489906

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	53,704,637 - 53,743,738 (+)	NCBI
mRatBN7.2	10	53,205,749 - 53,244,853 (+)	NCBI

RefSeq Acc Id:

XR_005489907

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	53,704,640 - 53,743,738 (+)	NCBI
mRatBN7.2	10	53,205,751 - 53,244,853 (+)	NCBI

RefSeq Acc Id:

XR_005489908

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	53,703,248 - 53,736,054 (+)	NCBI
mRatBN7.2	10	53,204,361 - 53,237,174 (+)	NCBI


Protein RefSeqs	NP_001074913	(Get FASTA)	NCBI Sequence Viewer
	XP_038942502	(Get FASTA)	NCBI Sequence Viewer
	XP_038942503	(Get FASTA)	NCBI Sequence Viewer
	XP_038942504	(Get FASTA)	NCBI Sequence Viewer
	XP_038942505	(Get FASTA)	NCBI Sequence Viewer
	XP_038942506	(Get FASTA)	NCBI Sequence Viewer
	XP_038942507	(Get FASTA)	NCBI Sequence Viewer
	XP_038942508	(Get FASTA)	NCBI Sequence Viewer
	XP_038942509	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	ABM92928	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000005405
	ENSRNOP00000005405.5
	ENSRNOP00000083483
	ENSRNOP00000083483.1
	ENSRNOP00000100735

RefSeq Acc Id:

NP_001074913 ⟸ NM_001081444

- UniProtKB:

F1LNJ8 (UniProtKB/TrEMBL), A0A8I6G942 (UniProtKB/TrEMBL), A2TJT9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MESSDVELDFQRSVQAVLRELNTPNPALQSNQGMWRWSLHKKMERNPGKSSVLVRILLRELEKAESEDARRVIIPLLLTLMSVLTKATGITEDLYHRAYTFCTRLLTLPAPYSTVALDCAIRLKTETA
VPGTLYQRTVIAEQNLISELYPYQERVFLFVDPELVSASVCSALLLEIQAAQEQQTPEACMRHVVSHALQAALGEACHTGALNRKLQASSRRVLEYYFHAVVAAIEQVASEDSPSRLGHLERMEEIYC
SLLGTATTRRRCVGDLLQDRLPSIPLPSPYITFHLWTDQEQLWKELVLFLRPRSQLRLSADLDALDLQGFRPDRDLARVSTDSGIERDLPLGNDELPDPSSSEMERAALQRKGGIKKRVWPPDFFMPG
SWDGPPGLHRRTGRPSGDGELLPGVSRVHTARVLVLGDDRMVGRLAQAYYRLRKRETKKFCLTPRLSLQFYYIPVLAPQGTGQDPEASRKPELGELASFLGRVDPWYESTVNTLCPAILKLAEMPPCL
DTSRTVDPFILDVITYYVRMGTQPIYFQLYKVKIFTNLSHDPIEDIFLMELKVKTQDSKSPKEGSSPRRRGAAEGTGAELSMCYQKALLSHRPREVTVSLRATGLVLKAIPAGDTEVSGFSHCTSPNA
ASAADCSCLHVSVTEVVKTSNLAGRSFTTSTNTFRTSSIQVQSQDQRLLTLWLDKDGRRTFRDVVRFEAGPCPEPCSRAQKSKMSAFNSHGQETEKSMTKPNSLLMPINTFSGIIQ

hide sequence

Ensembl Acc Id:

ENSRNOP00000005405 ⟸ ENSRNOT00000005405

RefSeq Acc Id:	XP_038942509 ⟸ XM_039086581
- Peptide Label:	isoform X5

RefSeq Acc Id:	XP_038942508 ⟸ XM_039086580
- Peptide Label:	isoform X5

RefSeq Acc Id:	XP_038942504 ⟸ XM_039086576
- Peptide Label:	isoform X2
- UniProtKB:	A0A8I6G942 (UniProtKB/TrEMBL), A2TJT9 (UniProtKB/TrEMBL)

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-F1LNJ8-F1-model_v2	AlphaFold	F1LNJ8	1-756	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-24633	BioCyc
BioCyc Pathway	PWY-6352 [3-phosphoinositide biosynthesis]	BioCyc
BioCyc Pathway Image	PWY-6352	BioCyc
Ensembl Genes	ENSRNOG00000003992	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000005405	ENTREZGENE
	ENSRNOT00000005405.8	UniProtKB/TrEMBL
	ENSRNOT00000117827	ENTREZGENE
	ENSRNOT00000117827.1	UniProtKB/TrEMBL
	ENSRNOT00000162807	ENTREZGENE
	ENSRNOT00000169773	ENTREZGENE
InterPro	PI3K_1B_gamma_p101_su	UniProtKB/TrEMBL
KEGG Report	rno:497932	UniProtKB/TrEMBL
NCBI Gene	497932	ENTREZGENE
PANTHER	PHOSPHOINOSITIDE 3-KINASE REGULATORY SUBUNIT 6	UniProtKB/TrEMBL
	PTHR15593	UniProtKB/TrEMBL
Pfam	PI3K_1B_p101	UniProtKB/TrEMBL
PhenoGen	Pik3r6	PhenoGen
RatGTEx	ENSRNOG00000003992	RatGTEx
UniProt	A0A8I6G942	ENTREZGENE, UniProtKB/TrEMBL
	A2TJT9	ENTREZGENE, UniProtKB/TrEMBL
	F1LNJ8	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-02-28	Pik3r6	phosphoinositide-3-kinase, regulatory subunit 6	RGD1560850_predicted	similar to Expressed sequence BB220380 (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-07	RGD1560850_predicted	similar to Expressed sequence BB220380 (predicted)	LOC497932	similar to Expressed sequence BB220380	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC497932	similar to Expressed sequence BB220380			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Annotations - SMPDB

Imported Annotations - PID (archival)

BioCyc Pathways